slc30a-8

Overview
Nameslc30a-8 (AKN21628.1)
Smed IDSMED30003463
Length (bp)1361
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc30a-8 (SMED30003463) t-SNE clustered cells

Violin plots show distribution of expression levels for slc30a-8 (SMED30003463) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc30a-8 (SMED30003463) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc30a-8 (SMED30003463) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003463

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003463SMESG000013136.1 dd_Smed_v4_5529_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003463SMESG000013136.1 dd_Smed_v4_5529_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30003463SMESG000013136.1 dd_Smed_v4_5529_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30003463SMESG000013136.1 dd_Smed_v6_5529_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc30a-8 vs. Ensembl Human
Match: SLC30A2 (solute carrier family 30 member 2 [Source:HGNC Symbol;Acc:HGNC:11013])

HSP 1 Score: 377.481 bits (968), Expect = 3.401e-128
Identity = 195/386 (50.52%), Postives = 262/386 (67.88%), Query Frame = 1
Query:  124 EHKEDQQVLIENDACINYYGS----STG---ITRTSSDF---------SDHCH---GPSEAIGVDK-NARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKS--EKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            E KE Q +L    A  +Y GS      G   + R   D          + HCH   GP       K  A+++L VAS +CL+FMIGE+VGG +A SLA+MTDAAHLLTDFAS +ISLF+++++SRPATK M+FGW RAE++GALVSVL IWVVTG+LVYLAV R++S +++I+GG MLITS   + +N+IM  TLHQ G               HGHSHG +  ++EN +VRAAFIHVIGD +QS+GV +AA ++Y KP+YK  DPICTF+FSILVL TT+ ILRD ++VLMEGTPK +DF  V+     + GV  +H+L +W+LT+++  LSVHIAI  + +   +L+ AS+ L+ +F    VTIQ+E+Y  +M +CQ CQ P+D
Sbjct:    2 EAKEKQHLLDARPAIRSYTGSLWQEGAGWIPLPRPGLDLQAIELAAQSNHHCHAQKGPDSHCDPKKGKAQRQLYVASAICLLFMIGEVVGGYLAHSLAVMTDAAHLLTDFASMLISLFSLWMSSRPATKTMNFGWQRAEILGALVSVLSIWVVTGVLVYLAVERLISGDYEIDGGTMLITSGCAVAVNIIMGLTLHQSG---------------HGHSHGTTNQQEENPSVRAAFIHVIGDFMQSMGVLVAAYILYFKPEYKYVDPICTFVFSILVLGTTLTILRDVILVLMEGTPKGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDCQACQGPSD 372          
BLAST of slc30a-8 vs. Ensembl Human
Match: SLC30A3 (solute carrier family 30 member 3 [Source:HGNC Symbol;Acc:HGNC:11014])

HSP 1 Score: 327.405 bits (838), Expect = 2.255e-108
Identity = 158/339 (46.61%), Postives = 225/339 (66.37%), Query Frame = 1
Query:  226 HCHG---PSEAIGVDK-NARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHG--HTHGSSKSNNETDKEHGHSHGKSEK---ENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            HCH    P   +  ++ +AR++L  A  +C +FM GE+VGG +A SLAIMTDAAHLL D  S M SLF+++L++RPAT+ M+FGWHR+E +GAL SV+ +W+VTGIL+YLA +R++  ++ IEGG ML+T+   +  NL+MA  LHQ G  H+HGS  +     +E     G  E     N +VRAAF+HV+GDL+QS GV  A+++IY KP+YK ADPI TF+FSI  L +T   LRD + +LMEGTP+++ F  V+     +PGV   H L +W+LT++    S H+AID   +   +L +AS+ L  RF  +  T+Q+E Y  EMA+C +CQ+P  
Sbjct:   54 HCHRDPLPPPGLTPERLHARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAMLLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEE-----GPEEPLPLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRILMEGTPRNVGFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEPPQ 387          
BLAST of slc30a-8 vs. Ensembl Human
Match: SLC30A8 (solute carrier family 30 member 8 [Source:HGNC Symbol;Acc:HGNC:20303])

HSP 1 Score: 298.13 bits (762), Expect = 5.978e-98
Identity = 155/334 (46.41%), Postives = 227/334 (67.96%), Query Frame = 1
Query:  226 HCHGPSEAIGVDKN----ARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            HCH  S+      N    A+ KL  AS +C IFMI E+VGG +A SLA++TDAAHLL D  SF++SLF+++L+S+P +KR++FGWHRAE++GAL+S+L IWVVTG+LVYLA  R++  +++I+  +M+I S   +  N+++   LHQ               +  GH+H K  + N +VRAAF+H +GDL QSI V I+AL+IY KP+YKIADPICTFIFSILVL +TI IL+D  ++LMEG PK L+++ VK     + GV+ VH+L +WSLT+++  LS H+A    +++  + R+ +  L + F +  +TIQ+E+ V +  +C  C+DP D
Sbjct:    3 HCHSGSKPTEKGANEYAYAKWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTGVLVYLACERLLYPDYQIQATVMIIVSSCAVAANIVLTVVLHQ---------------RCLGHNH-KEVQANASVRAAFVHALGDLFQSISVLISALIIYFKPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD 320          
BLAST of slc30a-8 vs. Ensembl Human
Match: SLC30A8 (solute carrier family 30 member 8 [Source:HGNC Symbol;Acc:HGNC:20303])

HSP 1 Score: 298.13 bits (762), Expect = 5.978e-98
Identity = 155/334 (46.41%), Postives = 227/334 (67.96%), Query Frame = 1
Query:  226 HCHGPSEAIGVDKN----ARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            HCH  S+      N    A+ KL  AS +C IFMI E+VGG +A SLA++TDAAHLL D  SF++SLF+++L+S+P +KR++FGWHRAE++GAL+S+L IWVVTG+LVYLA  R++  +++I+  +M+I S   +  N+++   LHQ               +  GH+H K  + N +VRAAF+H +GDL QSI V I+AL+IY KP+YKIADPICTFIFSILVL +TI IL+D  ++LMEG PK L+++ VK     + GV+ VH+L +WSLT+++  LS H+A    +++  + R+ +  L + F +  +TIQ+E+ V +  +C  C+DP D
Sbjct:    3 HCHSGSKPTEKGANEYAYAKWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTGVLVYLACERLLYPDYQIQATVMIIVSSCAVAANIVLTVVLHQ---------------RCLGHNH-KEVQANASVRAAFVHALGDLFQSISVLISALIIYFKPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD 320          
BLAST of slc30a-8 vs. Ensembl Human
Match: SLC30A8 (solute carrier family 30 member 8 [Source:HGNC Symbol;Acc:HGNC:20303])

HSP 1 Score: 298.13 bits (762), Expect = 5.978e-98
Identity = 155/334 (46.41%), Postives = 227/334 (67.96%), Query Frame = 1
Query:  226 HCHGPSEAIGVDKN----ARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            HCH  S+      N    A+ KL  AS +C IFMI E+VGG +A SLA++TDAAHLL D  SF++SLF+++L+S+P +KR++FGWHRAE++GAL+S+L IWVVTG+LVYLA  R++  +++I+  +M+I S   +  N+++   LHQ               +  GH+H K  + N +VRAAF+H +GDL QSI V I+AL+IY KP+YKIADPICTFIFSILVL +TI IL+D  ++LMEG PK L+++ VK     + GV+ VH+L +WSLT+++  LS H+A    +++  + R+ +  L + F +  +TIQ+E+ V +  +C  C+DP D
Sbjct:    3 HCHSGSKPTEKGANEYAYAKWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTGVLVYLACERLLYPDYQIQATVMIIVSSCAVAANIVLTVVLHQ---------------RCLGHNH-KEVQANASVRAAFVHALGDLFQSISVLISALIIYFKPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD 320          
BLAST of slc30a-8 vs. Ensembl Celegans
Match: cdf-2 (Cation Diffusion Facilitator family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVP5])

HSP 1 Score: 340.117 bits (871), Expect = 2.862e-114
Identity = 171/361 (47.37%), Postives = 257/361 (71.19%), Query Frame = 1
Query:  136 DQQVLIENDACINYYGSSTGITRTSSDFSDHCHGPSEAIGV---DKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDP 1209
            ++  L+EN    + Y +  G   T +  + HCH  +++      ++ A + L +  +LCL FM+ E++GG +A SLAI+TDAAHLLTDFAS +ISLF++Y+A RP +++MSFG+HRAEV+GA  SV +IW+VTG+LV LA+MR+VS ++++EGGIM +T+  G+++NL+M A L+      G    ++     HGHSHG    +NINVRAAFIHV+GDL+QS+GV +AAL IY +P + I DPICT +FS++VL TTI ILRD M+VL+EG P ++DF +V ++  D+ GV +VH+LR+WSLT+ K ALSVH+ ID + ++ +ILR+   ML+Q + + ++TIQ+E + +  ++C +C  P
Sbjct:    4 ERAPLLEN-GVPHIYNTDEGRKTTVTYDNFHCHDEADSTDSHDSNRRATRILWLTVVLCLFFMVCEVIGGVLAGSLAIVTDAAHLLTDFASVLISLFSLYIARRPPSQKMSFGFHRAEVLGAFFSVFLIWIVTGVLVVLAIMRIVSGDYEVEGGIMALTAALGVVVNLVMLALLY-----FGGHSHSHGGGSSHGHSHGGGNGDNINVRAAFIHVLGDLLQSLGVLVAALFIYFQPSWVIIDPICTLVFSVIVLCTTIYILRDAMIVLLEGRPSNIDFAKVFSSLEDIEGVKKVHDLRIWSLTMDKIALSVHLEIDANSQSQSILRETRKMLKQTYNVHEITIQIEEFGANRSDCGKCDFP 358          
BLAST of slc30a-8 vs. Ensembl Celegans
Match: ttm-1 (Toxin-regulated Targets of MAPK [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU82])

HSP 1 Score: 261.922 bits (668), Expect = 4.818e-83
Identity = 144/326 (44.17%), Postives = 209/326 (64.11%), Query Frame = 1
Query:  226 HCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQ 1203
            H H   E     + A K L   + L  +F+  E VGG  A SLAIMTDA H+L+D  SF+IS+FAI  A  PA+KR+SFG+ RAEV+GAL SV+++WV+T +LV +A+ R+V+ E +++  +MLIT+  G++ N++M   LH     HG +   + +           + +N+NVRAA IHVIGDLVQSIGV IAAL+I     + +ADPICTF+FSI+VL TT+ ++RD   VLME TP   D ++VK A   L GV  VH+L +WS+ + KTA SVH+A++        + +A +++R+RF +A  T+Q+E +  ++  C  CQ
Sbjct:   87 HKHSHDEKYQKGRRAEKVLWAVAALSAVFIAAEFVGGFWAQSLAIMTDAGHMLSDLLSFIISIFAIRCARLPASKRLSFGYERAEVLGALTSVIILWVLTTVLVVVAIQRIVNNEHEVDADVMLITAGVGVLFNIVMGLVLHFGTGGHGHTHGGHSSHGH------AHDGKNVNVRAALIHVIGDLVQSIGVLIAALIIRFT-GWTLADPICTFLFSIIVLFTTVTVMRDIFFVLMEATPSHYDLSDVKKALSALEGVKGVHDLHLWSIGMDKTAFSVHLALESPNRAMENVAEARSLIRRRFGVAVATVQVEPFDEKIDSCDTCQ 405          
BLAST of slc30a-8 vs. Ensembl Celegans
Match: ttm-1 (Toxin-regulated Targets of MAPK [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU82])

HSP 1 Score: 259.225 bits (661), Expect = 6.002e-83
Identity = 144/314 (45.86%), Postives = 208/314 (66.24%), Query Frame = 1
Query:  262 KNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQ 1203
            + A K L   + L  +F+  E VGG  A SLAIMTDA H+L+D  SF+IS+FAI  A  PA+KR+SFG+ RAEV+GAL SV+++WV+T +LV +A+ R+V+ E +++  +MLIT+  G++ N++M   LH      G     +     HGH+H   + +N+NVRAA IHVIGDLVQSIGV IAAL+I     + +ADPICTF+FSI+VL TT+ ++RD   VLME TP   D ++VK A   L GV  VH+L +WS+ + KTA SVH+A++        + +A +++R+RF +A  T+Q+E +  ++  C  CQ
Sbjct:   22 RRAEKVLWAVAALSAVFIAAEFVGGFWAQSLAIMTDAGHMLSDLLSFIISIFAIRCARLPASKRLSFGYERAEVLGALTSVIILWVLTTVLVVVAIQRIVNNEHEVDADVMLITAGVGVLFNIVMGLVLHF---GTGGHGHTHGGHSSHGHAH---DGKNVNVRAALIHVIGDLVQSIGVLIAALIIRFT-GWTLADPICTFLFSIIVLFTTVTVMRDIFFVLMEATPSHYDLSDVKKALSALEGVKGVHDLHLWSIGMDKTAFSVHLALESPNRAMENVAEARSLIRRRFGVAVATVQVEPFDEKIDSCDTCQ 328          
BLAST of slc30a-8 vs. Ensembl Celegans
Match: ttm-1 (Toxin-regulated Targets of MAPK [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU82])

HSP 1 Score: 259.61 bits (662), Expect = 2.198e-82
Identity = 144/314 (45.86%), Postives = 208/314 (66.24%), Query Frame = 1
Query:  262 KNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQ 1203
            + A K L   + L  +F+  E VGG  A SLAIMTDA H+L+D  SF+IS+FAI  A  PA+KR+SFG+ RAEV+GAL SV+++WV+T +LV +A+ R+V+ E +++  +MLIT+  G++ N++M   LH      G     +     HGH+H   + +N+NVRAA IHVIGDLVQSIGV IAAL+I     + +ADPICTF+FSI+VL TT+ ++RD   VLME TP   D ++VK A   L GV  VH+L +WS+ + KTA SVH+A++        + +A +++R+RF +A  T+Q+E +  ++  C  CQ
Sbjct:   80 RRAEKVLWAVAALSAVFIAAEFVGGFWAQSLAIMTDAGHMLSDLLSFIISIFAIRCARLPASKRLSFGYERAEVLGALTSVIILWVLTTVLVVVAIQRIVNNEHEVDADVMLITAGVGVLFNIVMGLVLHF---GTGGHGHTHGGHSSHGHAH---DGKNVNVRAALIHVIGDLVQSIGVLIAALIIRF-TGWTLADPICTFLFSIIVLFTTVTVMRDIFFVLMEATPSHYDLSDVKKALSALEGVKGVHDLHLWSIGMDKTAFSVHLALESPNRAMENVAEARSLIRRRFGVAVATVQVEPFDEKIDSCDTCQ 386          
BLAST of slc30a-8 vs. Ensembl Celegans
Match: Y105E8A.3 (pep chromosome:WBcel235:I:14358502:14367594:1 gene:WBGene00013668.1 transcript:Y105E8A.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y105E8A.3)

HSP 1 Score: 69.3218 bits (168), Expect = 2.480e-12
Identity = 81/351 (23.08%), Postives = 155/351 (44.16%), Query Frame = 1
Query:  124 EHKEDQQVLIENDACINYYGSSTGITRTSSDFSDHCHGPSEAIGVDKNARKKLLVASILC--LIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ-HGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLEN 1167
            +H+    V I N     +      + RTS             I ++ ++R+   +   LC  L F   E + G   +SL +++D  H+L D ++ ++ L A  +A  P T+  +FG+ R E++   ++ L + V+   ++  A+ R+      I    +L  +I+G+I+NL    +L +      G S   +       H H      N N++  F+HV+ D + S+ V I+ L+I     +   DP+C+ I S+L++ +   +L  ++  L++  P++ +F        ++  V    N  MW         SVH+ +  +     I    SN+L+        T+Q+E 
Sbjct:  353 KHRGGHFVGISNTGLPLFTYGEAFLQRTSKSLMLFMKETLNEILMNNDSRR---IFWFLCVNLGFCGVEFLYGFWTNSLGLISDGFHMLFDCSALVMGLVASVMARWPPTRHFTFGFGRVEILSGFINALFLCVIALFILIEALERLFDPP-NINTDRLLFVAISGLIVNLFGMYSLGEHGHSHGGGSSHGHSHGGGGSHGHSHGGGGNANMQGVFLHVLADTLGSVFVIISTLLIQWF-GWVWVDPLCSLILSLLIIGSVYPLLVSSISTLLQDVPEEEEFEYHINEILEIEHVESYSNAHMWQHKSDINVASVHVQVKEEANAQMIRHRVSNILKST-GATHSTVQVEK 697          
BLAST of slc30a-8 vs. Ensembl Fly
Match: ZnT33D (gene:FBgn0051860 transcript:FBtr0302984)

HSP 1 Score: 342.813 bits (878), Expect = 8.380e-111
Identity = 177/357 (49.58%), Postives = 247/357 (69.19%), Query Frame = 1
Query:  190 TGITRTSSDFSDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTH---GSSKSNNETDKEHGHSH----GKS--------EKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            TG +  ++ +  HCH      GVDK AR+ L++A ILC IF+I E++GG +++SLAI TDAAHLLTD ASF+IS+ A++LA RP+++R+++GWHRAEV+GA+VS+  IWVVTGILVY+A+MR V+ +F+++  IMLITS   I+ N+IMA  L QHGH+H   G  K + +     G       GKS          ENINVRAA IHV+GD++QS GVF+AAL+I+  P++   D +CTF+FS+LVL+ T  ILRD ++VLME TP  +D+ EVK  F  + GV  VHNLR+W+L+I+K ALS H+AI  D +   IL +A+ ++ +RF+  + TIQ+E Y   M  C QC  P+D
Sbjct:  311 TGHSHITAKWDGHCHFKERETGVDKAARRVLIIACILCTIFLILEVIGGILSNSLAIATDAAHLLTDLASFLISISALHLAGRPSSERLNYGWHRAEVIGAMVSIFFIWVVTGILVYMAIMRWVNQDFELDAKIMLITSALAILFNVIMAMQL-QHGHSHSLPGVHKMSKDAGSVLGSKMILLLGKSVSMQYAAKGHENINVRAAIIHVVGDIIQSFGVFVAALIIFFWPEWAFMDSVCTFVFSVLVLVVTFKILRDVLMVLMEATPDFMDYEEVKQTFLSISGVEHVHNLRIWALSINKVALSAHLAISKDADPQLILEEATTLIHKRFKFFETTIQIEEYSPGMENCGQCLSPSD 666          
BLAST of slc30a-8 vs. Ensembl Fly
Match: ZnT35C (gene:FBgn0028516 transcript:FBtr0080715)

HSP 1 Score: 194.126 bits (492), Expect = 1.291e-56
Identity = 96/170 (56.47%), Postives = 131/170 (77.06%), Query Frame = 1
Query:  157 NDACINYYGSSTGITRTSSDF-----SDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLH 651
            NDA + Y  ++T + ++  +       DHCH  + + GVD  AR+KL++ASILCL+FMI EIVGG +++SLAI TDAAHLLTDFASFMISLFAI++A RP+T+RMSFGW+RAEV+GA+ SV MIWV+TGILV+LA+ R++S ++++   IMLITS   I++N+IM   L 
Sbjct:   15 NDARL-YRNAATSLDKSRLEMLHEYVRDHCHR-ARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILVWLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQ 182          

HSP 2 Score: 180.259 bits (456), Expect = 2.253e-51
Identity = 85/168 (50.60%), Postives = 116/168 (69.05%), Query Frame = 1
Query:  706 HGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDP 1209
            HG   G+ E  N+NVRAA IHVIGD++QS+GVF+AA VIY  P+Y I DPICTF+FSI+VL TT  I++D ++VLMEGTP  + + EV   F  + GV  VHNLR+W+L+I+K ALS H+AI  +     IL  A++ +  R+   + TIQ+E+Y ++M  C QC  P
Sbjct:  272 HGGPVGR-EAVNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIVLFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALSINKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQMESCLQCNVP 438          
BLAST of slc30a-8 vs. Ensembl Fly
Match: ZnT35C (gene:FBgn0028516 transcript:FBtr0080714)

HSP 1 Score: 193.741 bits (491), Expect = 3.122e-56
Identity = 91/146 (62.33%), Postives = 120/146 (82.19%), Query Frame = 1
Query:  214 DFSDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLH 651
            +  DHCH  + + GVD  AR+KL++ASILCL+FMI EIVGG +++SLAI TDAAHLLTDFASFMISLFAI++A RP+T+RMSFGW+RAEV+GA+ SV MIWV+TGILV+LA+ R++S ++++   IMLITS   I++N+IM   L 
Sbjct:   70 EVRDHCHR-ARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILVWLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQ 214          

HSP 2 Score: 179.104 bits (453), Expect = 9.741e-51
Identity = 85/168 (50.60%), Postives = 116/168 (69.05%), Query Frame = 1
Query:  706 HGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDP 1209
            HG   G+ E  N+NVRAA IHVIGD++QS+GVF+AA VIY  P+Y I DPICTF+FSI+VL TT  I++D ++VLMEGTP  + + EV   F  + GV  VHNLR+W+L+I+K ALS H+AI  +     IL  A++ +  R+   + TIQ+E+Y ++M  C QC  P
Sbjct:  304 HGGPVGR-EAVNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIVLFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALSINKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQMESCLQCNVP 470          
BLAST of slc30a-8 vs. Ensembl Fly
Match: ZnT33D (gene:FBgn0051860 transcript:FBtr0302985)

HSP 1 Score: 144.05 bits (362), Expect = 5.815e-38
Identity = 63/113 (55.75%), Postives = 89/113 (78.76%), Query Frame = 1
Query:  190 TGITRTSSDFSDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTG 528
            TG +  ++ +  HCH      GVDK AR+ L++A ILC IF+I E++GG +++SLAI TDAAHLLTD ASF+IS+ A++LA RP+++R+++GWHRAEV+GA+VS+  IWVVTG
Sbjct:  311 TGHSHITAKWDGHCHFKERETGVDKAARRVLIIACILCTIFLILEVIGGILSNSLAIATDAAHLLTDLASFLISISALHLAGRPSSERLNYGWHRAEVIGAMVSIFFIWVVTG 423          
BLAST of slc30a-8 vs. Ensembl Fly
Match: ZnT41F (gene:FBgn0025693 transcript:FBtr0086054)

HSP 1 Score: 134.42 bits (337), Expect = 2.996e-34
Identity = 64/130 (49.23%), Postives = 93/130 (71.54%), Query Frame = 1
Query:  262 KNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLH 651
            + A+ K+++A  LC +FMI E +GG +A SLAIMTDAAHL +D  SF+I L AI++  RP  +RMSFG+ R EV+GAL S+L IW VT +LV +A+ R+ S +F++   +M++ S  GI+IN++M   LH
Sbjct:  127 QEAKYKIMLAVALCCVFMIIEFLGGYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRPPDERMSFGYKRFEVIGALASILGIWFVTTLLVVVAIERIFSQDFELNADMMMLISGIGIVINIVMMFVLH 256          

HSP 2 Score: 120.553 bits (301), Expect = 2.391e-29
Identity = 59/146 (40.41%), Postives = 96/146 (65.75%), Query Frame = 1
Query:  730 EKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQ-RFQIADVTIQLE 1164
            E +N+N+RAA IHVIGDLVQSIGVF+AA++I + P  K ADP+CT IFSI+V++TT+ + R+++ +++   P++L+   +      + GV  +H+L +W  T  +  L VH+  D   + + +L+ A+ ++   R+ I   TIQLE
Sbjct:  349 EDKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVCPGAKYADPLCTLIFSIIVIMTTLRLFRESLGIIVNAVPQNLNMRTLHLELGSIEGVRSLHHLNVWQQTSQQRVLMVHLVTDSRADGNEVLQAATALVSSPRYNIKHSTIQLE 494          
BLAST of slc30a-8 vs. Ensembl Zebrafish
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 376.711 bits (966), Expect = 1.036e-127
Identity = 183/383 (47.78%), Postives = 257/383 (67.10%), Query Frame = 1
Query:  106 RGAIFHEHKEDQQVLIENDACINY---YGSSTGITRTSSDFSDHCHGPSEAIGVDKN---ARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHG--HTHGSS----KSNNETDKEHGHSHGK-SEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            R A  +  K + +     ++C N     G   G          HCHG   A    +    A+KKL +ASI+CL+FMIGE++GG +A SLAIMTDAAHLLTDF S M+SLF+++++SRP TK M+FGWHR+E++GAL+SV+ IW+VTG+LVYLA+ R+V  +++IEG +ML+TS   +++N+IMA  LH     H+HGS       +  +   HGHSH       N +VRAAFIHV+GDL+QS GV +AA++IY +P+YKIADPICTF+FS+ VL TT+ ILRD   +LMEG PK + FN VK     L  V  +H+L +W+LT+S++ LSVHIAI+ + +  ++L++A+ +L+ +F     TIQ+E Y  +M  C QCQDP D
Sbjct:   16 RNAKIYSLKLNSEFSGSKESCPNLPLGNGEMAGAIELKRPVGTHCHGKKAAYDDSREKLLAKKKLFIASIVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFGSMMVSLFSLWISSRPPTKIMNFGWHRSEILGALISVMSIWIVTGVLVYLAIERIVKNDYEIEGRVMLLTSGCAVVVNIIMAYILHHSTTFHSHGSGYHKIDESGMSPVGHGHSHSLLGNHGNTSVRAAFIHVLGDLLQSFGVMVAAIIIYFRPEYKIADPICTFLFSVFVLATTLTILRDVFRILMEGAPKGIQFNSVKEVLLSLKAVKAMHSLHLWALTLSQSLLSVHIAIEENADPQSVLKEATELLQTKFGFYSTTIQVEPYSEDMIHCTQCQDPMD 398          
BLAST of slc30a-8 vs. Ensembl Zebrafish
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 374.015 bits (959), Expect = 2.292e-127
Identity = 176/340 (51.76%), Postives = 245/340 (72.06%), Query Frame = 1
Query:  226 HCHGPSEAIGVDKN---ARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHG--HTHGSS----KSNNETDKEHGHSHGK-SEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            HCHG   A    +    A+KKL +ASI+CL+FMIGE++GG +A SLAIMTDAAHLLTDF S M+SLF+++++SRP TK M+FGWHR+E++GAL+SV+ IW+VTG+LVYLA+ R+V  +++IEG +ML+TS   +++N+IMA  LH     H+HGS       +  +   HGHSH       N +VRAAFIHV+GDL+QS GV +AA++IY +P+YKIADPICTF+FS+ VL TT+ ILRD   +LMEG PK + FN VK     L  V  +H+L +W+LT+S++ LSVHIAI+ + +  ++L++A+ +L+ +F     TIQ+E Y  +M  C QCQDP D
Sbjct:   14 HCHGKKAAYDDSREKLLAKKKLFIASIVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFGSMMVSLFSLWISSRPPTKIMNFGWHRSEILGALISVMSIWIVTGVLVYLAIERIVKNDYEIEGRVMLLTSGCAVVVNIIMAYILHHSTTFHSHGSGYHKIDESGMSPVGHGHSHSLLGNHGNTSVRAAFIHVLGDLLQSFGVMVAAIIIYFRPEYKIADPICTFLFSVFVLATTLTILRDVFRILMEGAPKGIQFNSVKEVLLSLKAVKAMHSLHLWALTLSQSLLSVHIAIEENADPQSVLKEATELLQTKFGFYSTTIQVEPYSEDMIHCTQCQDPMD 353          
BLAST of slc30a-8 vs. Ensembl Zebrafish
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 363.229 bits (931), Expect = 1.831e-123
Identity = 172/334 (51.50%), Postives = 238/334 (71.26%), Query Frame = 1
Query:  226 HCHGPSEAIGVDKN---ARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHG-KSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            HCHG   A    +    A+KKL +ASI+CL+FMIGE++GG +A SLAIMTDAAHLLTDF S M+SLF+++++SRP TK M+FGWHR+E++GAL+SV+ IW+VTG+LVYLA+ R+V  +++IEG +ML+TS   +++N+I       HG  +     +  +   HGHSH       N +VRAAFIHV+GDL+QS GV +AA++IY +P+YKIADPICTF+FS+ VL TT+ ILRD   +LMEG PK + FN VK     L  V  +H+L +W+LT+S++ LSVHIAIDP     ++L++A+ +L+ +F     TIQ+E Y  +M  C QCQDP D
Sbjct:   14 HCHGKKAAYDDSREKLLAKKKLFIASIVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFGSMMVSLFSLWISSRPPTKIMNFGWHRSEILGALISVMSIWIVTGVLVYLAIERIVKNDYEIEGRVMLLTSGCAVVVNII-------HGSGYHKIDESGMSPVGHGHSHSLLGNHGNTSVRAAFIHVLGDLLQSFGVMVAAIIIYFRPEYKIADPICTFLFSVFVLATTLTILRDVFRILMEGAPKGIQFNSVKEVLLSLKAVKAMHSLHLWALTLSQSLLSVHIAIDPQ----SVLKEATELLQTKFGFYSTTIQVEPYSEDMIHCTQCQDPMD 336          
BLAST of slc30a-8 vs. Ensembl Zebrafish
Match: slc30a8 (solute carrier family 30 member 8 [Source:ZFIN;Acc:ZDB-GENE-060315-10])

HSP 1 Score: 352.829 bits (904), Expect = 1.708e-118
Identity = 175/360 (48.61%), Postives = 248/360 (68.89%), Query Frame = 1
Query:  208 SSDFSD--HCHGPSEAI----GVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ--HGHTHGSSKS----NNETDKEHGHSH-------------GKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPA 1212
            S D  D  HCH  + A+       K A+K+L + S +CL+FM+GEI+GG  A SLA+MTDAAHLL D  SF+ISL +++L+SRPAT+ +++GWHRAE++GAL+S+  IW+VTG+LVYLAV R+++  F IEG +MLITS   ++ N+IMA TLHQ  HGH+HG   +    +++  KE+GHSH             GK++  N +VRAAF+HVIGDL+QSI V ++AL+I+ KP+YKIADPICTF+FS+ VL TT  I+RD ++VLMEGTP  +++NEV+     + GV  VHNL +W+LT+++  LS H+A D   +   +LR+ + +   ++    VTIQLE    +  +C  CQDPA
Sbjct:   29 SVDMKDGKHCHDNNRALEDREREKKIAKKRLYIVSAVCLVFMVGEILGGYFAGSLAVMTDAAHLLVDLTSFIISLCSLWLSSRPATRTLNYGWHRAEILGALLSIFTIWLVTGVLVYLAVERIINDNFTIEGTVMLITSGCAVLANIIMALTLHQSGHGHSHGGLSAGHGHSHDHGKENGHSHSDGSHHDVEEQRPGKTQA-NASVRAAFVHVIGDLLQSISVLVSALIIFFKPEYKIADPICTFLFSLFVLGTTFTIMRDIVIVLMEGTPAGVNYNEVRQLLLGVKGVKAVHNLHIWALTMNQAVLSAHVATDETVDPQEVLREMTQVCFTKYSFHSVTIQLEPQADQRPDCSLCQDPA 387          
BLAST of slc30a-8 vs. Ensembl Zebrafish
Match: slc30a8 (solute carrier family 30 member 8 [Source:ZFIN;Acc:ZDB-GENE-060315-10])

HSP 1 Score: 352.443 bits (903), Expect = 1.780e-118
Identity = 176/364 (48.35%), Postives = 250/364 (68.68%), Query Frame = 1
Query:  196 ITRTSSDFSD--HCHGPSEAI----GVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ--HGHTHGSSKS----NNETDKEHGHSH-------------GKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPA 1212
            I   S D  D  HCH  + A+       K A+K+L + S +CL+FM+GEI+GG  A SLA+MTDAAHLL D  SF+ISL +++L+SRPAT+ +++GWHRAE++GAL+S+  IW+VTG+LVYLAV R+++  F IEG +MLITS   ++ N+IMA TLHQ  HGH+HG   +    +++  KE+GHSH             GK++  N +VRAAF+HVIGDL+QSI V ++AL+I+ KP+YKIADPICTF+FS+ VL TT  I+RD ++VLMEGTP  +++NEV+     + GV  VHNL +W+LT+++  LS H+ +DP +    +LR+ + +   ++    VTIQLE    +  +C  CQDPA
Sbjct:   23 IIMPSVDMKDGKHCHDNNRALEDREREKKIAKKRLYIVSAVCLVFMVGEILGGYFAGSLAVMTDAAHLLVDLTSFIISLCSLWLSSRPATRTLNYGWHRAEILGALLSIFTIWLVTGVLVYLAVERIINDNFTIEGTVMLITSGCAVLANIIMALTLHQSGHGHSHGGLSAGHGHSHDHGKENGHSHSDGSHHDVEEQRPGKTQA-NASVRAAFVHVIGDLLQSISVLVSALIIFFKPEYKIADPICTFLFSLFVLGTTFTIMRDIVIVLMEGTPAGVNYNEVRQLLLGVKGVKAVHNLHIWALTMNQAVLSAHVTVDPQE----VLREMTQVCFTKYSFHSVTIQLEPQADQRPDCSLCQDPA 381          
BLAST of slc30a-8 vs. Ensembl Xenopus
Match: slc30a2 (solute carrier family 30 member 2 [Source:NCBI gene;Acc:448552])

HSP 1 Score: 410.609 bits (1054), Expect = 2.831e-141
Identity = 195/338 (57.69%), Postives = 257/338 (76.04%), Query Frame = 1
Query:  220 SDHCHGPSEAIGVD----KNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ--HGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            + HCH   E    +    K AR+KL VAS +CL+FMIGE++GG +A SLAIMTDAAHLLTDFAS MISLFA++++SRPATK M+FGWHRAE++GAL+SVL IWVVTG+LVYLAV R++S +++IEG  MLITS   + +N+IM  TLHQ  HGH+HG   S       H HSH   + +N +VRAAFIHV+GDL+QS+GV IAA VIY KP+YKI DPICTF+FS+LVLITT+ ILRD ++VLMEGTPK +DFN VK     + GV  +H+L +W+LT+++  LSVHIAI+ + ++  +L++AS+ L+ +F     TIQ+ENY  +M +CQ+CQDP+D
Sbjct:   47 NQHCHSNRELDDWNAKEKKRARRKLYVASAVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFASMMISLFALWMSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVERIISGDYEIEGDAMLITSACAVAVNIIMGVTLHQTGHGHSHGDGNS-------HSHSHAAGDHKNPSVRAAFIHVVGDLLQSVGVLIAAYVIYYKPEYKIIDPICTFLFSVLVLITTLTILRDVLLVLMEGTPKGVDFNLVKDTLLSIDGVKALHSLHIWALTVTQPVLSVHIAINENADSQKVLKEASSQLQNKFHFHTTTIQIENYSDDMKDCQECQDPSD 377          
BLAST of slc30a-8 vs. Ensembl Xenopus
Match: slc30a2 (solute carrier family 30 member 2 [Source:NCBI gene;Acc:448552])

HSP 1 Score: 410.609 bits (1054), Expect = 3.162e-141
Identity = 195/338 (57.69%), Postives = 257/338 (76.04%), Query Frame = 1
Query:  220 SDHCHGPSEAIGVD----KNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ--HGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            + HCH   E    +    K AR+KL VAS +CL+FMIGE++GG +A SLAIMTDAAHLLTDFAS MISLFA++++SRPATK M+FGWHRAE++GAL+SVL IWVVTG+LVYLAV R++S +++IEG  MLITS   + +N+IM  TLHQ  HGH+HG   S       H HSH   + +N +VRAAFIHV+GDL+QS+GV IAA VIY KP+YKI DPICTF+FS+LVLITT+ ILRD ++VLMEGTPK +DFN VK     + GV  +H+L +W+LT+++  LSVHIAI+ + ++  +L++AS+ L+ +F     TIQ+ENY  +M +CQ+CQDP+D
Sbjct:   48 NQHCHSNRELDDWNAKEKKRARRKLYVASAVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFASMMISLFALWMSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVERIISGDYEIEGDAMLITSACAVAVNIIMGVTLHQTGHGHSHGDGNS-------HSHSHAAGDHKNPSVRAAFIHVVGDLLQSVGVLIAAYVIYYKPEYKIIDPICTFLFSVLVLITTLTILRDVLLVLMEGTPKGVDFNLVKDTLLSIDGVKALHSLHIWALTVTQPVLSVHIAINENADSQKVLKEASSQLQNKFHFHTTTIQIENYSDDMKDCQECQDPSD 378          
BLAST of slc30a-8 vs. Ensembl Xenopus
Match: ENSXETT00000033890.1 (solute carrier family 30 (zinc transporter), member 3 [Source:NCBI gene;Acc:100497671])

HSP 1 Score: 369.392 bits (947), Expect = 9.585e-125
Identity = 177/341 (51.91%), Postives = 241/341 (70.67%), Query Frame = 1
Query:  226 HCHGPSEAIGVDKN---ARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ----HGHTHGSS------KSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDP 1209
            HCHG S +         AR+KL  A  +C IFMIGE+VGG++A SLAIMTDAAHLLTD  S  +S+F++++++RP TK M+FGWHR+E++GAL SVL IW+VTG+LVYLA  R+++ ++ I+G +MLITS   + +N+IMA  LHQ    HGH+HGS         +N      G  HG     N +VRAAFIHVIGDL+QSIGV +AA+VIY KP+YKIADP+CTF+FSI VL TT+ ILRD   VLMEG P+ + +  VK     + GV  VH+LR+W+LT+S+ A++VH+AID   E  + +R+A+ +LR +F++   T+Q+E Y+ EM EC QC+DP
Sbjct:   58 HCHGASLSSAETNQKLQARRKLYFACAVCFIFMIGEVVGGSLAHSLAIMTDAAHLLTDLGSMCVSIFSLWISTRPPTKSMNFGWHRSEILGALASVLSIWIVTGVLVYLAAARIINNDYDIDGHVMLITSGCAVGVNVIMAYILHQSSPLHGHSHGSGYEKIGESPSNSLALRLGGPHG-----NTSVRAAFIHVIGDLLQSIGVMVAAIVIYFKPQYKIADPLCTFLFSIFVLATTVTILRDVFWVLMEGAPRGIAYGSVKEVLLSVRGVRSVHSLRLWALTLSQNAVTVHLAIDESTEPESAVREATELLRSQFELCHSTVQVERYLEEMEECPQCRDP 393          
BLAST of slc30a-8 vs. Ensembl Xenopus
Match: nbr1 (neighbor of BRCA1 gene 1 [Source:Xenbase;Acc:XB-GENE-949692])

HSP 1 Score: 331.257 bits (848), Expect = 3.335e-110
Identity = 165/338 (48.82%), Postives = 232/338 (68.64%), Query Frame = 1
Query:  226 HCHGPSEAIGVDKN-----ARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ--HGHTHGSSKSNNETDKEHGHSHGKSE---KENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDP 1209
            HCH  ++     +      A+KKL +AS++C +F+  EIVGG +A SLA++TDAAHLL D +SF ISL +++L+S+ +T R++FGWHRAE++GAL+SV+ IW+VTG+LVYLA  R++  ++ I+G +MLITS   +  NL++A  LHQ  HGH+H   K          H H  SE   + N ++RAAFIHVIGDL QSI V I+AL+IY KP+YK+ADPICTFIFSI VLITT+ +LRD + VLMEGTP+ + +++VK +  D+ GV  VH+L +W+LT+++  LS HIA D   E+  IL+D +  +  RF    VTIQ+E    +  EC  C +P
Sbjct:   45 HCHNNNKKAYDARQREQTFAKKKLCIASLICFVFISAEIVGGYIAGSLAVVTDAAHLLVDLSSFFISLCSLWLSSKSSTTRLTFGWHRAEILGALMSVITIWLVTGVLVYLACERLIRPDYTIDGTVMLITSACALGANLVLALILHQSGHGHSHAGGK----------HEHMASEYKPQTNASIRAAFIHVIGDLFQSISVLISALIIYFKPEYKMADPICTFIFSIFVLITTVTVLRDLLTVLMEGTPRGIHYSDVKQSILDVDGVKSVHSLHLWALTMNQVILSAHIATDIVGESKRILKDVTQNVFARFPFHSVTIQVEPIEDQSPECMFCYEP 372          
BLAST of slc30a-8 vs. Ensembl Xenopus
Match: gmip (GEM interacting protein [Source:Xenbase;Acc:XB-GENE-977540])

HSP 1 Score: 256.529 bits (654), Expect = 2.025e-80
Identity = 139/339 (41.00%), Postives = 218/339 (64.31%), Query Frame = 1
Query:  199 TRTSSDFSDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ-HGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQET--HTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQD 1206
             R  ++  + C    E     K  ++KLL+A+ L L+FM+GE+VGG +A+SLAIMTDA H+L+D +S +++L A+ L+S+P  KR +FG+HR EV+ A+VSV++++++TG L+Y A+ R + M++ I G +MLIT+  G+ +NLIM   L Q   H   S      +   HGHSHG     ++ VRAAF+H +GDL QSIGV IAA +I  KP+YKIADPICT+IFS+LV+ TT+ ++ DT+++++EG P+ L+ + +K     +  V  V +L +WSLT  K+A  +H+ + PD  +    +   A ++L +   +    IQ+++Y  E  E  +C D
Sbjct:   86 NRVKTEPCEKCSNHRERRKQGK-VKRKLLLAAALYLLFMVGELVGGYVANSLAIMTDALHMLSDLSSIILTLLALCLSSKPPNKRFTFGFHRLEVLSAIVSVILVYILTGFLLYEAIQRTIHMDYNINGDVMLITAAVGVAVNLIMGILLSQSGHHHSHSHGPAANSPSPHGHSHG-----SLAVRAAFVHALGDLAQSIGVLIAAYIIRFKPEYKIADPICTYIFSVLVVFTTVRLVWDTVLIILEGVPRHLNVDRIKDDLMKIEDVYSVKDLNVWSLTTGKSAAIIHLQLCPDASSKWEEVQNKARHVLLKTHGMYKCFIQIQSYGQE--ESTRCTD 416          
BLAST of slc30a-8 vs. Ensembl Mouse
Match: Slc30a2 (solute carrier family 30 (zinc transporter), member 2 [Source:MGI Symbol;Acc:MGI:106637])

HSP 1 Score: 374.4 bits (960), Expect = 3.425e-127
Identity = 179/320 (55.94%), Postives = 241/320 (75.31%), Query Frame = 1
Query:  262 KNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ--HGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            + AR+KL VAS +CL+FMIGEI+GG +A SLAIMTDAAHLLTDFAS +ISLFA++++SRPATK M+FGWHRAE++GAL+SVL IWVVTG+LVYLAV R++S +++I+G  MLITS   + +NLIM   LHQ  HGH+HG+S+ ++            S+++N +VRAAFIHVIGDL+QS+GV +AA +IY KP+YK  DPICTF+FSILVL TT+ ILRD ++VLMEGTPK +DF  VK     + GV  +H+L +W+LT+++  LSVHIAI  + +   +L+ A + L+ +F    +TIQ+E Y  +M  CQ CQ P +
Sbjct:   64 QRARRKLYVASAICLVFMIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFALWVSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNLIMGLALHQSGHGHSHGNSRDDS------------SQQQNPSVRAAFIHVIGDLLQSVGVLVAAYIIYFKPEYKYVDPICTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTVAQPVLSVHIAIAQNADAQAVLKVARDRLQGKFNFHTMTIQIEKYSEDMKNCQACQGPLE 371          
BLAST of slc30a-8 vs. Ensembl Mouse
Match: Slc30a2 (solute carrier family 30 (zinc transporter), member 2 [Source:MGI Symbol;Acc:MGI:106637])

HSP 1 Score: 351.673 bits (901), Expect = 1.869e-119
Identity = 169/303 (55.78%), Postives = 227/303 (74.92%), Query Frame = 1
Query:  313 MIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ--HGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            MIGEI+GG +A SLAIMTDAAHLLTDFAS +ISLFA++++SRPATK M+FGWHRAE++GAL+SVL IWVVTG+LVYLAV R++S +++I+G  MLITS   + +NLIM   LHQ  HGH+HG+S+ ++            S+++N +VRAAFIHVIGDL+QS+GV +AA +IY KP+YK  DPICTF+FSILVL TT+ ILRD ++VLMEGTPK +DF  VK     + GV  +H+L +W+LT+++  LSVHIAI  + +   +L+ A + L+ +F    +TIQ+E Y  +M  CQ CQ P +
Sbjct:    1 MIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFALWVSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNLIMGLALHQSGHGHSHGNSRDDS------------SQQQNPSVRAAFIHVIGDLLQSVGVLVAAYIIYFKPEYKYVDPICTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTVAQPVLSVHIAIAQNADAQAVLKVARDRLQGKFNFHTMTIQIEKYSEDMKNCQACQGPLE 291          
BLAST of slc30a-8 vs. Ensembl Mouse
Match: Slc30a2 (solute carrier family 30 (zinc transporter), member 2 [Source:MGI Symbol;Acc:MGI:106637])

HSP 1 Score: 351.673 bits (901), Expect = 1.869e-119
Identity = 169/303 (55.78%), Postives = 227/303 (74.92%), Query Frame = 1
Query:  313 MIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ--HGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            MIGEI+GG +A SLAIMTDAAHLLTDFAS +ISLFA++++SRPATK M+FGWHRAE++GAL+SVL IWVVTG+LVYLAV R++S +++I+G  MLITS   + +NLIM   LHQ  HGH+HG+S+ ++            S+++N +VRAAFIHVIGDL+QS+GV +AA +IY KP+YK  DPICTF+FSILVL TT+ ILRD ++VLMEGTPK +DF  VK     + GV  +H+L +W+LT+++  LSVHIAI  + +   +L+ A + L+ +F    +TIQ+E Y  +M  CQ CQ P +
Sbjct:    1 MIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFALWVSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNLIMGLALHQSGHGHSHGNSRDDS------------SQQQNPSVRAAFIHVIGDLLQSVGVLVAAYIIYFKPEYKYVDPICTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTVAQPVLSVHIAIAQNADAQAVLKVARDRLQGKFNFHTMTIQIEKYSEDMKNCQACQGPLE 291          
BLAST of slc30a-8 vs. Ensembl Mouse
Match: Slc30a3 (solute carrier family 30 (zinc transporter), member 3 [Source:MGI Symbol;Acc:MGI:1345280])

HSP 1 Score: 318.161 bits (814), Expect = 1.035e-105
Identity = 158/336 (47.02%), Postives = 229/336 (68.15%), Query Frame = 1
Query:  226 HCHG---PSEAIGVDK-NARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHG--HTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            HCH    P   +  ++  AR++L  A  +C IFM GE+VGG +A SLAIMTDAAHLL D  S + SLF+++L++RPAT+ M+FGWHR+E +GAL SV+ +W+VTGIL+YLA +R++  ++ IE G ML+T+   +  NL+MA  LHQ G  H+HGS+ +     +E GH +  S   N +VRAAF+HV+GDL+QS GV  A+++IY KP+YK+ADPI TF+FSI  L +T   LRD ++VLMEG P+ ++F  V+     +PGV   H+L +W+LT++    S H+AID   +   +L +AS+ L  RF  +  T+Q+E Y  EMA+C +CQ+P+ 
Sbjct:    5 HCHKDPVPQSGLSPERVQARRQLYAACAVCFIFMAGEVVGGYLAHSLAIMTDAAHLLADIGSMLASLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWIVTGILLYLAFLRLLHSDYHIEAGAMLLTASIAVCANLLMAFVLHQTGAPHSHGSTGAEYAPLEE-GHGYPMSLG-NTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKVADPISTFLFSICALGSTAPTLRDVLLVLMEGAPRSVEFEPVRDTLLSVPGVRATHDLHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEPSQ 338          
BLAST of slc30a-8 vs. Ensembl Mouse
Match: Slc30a3 (solute carrier family 30 (zinc transporter), member 3 [Source:MGI Symbol;Acc:MGI:1345280])

HSP 1 Score: 318.931 bits (816), Expect = 3.169e-105
Identity = 158/336 (47.02%), Postives = 228/336 (67.86%), Query Frame = 1
Query:  226 HCHG---PSEAIGVDK-NARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHG--HTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            HCH    P   +  ++  AR++L  A  +C IFM GE+VGG +A SLAIMTDAAHLL D  S + SLF+++L++RPAT+ M+FGWHR+E +GAL SV+ +W+VTGIL+YLA +R++  ++ IE G ML+T+   +  NL+MA  LHQ G  H+HGS+ +      E GH +  S   N +VRAAF+HV+GDL+QS GV  A+++IY KP+YK+ADPI TF+FSI  L +T   LRD ++VLMEG P+ ++F  V+     +PGV   H+L +W+LT++    S H+AID   +   +L +AS+ L  RF  +  T+Q+E Y  EMA+C +CQ+P+ 
Sbjct:   54 HCHKDPVPQSGLSPERVQARRQLYAACAVCFIFMAGEVVGGYLAHSLAIMTDAAHLLADIGSMLASLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWIVTGILLYLAFLRLLHSDYHIEAGAMLLTASIAVCANLLMAFVLHQTGAPHSHGSTGAEY-APLEEGHGYPMSLG-NTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKVADPISTFLFSICALGSTAPTLRDVLLVLMEGAPRSVEFEPVRDTLLSVPGVRATHDLHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEPSQ 387          
BLAST of slc30a-8 vs. UniProt/SwissProt
Match: sp|Q2HJ10|ZNT2_MOUSE (Zinc transporter 2 OS=Mus musculus OX=10090 GN=Slc30a2 PE=1 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 2.396e-126
Identity = 179/320 (55.94%), Postives = 241/320 (75.31%), Query Frame = 1
Query:  262 KNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ--HGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            + AR+KL VAS +CL+FMIGEI+GG +A SLAIMTDAAHLLTDFAS +ISLFA++++SRPATK M+FGWHRAE++GAL+SVL IWVVTG+LVYLAV R++S +++I+G  MLITS   + +NLIM   LHQ  HGH+HG+S+ ++            S+++N +VRAAFIHVIGDL+QS+GV +AA +IY KP+YK  DPICTF+FSILVL TT+ ILRD ++VLMEGTPK +DF  VK     + GV  +H+L +W+LT+++  LSVHIAI  + +   +L+ A + L+ +F    +TIQ+E Y  +M  CQ CQ P +
Sbjct:   64 QRARRKLYVASAICLVFMIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFALWVSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNLIMGLALHQSGHGHSHGNSRDDS------------SQQQNPSVRAAFIHVIGDLLQSVGVLVAAYIIYFKPEYKYVDPICTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTVAQPVLSVHIAIAQNADAQAVLKVARDRLQGKFNFHTMTIQIEKYSEDMKNCQACQGPLE 371          
BLAST of slc30a-8 vs. UniProt/SwissProt
Match: sp|Q62941|ZNT2_RAT (Zinc transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc30a2 PE=2 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 3.599e-119
Identity = 176/335 (52.54%), Postives = 245/335 (73.13%), Query Frame = 1
Query:  226 HCHGPSEAIGVDKN-----ARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            +CH   ++ G   N     AR+KL VAS +CL+FMIGEI+GG +A SLAIMTDAAHLLTDFAS +ISLF+++++SRPATK M+FGW RAE++GAL+SVL IWVVTG+LVYLAV R++S +++I+G  MLITS   + +N+IM   LHQ GH H    S+ ++ +         +++N +VRAAFIHV+GDL+QS+GV +AA +IY KP+YK  DPICTF+FSILVL TT+ ILRD ++VLMEGTPK +DF  VK     + GV  +H+L +W+LT+++  LSVHIAI  + +   +L+ A + L+ +F    +TIQ+E+Y  +M  CQ+CQ P++
Sbjct:   35 YCHAQKDS-GSHPNSEKQRARRKLYVASAICLVFMIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFSLWVSSRPATKTMNFGWQRAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNIIMGLALHQSGHGHSHGHSHEDSSQ---------QQQNPSVRAAFIHVVGDLLQSVGVLVAAYIIYFKPEYKYVDPICTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTVAQPVLSVHIAIAQNVDAQAVLKVARDRLQGKFNFHTMTIQIESYSEDMKSCQECQGPSE 359          
BLAST of slc30a-8 vs. UniProt/SwissProt
Match: sp|Q5XHB4|ZNT8_XENTR (Zinc transporter 8 OS=Xenopus tropicalis OX=8364 GN=slc30a8 PE=2 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 2.599e-108
Identity = 164/338 (48.52%), Postives = 231/338 (68.34%), Query Frame = 1
Query:  226 HCHGPSEAIGVDKN-----ARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ--HGHTHGSSKSNNETDKEHGHSHGKSE---KENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDP 1209
            HCH  ++     +      A+KKL +AS++C +F+  EIVGG +A SLA++TDAAHLL D +SF ISL +++L+S+ +T R++FGWHRAE++GAL+SV+ IW+VTG+LVYLA  R++  ++ I+G +MLITS   +  NL++A  LHQ  HGH+H   K          H H  SE   + N ++RAAFIHVIGDL QSI V I+AL+IY KP+YK+ADPICTFIFSI VLITT+ +LRD + VLMEGTP+ + +++VK +   + GV  VH+L +W+LT+++  LS HIA D   E+  IL+D +  +  RF    VTIQ+E    +  EC  C +P
Sbjct:   45 HCHNNNKKAYDARQREQTFAKKKLCIASLICFVFISAEIVGGYIAGSLAVVTDAAHLLVDLSSFFISLCSLWLSSKSSTTRLTFGWHRAEILGALMSVITIWLVTGVLVYLACERLIRPDYTIDGTVMLITSACALGANLVLALILHQSGHGHSHAGGK----------HEHMASEYKPQTNASIRAAFIHVIGDLFQSISVLISALIIYFKPEYKMADPICTFIFSIFVLITTVTVLRDLLTVLMEGTPRGIHYSDVKQSILAVDGVKSVHSLHLWALTMNQVILSAHIATDIVGESKRILKDVTQNVFARFPFHSVTIQVEPIEDQSPECMFCYEP 372          
BLAST of slc30a-8 vs. UniProt/SwissProt
Match: sp|Q08E25|ZNT3_BOVIN (Zinc transporter 3 OS=Bos taurus OX=9913 GN=SLC30A3 PE=2 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 3.869e-108
Identity = 159/339 (46.90%), Postives = 225/339 (66.37%), Query Frame = 1
Query:  226 HCHG---PSEAIGVDK-NARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHG--HTHGSSKSNNETDKEHGHSHGKSEK---ENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            HCH    P   +  ++  A+++L  A  +C +FM GE+VGG +A SLAIMTDAAHLL D  S M SLF+++L++RPAT+ M+FGWHR+E +GAL SV+ +W+VTGIL+YLA +R++  ++ IEGG ML+T+   +  NL+MA  LHQ G  H+HGS  +     +E     G  E     N +VRAAF+HV+GDL+QS+GV IA+++IY KP+YK ADPI TF+FSI  L +T   LRD + VLMEGTP+ + F  V+     +PGV  +H L +WSLT +    S H+AID   +   +L +A++ L  RF  +  T+Q+E Y  EMA+C +CQ+P  
Sbjct:   54 HCHRDPLPQPGLTPERMQAQRQLCTACAVCCVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFIRLLHSDYHIEGGAMLLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEE-----GSGEPLPLGNTSVRAAFVHVLGDLLQSLGVLIASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRVLMEGTPRSVSFEPVRDTLLSVPGVRAIHELHLWSLTFTHYVASAHLAIDSTADPEAVLAEATSRLHSRFGFSSCTLQVEQYQPEMAQCLRCQEPPQ 387          
BLAST of slc30a-8 vs. UniProt/SwissProt
Match: sp|Q99726|ZNT3_HUMAN (Zinc transporter 3 OS=Homo sapiens OX=9606 GN=SLC30A3 PE=1 SV=2)

HSP 1 Score: 327.405 bits (838), Expect = 1.083e-107
Identity = 158/339 (46.61%), Postives = 225/339 (66.37%), Query Frame = 1
Query:  226 HCHG---PSEAIGVDK-NARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHG--HTHGSSKSNNETDKEHGHSHGKSEK---ENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            HCH    P   +  ++ +AR++L  A  +C +FM GE+VGG +A SLAIMTDAAHLL D  S M SLF+++L++RPAT+ M+FGWHR+E +GAL SV+ +W+VTGIL+YLA +R++  ++ IEGG ML+T+   +  NL+MA  LHQ G  H+HGS  +     +E     G  E     N +VRAAF+HV+GDL+QS GV  A+++IY KP+YK ADPI TF+FSI  L +T   LRD + +LMEGTP+++ F  V+     +PGV   H L +W+LT++    S H+AID   +   +L +AS+ L  RF  +  T+Q+E Y  EMA+C +CQ+P  
Sbjct:   54 HCHRDPLPPPGLTPERLHARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAMLLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEE-----GPEEPLPLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRILMEGTPRNVGFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEPPQ 387          
BLAST of slc30a-8 vs. TrEMBL
Match: A0A0H3YKE4 (Slc30a-8 OS=Schmidtea mediterranea OX=79327 GN=slc30a-8 PE=2 SV=1)

HSP 1 Score: 791.956 bits (2044), Expect = 0.000e+0
Identity = 384/384 (100.00%), Postives = 384/384 (100.00%), Query Frame = 1
Query:   64 MAKEFVKRNIPSVVRGAIFHEHKEDQQVLIENDACINYYGSSTGITRTSSDFSDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            MAKEFVKRNIPSVVRGAIFHEHKEDQQVLIENDACINYYGSSTGITRTSSDFSDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD
Sbjct:    1 MAKEFVKRNIPSVVRGAIFHEHKEDQQVLIENDACINYYGSSTGITRTSSDFSDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 384          
BLAST of slc30a-8 vs. TrEMBL
Match: A0A504YFT6 (Zinc transporter OS=Fasciola gigantica OX=46835 GN=FGIG_05430 PE=4 SV=1)

HSP 1 Score: 460.299 bits (1183), Expect = 3.166e-157
Identity = 221/365 (60.55%), Postives = 284/365 (77.81%), Query Frame = 1
Query:  199 TRTSSDFSD----HCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATL---------------------HQHGHTHGSSKSNNETDKEHG---HSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDP 1209
            T +++++SD    HCH  + ++ VDK AR+KL++AS LCL+FMIGEIVGGA+A SLAIMTDAAHLLTDFASF+ISL A++LASRP+TK+MSFGWHRAEVVGAL SVLMIW+VTGILVYLAVMRV+   ++I+G IMLITSI G+ +N+IM  TL                     H HG +H  S SN   D EH     +  +++++NI VRAA IHVIGDLVQS+GVF+AA++I+ KP  K+ DPICTF+FSILVLITTINILRDT+ VLME TP+ L+FNEVK A  D+PGV+E+HNLRMWSLT++KTA+SVH+AID + ++  ILR AS++LR R+ + +VTIQ+E Y+ EMA+CQ+CQ+P
Sbjct:   36 TSSAAEYSDGARGHCHDSATSVSVDKQARRKLVLASGLCLVFMIGEIVGGALAQSLAIMTDAAHLLTDFASFLISLLALFLASRPSTKKMSFGWHRAEVVGALASVLMIWLVTGILVYLAVMRVIHQHYEIDGKIMLITSIIGVCVNIIMVLTLHDHGHGHSHGGGPSDRSPLKGHSHGGSHEHSHSNGAGDHEHKVDQRTQREAQRQNITVRAALIHVIGDLVQSLGVFVAAMIIFFKPSLKVVDPICTFVFSILVLITTINILRDTLNVLMEATPRGLEFNEVKNALNDIPGVVELHNLRMWSLTMNKTAVSVHLAIDREYDSQEILRQASSLLRMRYLVHEVTIQMEPYIPEMADCQRCQEP 400          
BLAST of slc30a-8 vs. TrEMBL
Match: A0A267DB27 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021642g1 PE=4 SV=1)

HSP 1 Score: 454.907 bits (1169), Expect = 2.041e-155
Identity = 223/358 (62.29%), Postives = 275/358 (76.82%), Query Frame = 1
Query:  172 NYYGSSTGITRTSSDFSDHCHGPSE------AIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGS----SKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            +Y+    G T + S+   HCH   +      A+G  + AR+KL VAS+LCL+FM GEIVGGA+A+SLAIMTDAAHLLTDFASFMISL A+YLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLA+ RVV+  F+++G  MLITS  G+ +N+IMA TLHQHGH+HG+    S +NN  + +HGHS      +NINVRAAFIHV+GD +QS+GV  AA VIY +P  K+ADPICTF+FSILVL TT +ILRDTM VLME TPK LDFN VK     +PGVIEVHNLR+WSLT++KTA+S H+A+  D     +L  A+ +++QRFQ+ +VT+Q+E YV  MA+C+ CQDP D
Sbjct:   31 SYHAMQRG-TSSDSEAGLHCHASEQVREQLLALG-QRTARRKLWVASLLCLLFMAGEIVGGAIANSLAIMTDAAHLLTDFASFMISLLALYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAIERVVNQNFEVQGQAMLITSGVGVAVNIIMAVTLHQHGHSHGTDHGHSHANNHGNDDHGHS-----DQNINVRAAFIHVVGDFLQSLGVLCAAFVIYYRPDLKLADPICTFLFSILVLFTTFSILRDTMRVLMEATPKGLDFNIVKETLASVPGVIEVHNLRLWSLTMNKTAVSAHLAVVKDANQQELLLAATRLVKQRFQLHEVTVQIEEYVEAMADCEHCQDPQD 381          
BLAST of slc30a-8 vs. TrEMBL
Match: A0A267DEN5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031079g1 PE=4 SV=1)

HSP 1 Score: 454.136 bits (1167), Expect = 4.677e-155
Identity = 223/358 (62.29%), Postives = 274/358 (76.54%), Query Frame = 1
Query:  172 NYYGSSTGITRTSSDFSDHCHGPSE------AIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHT----HGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            +Y+    G T + S+   HCH   +      A+G  + AR+KL VAS+LCL+FM GEIVGGA+A+SLAIMTDAAHLLTDFASFMISL A+YLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLA+ RVV+  F+++G  MLITS  G+ +N+IMA TLHQHGH+    HG S +NN  + +HGHS      +NINVRAAFIHV+GD +QS+GV  AA VIY +P  K+ADPICTF+FSILVL TT +ILRDTM VLME TPK LDFN VK     +PGVIEVHNLR+WSLT++KTA+S H+A+  D     +L  A+ +++QRFQ+ +VT+Q+E YV  MA+C+ CQDP D
Sbjct:   31 SYHAMQRG-TSSDSEAGLHCHASEQVREQLLALG-QRTARRKLWVASLLCLLFMAGEIVGGAIANSLAIMTDAAHLLTDFASFMISLLALYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAIERVVNQNFEVQGQAMLITSGVGVAVNIIMAVTLHQHGHSLGTDHGHSHANNHGNDDHGHS-----DQNINVRAAFIHVVGDFLQSLGVLCAAFVIYYRPDLKLADPICTFLFSILVLFTTFSILRDTMRVLMEATPKGLDFNIVKETLASVPGVIEVHNLRLWSLTMNKTAVSAHLAVVKDANQQELLLAATRLVKQRFQLHEVTVQIEEYVEAMADCEHCQDPQD 381          
BLAST of slc30a-8 vs. TrEMBL
Match: A0A4E0RCI3 (Zinc transporter OS=Fasciola hepatica OX=6192 GN=D915_002750 PE=4 SV=1)

HSP 1 Score: 454.521 bits (1168), Expect = 6.703e-155
Identity = 219/365 (60.00%), Postives = 283/365 (77.53%), Query Frame = 1
Query:  205 TSSDFSD----HCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATL-----------------------HQHGHTHGSSKSNNETDKEHG---HSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDP 1209
            +++++SD    HCH  + ++ VDK AR+KL++AS LCL+FMIGEIVGGA+A SLAIMTDAAHLLTDFASF+ISL A++LASRP+TK+MSFGWHRAEVVGAL SVLMIW+VTGILVYLAVMRV+   ++I+G IMLITSI G+ +N+IM  TL                       H HG +H  S S+   D EH     +  +++++NI VRAA IHVIGDLVQS+GVF+AA++I+ KP  K+ DPICTF+FSILVLITTINILRDT+ VLME TP+ L+FNEVK A  D+PGV+E+HNLRMWSLT++KTA+SVH+AID + ++  ILR AS++LR R+ + +VTIQ+E Y+ EMA+CQ+CQ+P
Sbjct:   41 SAAEYSDGVRGHCHDSATSVSVDKQARRKLVLASGLCLVFMIGEIVGGALAQSLAIMTDAAHLLTDFASFLISLLALFLASRPSTKKMSFGWHRAEVVGALASVLMIWLVTGILVYLAVMRVIHQHYEIDGKIMLITSIIGVCVNIIMVLTLHDHGHGHGHSHGGGPSDRSPLTGHSHGGSHEHSHSDGAGDHEHKVDQRTQREAQRQNITVRAALIHVIGDLVQSLGVFVAAMIIFFKPSLKVVDPICTFVFSILVLITTINILRDTLNVLMEATPRGLEFNEVKNALNDIPGVVELHNLRMWSLTMNKTAVSVHLAIDREYDSQEILRQASSLLRMRYLVHEVTIQMEPYIPEMADCQRCQEP 405          
BLAST of slc30a-8 vs. Ensembl Cavefish
Match: slc30a2 (zinc transporter 2 [Source:NCBI gene;Acc:103036936])

HSP 1 Score: 372.089 bits (954), Expect = 4.299e-126
Identity = 175/355 (49.30%), Postives = 249/355 (70.14%), Query Frame = 1
Query:  181 GSSTGITRTSSDFSDHCHGPSEAIGVDKN---ARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ----HGHTHGSSK--SNNETDKEHGHSHGK-SEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            G + G          HCHG   A   ++    A+KKL +ASI+CL+FMIGE++GG +A SLAIMTDAAHLLTDF S M+SLF+++++SRP TK M+FG+HR+E++GA +SV+ IW+VTG+LVYLA+ R+V  +++IEG +ML+TS   +++N+IMA  LH     HGH  G  K   N  +   HGHSH   S   N +VRAAFIHV+GDL+QS GV +AA++IY +P+YK+ADPICTF+FS+ VL TTI ILRD   +LMEG P+ ++FN VK     L  V  +H+L +W+LT+ ++ +SVH+AI+ + +  ++L++A+ +L+ +F     TIQ+E Y  +MA C  CQDP D
Sbjct:   44 GDTAGAIELKRPTGTHCHGKKTAWEENREKLVAKKKLYIASIVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFGSMMVSLFSLWISSRPPTKTMNFGFHRSEILGAFISVMSIWIVTGVLVYLAIERIVKNDYEIEGHVMLLTSGCAVVVNIIMAYILHHSTTFHGHGSGYHKIDENGMSPVGHGHSHSLLSGHGNTSVRAAFIHVLGDLLQSFGVLVAAIIIYFRPEYKVADPICTFLFSVFVLGTTITILRDVFRILMEGAPRGIEFNSVKEVLLSLKAVKAIHSLHLWALTVGQSLVSVHVAIEENADHQSVLKEATELLQTKFGFYSTTIQIEPYCEDMAYCTLCQDPVD 398          
BLAST of slc30a-8 vs. Ensembl Cavefish
Match: slc30a8 (solute carrier family 30 member 8 [Source:ZFIN;Acc:ZDB-GENE-060315-10])

HSP 1 Score: 363.999 bits (933), Expect = 6.510e-123
Identity = 186/395 (47.09%), Postives = 262/395 (66.33%), Query Frame = 1
Query:  133 EDQQVLIENDACINYYGSSTGITRTSSDF----SDHCHGPSEAI----GVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ--HGHTHG--SSKSNNET-------DKEHGHSH---------------GKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            + ++ L+  D   N Y + T  + +S D     S HCH  S A        K ARK+L + S++CL+FM+GEI+GG  A SLA+MTDAAHLL DF SF+ISL +++L+SRPAT  +++GWHRAE++GAL+SV  IW+VTG+LVYLAV R++S +++IEG +MLITS   ++ N+IMA TLHQ  HGH+HG  SS+ +  +       +K++GHSH               GK  +EN +VRAAF+HVIGDL+QSI V ++AL+I+ +P+YK+ADPICTF+FS+ VL TT  I+RD +VVLMEGTP  +D+ EV+     + GV  VHNL +W+LT+++  LS H+AID   E   +LR+ +      +    VTIQLE    +  +C  CQDP +
Sbjct:    5 DPEKALLVKDKAANMY-TITMESVSSGDMVLKDSKHCHDSSHAFEDREKEKKVARKRLYIVSVVCLVFMVGEILGGYFAGSLAVMTDAAHLLVDFTSFIISLCSLWLSSRPATHTLNYGWHRAEILGALLSVFTIWLVTGVLVYLAVERLISDDYEIEGTVMLITSGCAVLANIIMALTLHQSGHGHSHGGLSSQGHGHSHSGAHSHEKKNGHSHAYANGDSHNPENKTTGKKTQENASVRAAFVHVIGDLLQSISVLVSALIIFFRPEYKMADPICTFLFSLFVLGTTFTIMRDILVVLMEGTPAGVDYREVRERLLSVKGVKAVHNLHIWALTMNQAVLSAHVAIDDATEPQVVLREITQSCFTTYSFHSVTIQLEQQEDQRPDCTLCQDPKN 398          
BLAST of slc30a-8 vs. Ensembl Cavefish
Match: SLC30A2 (zinc transporter 2-like [Source:NCBI gene;Acc:103045971])

HSP 1 Score: 334.724 bits (857), Expect = 7.570e-112
Identity = 161/333 (48.35%), Postives = 227/333 (68.17%), Query Frame = 1
Query:  226 HCHGPSEAIGVDKN---ARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            HCH    A   ++    A +KLL+ SILCL+FMIGE++GG  A SLA+MTDAAHLLTDF S +ISLF+++++SRPA+K M++GWHR+EV+G L+SVL IW VT +LV++A+ R++  +++I  G MLITS   +I+N++MA  LHQ                   H        N +VRAAFIHV+GDL+QS+GV +AA +IY  P++KIADP+CTF+FSIL+L TT  IL+D   +LMEGTP  +DF+ VK A   + GV  +H+L +W+LT+S+  +SVH  ID      T+L D + ML+  F   ++TIQ+E Y ++ A C++CQDP D
Sbjct:   48 HCHNSRAAWAQNEEKSGAWRKLLITSILCLVFMIGEVIGGYAAHSLAVMTDAAHLLTDFGSILISLFSLWISSRPASKTMTYGWHRSEVLGGLLSVLSIWAVTAVLVFIAIQRILQNDYEIHSGAMLITSGCAVIVNILMALILHQ----------------SPAHHGHSHGHSNTSVRAAFIHVVGDLLQSLGVALAATIIYFWPEWKIADPVCTFLFSILILATTSTILKDIFKILMEGTPHGIDFDFVKEALLAVRGVKSIHSLHLWALTMSQPQISVHTVIDEQTSPQTVLLDLTEMLQSDFNFHNITIQIETYSNDAAHCRECQDPID 364          
BLAST of slc30a-8 vs. Ensembl Cavefish
Match: SLC30A2 (zinc transporter 2-like [Source:NCBI gene;Acc:103045971])

HSP 1 Score: 333.954 bits (855), Expect = 9.990e-112
Identity = 161/333 (48.35%), Postives = 227/333 (68.17%), Query Frame = 1
Query:  226 HCHGPSEAIGVDK---NARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            HCH    A   ++    A +KLL+ SILCL+FMIGE++GG  A SLA+MTDAAHLLTDF S +ISLF+++++SRPA+K M++GWHR+EV+G L+SVL IW VT +LV++A+ R++  +++I  G MLITS   +I+N++MA  LHQ                   H        N +VRAAFIHV+GDL+QS+GV +AA +IY  P++KIADP+CTF+FSIL+L TT  IL+D   +LMEGTP  +DF+ VK A   + GV  +H+L +W+LT+S+  +SVH  ID      T+L D + ML+  F   ++TIQ+E Y ++ A C++CQDP D
Sbjct:   35 HCHNSRAAWAQNEEKSGAWRKLLITSILCLVFMIGEVIGGYAAHSLAVMTDAAHLLTDFGSILISLFSLWISSRPASKTMTYGWHRSEVLGGLLSVLSIWAVTAVLVFIAIQRILQNDYEIHSGAMLITSGCAVIVNILMALILHQ----------------SPAHHGHSHGHSNTSVRAAFIHVVGDLLQSLGVALAATIIYFWPEWKIADPVCTFLFSILILATTSTILKDIFKILMEGTPHGIDFDFVKEALLAVRGVKSIHSLHLWALTMSQPQISVHTVIDEQTSPQTVLLDLTEMLQSDFNFHNITIQIETYSNDAAHCRECQDPID 351          
BLAST of slc30a-8 vs. Ensembl Cavefish
Match: slc30a8 (solute carrier family 30 member 8 [Source:ZFIN;Acc:ZDB-GENE-060315-10])

HSP 1 Score: 327.405 bits (838), Expect = 2.972e-109
Identity = 168/369 (45.53%), Postives = 238/369 (64.50%), Query Frame = 1
Query:  133 EDQQVLIENDACINYYGSSTGITRTSSDF----SDHCHGPSEAI----GVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            + ++ L+  D   N Y + T  + +S D     S HCH  S A        K ARK+L + S++CL+FM+GEI+GG  A SLA+MTDAAHLL DF SF+ISL +++L+SRPAT  +++GWHRAE++GAL+SV  IW+VTG+LVYLAV R++S +++IEG +MLITS   ++ N+IMA TLHQ                        S   + +  +AF+HVIGDL+QSI V ++AL+I+ +P+YK+ADPICTF+FS+ VL TT  I+RD +VVLMEGTP  +D+ EV+     + GV  VHNL +W+LT+++  LS H+AID   E   +LR+ +      +    VTIQLE    +  +C  CQDP +
Sbjct:    5 DPEKALLVKDKAANMY-TITMESVSSGDMVLKDSKHCHDSSHAFEDREKEKKVARKRLYIVSVVCLVFMVGEILGGYFAGSLAVMTDAAHLLVDFTSFIISLCSLWLSSRPATHTLNYGWHRAEILGALLSVFTIWLVTGVLVYLAVERLISDDYEIEGTVMLITSGCAVLANIIMALTLHQ------------------------SGHGHGHSHSAFVHVIGDLLQSISVLVSALIIFFRPEYKMADPICTFLFSLFVLGTTFTIMRDILVVLMEGTPAGVDYREVRERLLSVKGVKAVHNLHIWALTMNQAVLSAHVAIDDATEPQVVLREITQSCFTTYSFHSVTIQLEQQEDQRPDCTLCQDPKN 348          
BLAST of slc30a-8 vs. Ensembl Sea Lamprey
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 347.436 bits (890), Expect = 3.558e-117
Identity = 166/325 (51.08%), Postives = 236/325 (72.62%), Query Frame = 1
Query:  253 GVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHR-AEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ--HGHTHGSSKSNNETDKEHGHSHGK--SEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPA 1212
            G  ++AR+KL +A+++CL+FM GEI GG +A SLAIMTDAAHL  DFASF ISLF+++++SRP TK M+FGW+R  E++GAL+SVL IWVVTG+LVYLA +R++  +F+IEG  ML+TS   I +N+IM+ TL+Q  H H+HG   ++    K    + G     + N +VRAAFIHV+GDL+QSIGV IAA VIY +P+YKIADPICTF+FS  VL TT+ ILRD ++VLMEG P+ + F +V+ A   LP V  VH++ +WSLTI+  A+  H+ +D   +   ++R+A+ +L+ RF  + +TIQ+E +  +M  C+ CQ+P+
Sbjct:   64 GERRHARRKLCIAAVICLLFMAGEIFGGFLAHSLAIMTDAAHLFADFASFSISLFSLWVSSRPPTKTMNFGWYRMPEILGALLSVLTIWVVTGVLVYLASLRLIYKDFEIEGTAMLVTSGCAIAVNVIMSFTLYQANHLHSHGGVTADATEPKPLTMAEGPVSGPQANPSVRAAFIHVVGDLLQSIGVLIAACVIYAEPEYKIADPICTFVFSFFVLFTTVTILRDVLLVLMEGAPRAVKFTDVQEALLALPHVCSVHDVHLWSLTINHCAICAHVCVDDIGKGEEVVREATVVLQTRFSFSVLTIQVEKFTEDMHSCRDCQEPS 388          
BLAST of slc30a-8 vs. Ensembl Sea Lamprey
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 201.83 bits (512), Expect = 3.791e-63
Identity = 102/189 (53.97%), Postives = 135/189 (71.43%), Query Frame = 1
Query:  265 NARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLK 831
             A+++L + S++C +F+IGE VGG +A SLAIMTD AHLLTDFASF ISL +++LA RP +KRM+FGW+RAE++GAL+S+  IWVVTG+LVYLA  R++S +F IEG  ML TS   +I+N IM   LH   H              HGHSH +S   N ++RAAFIH +GDL+QSIGV +AA +I+ K
Sbjct:    1 RAKRQLYLVSVICFVFIIGEAVGGILAHSLAIMTDVAHLLTDFASFSISLLSLWLADRPTSKRMTFGWYRAEILGALLSIFSIWVVTGVLVYLAACRMISRDFAIEGTAMLATSACAVIVN-IMCVRLHTVSH--------------HGHSHLQSH-SNPSIRAAFIHALGDLLQSIGVLVAACIIFFK 173          
BLAST of slc30a-8 vs. Ensembl Sea Lamprey
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 182.57 bits (462), Expect = 3.600e-56
Identity = 89/168 (52.98%), Postives = 119/168 (70.83%), Query Frame = 1
Query:  361 MTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKE----HGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIAD 852
            MTD AHLLTDFASF ISL +++LA RP +KRM+FGW+RAE++GAL+S+  IWVVTG+LVYLA  R++S +F IEG  ML TS   +I+N+IMA  L +  H+ G S  +          HGHSH +S   N ++RAAFIH +GDL+QSIGV +AA +I+ KP   + +
Sbjct:    1 MTDVAHLLTDFASFSISLLSLWLADRPTSKRMTFGWYRAEILGALLSIFSIWVVTGVLVYLAACRMISRDFAIEGTAMLATSACAVIVNIIMAVLLARGHHSSGPSGDSEAPPAVPLHLHGHSHLQSH-SNPSIRAAFIHALGDLLQSIGVLVAACIIFFKPPLPMPE 167          
BLAST of slc30a-8 vs. Ensembl Sea Lamprey
Match: slc30a10 (solute carrier family 30 member 10 [Source:ZFIN;Acc:ZDB-GENE-060608-2])

HSP 1 Score: 110.923 bits (276), Expect = 7.915e-28
Identity = 74/279 (26.52%), Postives = 138/279 (49.46%), Query Frame = 1
Query:  295 ILCL--IFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGG-IMLITSIAGIIINLI----------MAATLHQHGHTHGSSKSNNET-DKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYK--------IADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHI 1065
            +LC   +F + E+V G + +SLA++ D+ ++L+D  S    L +  LA  PAT R ++G  R EVV AL +   + V   + V +  ++ +S    I+   ++LI    G+ +NL            +    +     G+      T D+E G S  +S++  IN+R   +H +GD + S+ V I A++  ++P             DP  T   +++++ + + ++R+  V+L++  P D+   +++     +PGV  +H L +W LT  +   SVHI
Sbjct:   14 MLCFTSVFFVTELVSGYVGNSLALVADSFNMLSDALSLTSGLASARLARWPATSRHTYGLVRGEVVSALATASFL-VALSLSVAVQALKALSQPDVIDNPRLVLIVGALGLSVNLTGLMLFQDCFSCSRLCARFNAAEGTDDRKPRTGDEEMGASVKRSKENAINIRGVLLHTLGDALGSVTVVITAIIFNVRPIASKEECNWQCYIDPALTIAMTLIIITSAVRLIREAAVILLQIVPPDILIKDIEQKLSGIPGVQSIHRLHVWRLTAGRDVASVHI 291          
BLAST of slc30a-8 vs. Ensembl Sea Lamprey
Match: slc30a10 (solute carrier family 30 member 10 [Source:ZFIN;Acc:ZDB-GENE-060608-2])

HSP 1 Score: 98.9821 bits (245), Expect = 4.138e-23
Identity = 86/351 (24.50%), Postives = 157/351 (44.73%), Query Frame = 1
Query:  295 ILCL--IFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGG-IMLITSIAGIIINLI-------------MAATLH----------QHGHTHGSSKSNNETD---------------------------KEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKP---KYKIA-----DPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLE 1164
            +LC   +F + E+V G + +SLA++ D+ ++L+D  S    L +  LA  PAT R ++G  R EVV AL +   + V   + V +  ++ +S    I+   ++LI    G+ +NL              + A  +          + G     S+  N TD                           +E G S  +S++  IN+R   +H +GD + S+ V I A++  ++P   K +       DP  T   +++++ + + ++R+  V+L++  P D+   +++     +PGV  +H L +W LT  +   SVHI      +  T      ++L Q   I D+T+Q E
Sbjct:   14 MLCFTSVFFVTELVSGYVGNSLALVADSFNMLSDALSLTSGLASARLARWPATSRHTYGLVRGEVVSALATASFL-VALSLSVAVQALKALSQPDVIDNPRLVLIVGALGLSVNLTGLMLFQDCFSCSRLCARFNAAEGTDDRKPRTGDKSTLSEKENYTDVSMKREDTFHFTYFIQPEERLIFTSGDEEMGASVKRSKENAINIRGVLLHTLGDALGSVTVVITAIIFNVRPIASKEECNWQCYIDPALTIAMTLIIITSAVRLIREAAVILLQIVPPDILIKDIEQKLSGIPGVQSIHRLHVWRLTAGRDVASVHIKCAGMSDYATAGLHIHDLL-QLEGIDDITVQPE 362          
BLAST of slc30a-8 vs. Ensembl Yeast
Match: ZRC1 (Vacuolar membrane zinc transporter; transports zinc from cytosol to vacuole for storage; also has role in resistance to zinc shock resulting from sudden influx of zinc into cytoplasm; human ortholog SLC30A10 functions as a Mn transporter and mutations in SLC30A10 cause neurotoxic accumulation of Mn in liver and brain; ZRC1 has a paralog, COT1, that arose from the whole genome duplication [Source:SGD;Acc:S000004856])

HSP 1 Score: 112.464 bits (280), Expect = 1.237e-27
Identity = 96/373 (25.74%), Postives = 174/373 (46.65%), Query Frame = 1
Query:  274 KKLLVASILCL--IFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLA-SRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHG------HTHGSSKSNN-----ETDKEHGHSHGKSEKENINVRAAFIHVIGD-------LVQSI----------------------------------GVF-------------IAALVIYLKPKYK---IADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAID--PDQETHTILRDASNMLRQRFQ---IADVTIQLE 1164
            K+L + S+L L  +F + EI  G M+ SLA++ D+ H+L D  S +++L+A+ +A +R    + ++GW RAE++GAL++ + +  +   ++  A+ R++  +      ++L   +AG+I N++     H HG      H+HGS +S N     E++  H HSH     +N+ +    I   G        L QS+                                  GVF             IAA +   K +Y     +DPI + I +I++  + + + R    +L++ TP  +  ++++     +PGVI VH+  +W+LT S    S+H+ ID  PD+        ++ ++R+ F    I   T+Q E
Sbjct:    5 KELRIISLLTLDTVFFLLEITIGYMSHSLALIADSFHMLNDIISLLVALWAVDVAKNRGPDAKYTYGWKRAEILGALINAVFLIALCFSIMIEALQRLIEPQEIQNPRLVLYVGVAGLISNVVGLFLFHDHGSDSLHSHSHGSVESGNNDLDIESNATHSHSHASLPNDNLAIDEDAISSPGPSGQIGEVLPQSVVNRLSNESQPLLNHDDHDHSHESKKPGHRSLNMHGVFLHVLGDALGNIGVIAAALFIWKTEYSWRYYSDPIVSLIITIIIFSSALPLSRRASRILLQATPSTISADQIQREILAVPGVIAVHDFHVWNLTESIYIASIHVQIDCAPDK-----FMSSAKLIRKIFHQHGIHSATVQPE 372          
BLAST of slc30a-8 vs. Ensembl Yeast
Match: COT1 (Vacuolar transporter that mediates zinc transport into the vacuole; overexpression confers resistance to cobalt and rhodium; protein abundance increases in response to DNA replication stress; COT1 has a paralog, ZRC1, that arose from the whole genome duplication [Source:SGD;Acc:S000005843])

HSP 1 Score: 77.7962 bits (190), Expect = 5.676e-16
Identity = 46/166 (27.71%), Postives = 83/166 (50.00%), Query Frame = 1
Query:  718 HGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYK---IADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQD 1206
            H K  K ++N+   F+HV+GD + +IGV ++A  I+ K  Y      DP+ + I + ++  + + +      +L++ TP  L  ++V+     +PG+I +H+  +W+LT S    S+HI +D   E  T L         R+ I   T+Q E    E+   ++  D
Sbjct:  232 HNK-RKRSLNMHGVFLHVLGDALGNIGVMLSAFFIW-KTDYSWKYYTDPLVSLIITGIIFSSALPLSCKASKILLQATPSTLSGDQVEGDLLKIPGIIAIHDFHIWNLTESIFIASLHIQLDISPEQFTDLAKIVRSKLHRYGIHSATLQPEFITREVTSTERAGD 395          

HSP 2 Score: 63.1586 bits (152), Expect = 3.059e-11
Identity = 41/136 (30.15%), Postives = 77/136 (56.62%), Query Frame = 1
Query:  262 KNARKKLLVASILCL--IFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLA-SRPATKRMSFGWHRAEVVGALV-SVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQH 657
            K   K++ + S+L L  +F   EI  G ++ SLA++ D+ H+L D  S +++L+A+ +A +R      ++GW RAE++GAL+ +V +I +   IL+  A+ R+++         +L   +AG+I N +     H +
Sbjct:    2 KLGSKQVKIISLLLLDTVFFGIEITTGYLSHSLALIADSFHMLNDIISLVVALWAVNVAKNRNPDSTYTYGWKRAEILGALINAVFLIALCVSILIE-ALQRIIAPPVIENPKFVLYVGVAGLISNTVGLFLFHDN 136          
BLAST of slc30a-8 vs. Ensembl Yeast
Match: MSC2 (Endoplasmic reticulum zinc transporter; part of a heterodimeric transporter with Zrg17p that transfers zinc from the cytosol to the ER lumen; member of the cation diffusion facilitator family of efflux pumps; localizes to ER and nucleus; mutations affect the cellular distribution of zinc and also confer defects in meiotic recombination between homologous chromatids [Source:SGD;Acc:S000002613])

HSP 1 Score: 57.3806 bits (137), Expect = 2.396e-9
Identity = 51/210 (24.29%), Postives = 102/210 (48.57%), Query Frame = 1
Query:  244 EAIGVDKNARKKLLVASILCL--IFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGW-HRAEVVGALVSVLMIWVVTGILVYLAVMRVVS-MEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPIC 861
            + + ++K+ R    + S L L   FM  +++    + SL +++D+ H+  D  S ++ L A  L  +PA+ +  FG  +   + G    VL++ +V GI V  A+ R+ + +       ++++ ++  ++  + + A    HG                 H HG ++ EN+  +  F+H++ D + S+GV I+ L+I L   + I DPI 
Sbjct:  377 KQMALNKDTRS---IFSFLLLNTAFMFVQLLYSFRSKSLGLLSDSLHMALDCTSLLLGLIAGVLTKKPASDKFPFGLNYLGTLAGFTNGVLLLGIVCGIFVE-AIERIFNPIHLHATNELLVVATLGLLVNLVGLFA--FDHG----------------AHDHGGTDNENM--KGIFLHILADTLGSVGVVISTLLIKLT-HWPIFDPIA 561          
BLAST of slc30a-8 vs. Ensembl Yeast
Match: MMT2 (Putative metal transporter involved in mitochondrial iron accumulation; MMT2 has a paralog, MMT1, that arose from the whole genome duplication [Source:SGD;Acc:S000006145])

HSP 1 Score: 51.2174 bits (121), Expect = 2.058e-7
Identity = 26/72 (36.11%), Postives = 42/72 (58.33%), Query Frame = 1
Query:  316 IGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGI 531
            +G+ VGG    S A++ D+ H L+D  S  ++LF++  ASR  T    +G+ + E VG+L +V  I  + GI
Sbjct:  145 VGKFVGGITFHSQALLADSVHALSDLVSDFLTLFSVQYASRKPTSEYPYGYGKVETVGSL-AVSTILAMAGI 215          
BLAST of slc30a-8 vs. Ensembl Nematostella
Match: EDO30554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0G7])

HSP 1 Score: 361.688 bits (927), Expect = 9.971e-124
Identity = 173/318 (54.40%), Postives = 236/318 (74.21%), Query Frame = 1
Query:  265 NARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLE-NYVSEMAECQQCQDPAD 1215
            N  ++L +AS LCL FMI E VGG  ++SLAIMTDAAH+L+DFA FMISLFAI++A+RPATK +S+GW+RAEV+GA++SVL+IWV+TG+LVY+A+ R++  E++++  +MLIT+  G++IN+IM A L+Q G               HGHSHG+ E+EN+NVRAAFIHVIGD +QS+GVF+AAL+I+ KP++ IADPICTFIFSI+VL TT+ IL+D ++VLMEG PK L FN++K +   +PGV  VH+L +WSLT+   ALSVH+ +D    T  IL  AS +  + F I   TIQ+E +  S    C++C DP D
Sbjct:    7 NPTRRLRIASFLCLFFMIAEFVGGYFSNSLAIMTDAAHMLSDFAGFMISLFAIWVATRPATKTLSYGWYRAEVMGAVLSVLVIWVLTGVLVYMALQRLIMKEYEVDAKVMLITASGGLLINVIMGAILYQKG---------------HGHSHGE-EEENVNVRAAFIHVIGDFLQSLGVFVAALIIWFKPEWAIADPICTFIFSIIVLFTTLAILKDALIVLMEGMPKGLSFNDLKTSLTAIPGVEAVHDLHVWSLTVGTDALSVHLVVDNSANTQDILEAASQVCSKSFDIHHSTIQIETDNGSRKESCKKCDDPQD 308          
BLAST of slc30a-8 vs. Ensembl Nematostella
Match: EDO43612 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY04])

HSP 1 Score: 337.806 bits (865), Expect = 4.619e-114
Identity = 181/327 (55.35%), Postives = 239/327 (73.09%), Query Frame = 1
Query:  271 RKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGH----SHGKS------EKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEG-TPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYV-SEMAECQQCQDPAD 1215
            RKKL  AS++CL F++ E+VGG +A SLAIMTDAAH+L+DFA+FMISLFAI++A     K+ +FG++RAE++GALVSVL+IWV+TGILVYLAV RV++ +F I   IMLIT+   + IN+++   LHQ G  HG S      D    H    SHGK       EKENINVRAAFIHV+GD+VQS+GV IAA +I  KP +K+ADPICTF+FSILVLITT+NI+RDT+ VLMEG TPK++++N VKA   ++ GV+  H+L +WSLT++K AL+VH+AI P+ ++  +L  A   L+ +FQI   TIQ+E Y  S M  C +CQD  D
Sbjct:    4 RKKLTTASVVCLFFVVAEVVGGYLAHSLAIMTDAAHMLSDFAAFMISLFAIWVAEWQPDKKRTFGYYRAEILGALVSVLIIWVLTGILVYLAVQRVITKDFDINADIMLITAGVALGINILLGIILHQSGVGHGHSHGGGGHDHGGSHSHSASHGKPRSGSVLEKENINVRAAFIHVLGDVVQSVGVLIAAYIIKYKPSWKLADPICTFLFSILVLITTLNIVRDTIHVLMEGSTPKNVNYNAVKAGLENIQGVVAAHSLHIWSLTVNKAALAVHLAIGPNVDSQKVLNIAHQKLKTQFQIFHSTIQVELYQESVMQSCTECQDLKD 330          
BLAST of slc30a-8 vs. Ensembl Nematostella
Match: EDO48857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHI7])

HSP 1 Score: 212.231 bits (539), Expect = 1.315e-65
Identity = 106/305 (34.75%), Postives = 191/305 (62.62%), Query Frame = 1
Query:  274 KKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEF-----KIEGGIMLITSIAGIIINLIMAATLH---QHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLE 1164
            ++L++A++ C++F+  E+ GG +A+SLA+M DA H L D  S + SL A ++A      + ++G+ RAE++GA + +LM+W++TG+LVY A++R+++         +   +M+IT+      N+++A  L    +H H+HGS + N+  +             NIN+RAAF+H IGD++ + GV +A L+I +KP+++ AD IC+ + +++VL+TT  ++RD+  +L EG P+D+   EVK     L  V+  HN+ +W+LT  +  L+ H+ ++P+ +T T+L+ AS  L  ++ +   T+QLE
Sbjct:    1 RRLIIATLFCVVFIACEVTGGVIANSLAVMNDALHQLFDLNSLLASLLAAWIAGWKPNSQKTYGYFRAEILGACLVILMLWLLTGVLVYEALLRLLAGTAMGHSDHVNADVMMITAGFTCAANIVLAFMLSGVGRHHHSHGSYEKNDNCEG------------NINIRAAFLHTIGDIIYAFGVLLAGLIIKIKPEWQKADAICSLVGAVIVLVTTYAVIRDSFNILFEGVPRDVRIAEVKRDLSTLHHVVSFHNVHVWALTSGRNLLTAHLVVEPEADTQTLLKIASKRLSSKYSLYHCTLQLE 293          
BLAST of slc30a-8 vs. Ensembl Nematostella
Match: EDO34617 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNW3])

HSP 1 Score: 85.8853 bits (211), Expect = 7.243e-18
Identity = 67/341 (19.65%), Postives = 155/341 (45.45%), Query Frame = 1
Query:  256 VDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLI-----------------------------------MAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKA--AFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLEN 1167
            ++++  +++     L L+F   E++ G   +SL +++D  H+L D  + ++ L A  ++   A++  S+G+ R E++   V+ + + VV    V+LA ++ +    K+    +L  S+ G+++NL+                                      +   H  TH     N +    H H               F+HV+ D + S+GV IA+ ++  +    IADP+C+   + L+ ++ + +L+++ +VL++ TP D++ +   A        GV+   +   W  + S    ++H+ + P      I++  +++ ++ + + ++++Q+E 
Sbjct:  375 LEESESRQIFYFLCLNLMFTGVELLYGVWTNSLGLISDGFHMLFDCTALVLGLCASLMSRWKASRTFSYGFGRVEILSGFVNGIFL-VVIAFFVFLAAVQRLFDPPKVSTERLLAVSVGGLLVNLVGILAFRHAHAHAHGGGGSCGGGGGSHGHGHSHTHGHGHSHDHHPSTHPDRSVNMQGMYSHAH-------------GVFLHVVADTLGSVGV-IASSILIDQFGLFIADPVCSLFIASLIFLSVLPLLKESSLVLLQRTPLDMEKSLTGALNKILSFDGVLSFRDHHFWQHSESVVCGTIHVQVAPSASEQKIIQQVTSLFKE-YGVNNLSVQVEK 699          
BLAST of slc30a-8 vs. Ensembl Nematostella
Match: EDO29786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2N0])

HSP 1 Score: 48.521 bits (114), Expect = 5.765e-7
Identity = 32/118 (27.12%), Postives = 59/118 (50.00%), Query Frame = 1
Query:  322 EIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLH--QHGHTH 669
            E+  G   +SL ++TD+ H+  D  + +  L A  +A     +R S+G+ RAE++   V+ L +  V   +   AV RV     +++   + + S+ G ++NL+     H  Q G +H
Sbjct:   27 ELAYGIWTNSLGLITDSFHMFFDCTALLAGLVASVIAHWGRNERFSYGYARAEIMAGFVNGLFLIFVAFFIFSEAVERVFHPP-EVKHERLFVVSVLGFLVNLVGIFVFHHGQGGKSH 143          
BLAST of slc30a-8 vs. Ensembl Medaka
Match: slc30a2 (solute carrier family 30 member 3 [Source:NCBI gene;Acc:101167260])

HSP 1 Score: 359.762 bits (922), Expect = 7.164e-122
Identity = 174/356 (48.88%), Postives = 246/356 (69.10%), Query Frame = 1
Query:  190 TGITRTSSDFSDHCHGPSEAIGVDKN----ARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMA------ATLHQHGHTHGSSKSNNETDKEHGHSH----GKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            +G        S HCH      G        A++KL +AS +CLIFMIGE++GG +A SLAIMTDAAHLLTDF S M+SLF+++++SRP TK M+FGWHR+E++GA VSV+ IWVVTG LVYLA+ R+V  +++IEG +ML TS   +I+N+IMA       TLH HG  +     +  +   HGH+H    G S   N +VRAAFIHVIGDL+QSIGV +AA++IY++P+YK+ADPICTF+FS+ VL TT+ ILRD   +LMEG+PK ++F+ VK     +  V  +H L +W+LT+ ++ +SVH+AI+ + +   IL++A+++L  +F    +TIQ+E Y  +M+ C  CQDP+D
Sbjct:    2 SGAMELKQRVSAHCHRSKPPHGEQSGDKVLAKRKLFIASGVCLIFMIGEVIGGYLAHSLAIMTDAAHLLTDFGSMMVSLFSLWISSRPPTKTMNFGWHRSEILGAFVSVMSIWVVTGALVYLAIERIVQNDYEIEGHVMLATSGCAVIVNIIMAYILHHSTTLHPHGSGYHQIDEDGRSPVNHGHAHMLLGGHS---NTSVRAAFIHVIGDLLQSIGVMVAAIIIYVRPEYKVADPICTFLFSLFVLCTTVTILRDVFRILMEGSPKGIEFSSVKEVLLSVKAVKSMHCLHLWALTLGQSLVSVHLAIEEEADPQAILQEATDLLIAKFGFHSITIQVELYSEDMSHCSHCQDPSD 354          
BLAST of slc30a-8 vs. Ensembl Medaka
Match: slc30a8 (solute carrier family 30 member 8 [Source:NCBI gene;Acc:101174514])

HSP 1 Score: 341.273 bits (874), Expect = 4.604e-114
Identity = 171/357 (47.90%), Postives = 242/357 (67.79%), Query Frame = 1
Query:  220 SDHCHGPSEAI----GVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ--------HGHTHGSSKSNNETDKEHGHS---------------HGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDP 1209
            ++HCH  S A        K A+++L V S++CL+FM+ EIVGG +A SLA+MTDAAHLLTD  SF+ISLF+++L+S+PAT+++SFGWHRAE++GAL+SV  IW+VTG+LVYLAV R+V+ +F IEG IMLITS   ++ N+IMA TLHQ           +HG S  N + +K+  +S                G++++ N +VRAAF+HVIGDL+QSI V I+A+VI+ +P+YKIADPICTF+FSILVL TT  I+RD ++VLMEGTP  + ++EV+     + GV  VHNL +W+LT+++  LS H+AID   +   +LR+ +      +    VTIQ+E        C  C++P
Sbjct:   32 AEHCHDNSRAQEDRETEKKVAKRRLYVVSVICLVFMVAEIVGGYLAGSLAVMTDAAHLLTDLTSFLISLFSLWLSSKPATQKLSFGWHRAEILGALLSVFTIWLVTGVLVYLAVERLVTDDFTIEGSIMLITSGCAVVANIIMAVTLHQSGHGHSHGGLGSHGHSHENGKPNKQMSNSVHSELIDMEQSLPDHGGRTQQANASVRAAFVHVIGDLLQSISVLISAIVIFFRPEYKIADPICTFLFSILVLCTTFTIMRDILLVLMEGTPSGVKYSEVRDRLLAVKGVTAVHNLHIWALTMNQAMLSAHVAIDDSADAQMVLREMTQACFSSYNFHSVTIQMERQADLKPGCSLCENP 388          
BLAST of slc30a-8 vs. Ensembl Medaka
Match: slc30a8 (solute carrier family 30 member 8 [Source:NCBI gene;Acc:101174514])

HSP 1 Score: 341.273 bits (874), Expect = 4.604e-114
Identity = 171/357 (47.90%), Postives = 242/357 (67.79%), Query Frame = 1
Query:  220 SDHCHGPSEAI----GVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQ--------HGHTHGSSKSNNETDKEHGHS---------------HGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDP 1209
            ++HCH  S A        K A+++L V S++CL+FM+ EIVGG +A SLA+MTDAAHLLTD  SF+ISLF+++L+S+PAT+++SFGWHRAE++GAL+SV  IW+VTG+LVYLAV R+V+ +F IEG IMLITS   ++ N+IMA TLHQ           +HG S  N + +K+  +S                G++++ N +VRAAF+HVIGDL+QSI V I+A+VI+ +P+YKIADPICTF+FSILVL TT  I+RD ++VLMEGTP  + ++EV+     + GV  VHNL +W+LT+++  LS H+AID   +   +LR+ +      +    VTIQ+E        C  C++P
Sbjct:   32 AEHCHDNSRAQEDRETEKKVAKRRLYVVSVICLVFMVAEIVGGYLAGSLAVMTDAAHLLTDLTSFLISLFSLWLSSKPATQKLSFGWHRAEILGALLSVFTIWLVTGVLVYLAVERLVTDDFTIEGSIMLITSGCAVVANIIMAVTLHQSGHGHSHGGLGSHGHSHENGKPNKQMSNSVHSELIDMEQSLPDHGGRTQQANASVRAAFVHVIGDLLQSISVLISAIVIFFRPEYKIADPICTFLFSILVLCTTFTIMRDILLVLMEGTPSGVKYSEVRDRLLAVKGVTAVHNLHIWALTMNQAMLSAHVAIDDSADAQMVLREMTQACFSSYNFHSVTIQMERQADLKPGCSLCENP 388          
BLAST of slc30a-8 vs. Ensembl Medaka
Match: slc30a4 (solute carrier family 30 member 4 [Source:NCBI gene;Acc:101171398])

HSP 1 Score: 250.366 bits (638), Expect = 4.063e-78
Identity = 141/346 (40.75%), Postives = 214/346 (61.85%), Query Frame = 1
Query:  214 DFSDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKE----------HGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPD--QETHTILRDASNMLRQRFQIADVTIQLENYVSEMAE-CQQCQDPA 1212
            D  D+C    E I   +   K+L++A++L  +FM GEI+GG +++SLAIMTDA H+L D    + SL A++L+++P TKR +FG HR EVV A++SV++I+++TG+L+Y AV R V  +F I+G +MLIT+  G+ +NLIM   L+Q GH H  S  +  +              G  HG     ++ VRAAFIH +GDL+QS+GV IAA V+  KP++K+ADPICT+IFS+LVL TTI I+RDT+V+++EG P+ LD   ++     L  V  +  L +W+LT  KTA  VH+ + P        +   A ++L   + ++  T+Q++ +   M   C  C  P+
Sbjct:   94 DPCDNCTKKRERIK-HRRVMKRLVIAALLYFLFMTGEIIGGYVSNSLAIMTDAVHMLADVVGILFSLLALWLSTKPPTKRFTFGLHRLEVVSAVLSVVLIYILTGVLLYEAVQRTVHQDFSIDGDVMLITAAVGVAVNLIMGFLLNQGGHLHSHSHGHGHSHSSAAAAGSRPAGSGQPHG-----SLAVRAAFIHALGDLLQSVGVLIAAYVVRFKPEFKLADPICTYIFSVLVLFTTIRIIRDTIVIVLEGVPRHLDTQRIREDLLKLEDVQSIDELNVWALTADKTAAIVHLQLTPSSGHSWEDVQAKARHLLLHTYGLSRCTVQVQTHRERMVRSCANCLQPS 433          
BLAST of slc30a-8 vs. Ensembl Medaka
Match: slc30a5 (solute carrier family 30 member 5 [Source:NCBI gene;Acc:101161255])

HSP 1 Score: 115.546 bits (288), Expect = 3.144e-27
Identity = 76/298 (25.50%), Postives = 151/298 (50.67%), Query Frame = 1
Query:  295 ILCL--IFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKEN---INVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLD--FNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLEN 1167
             LCL   F   E+  G   +SL +++D  H+L D ++ ++ LFA  +    AT+  S+G+ R E++   ++ L + V+   +   +V R++     I   ++   S+ G+++NL+       H H+HG     +    +HGHSHG+ + E    ++    F+HV+ D + S+GV I+ L+I  +  + IADPIC+   + L+ ++ I +L++   VL+  TP + +   N        L GV+   +   W  + +  A ++H+ +  D     I +  + +L+    + ++++Q+E 
Sbjct:  362 FLCLNLAFTFVELFYGVWTNSLGLISDGFHMLFDCSALVLGLFAALMTRWKATRIFSYGFGRVEILSGFINGLFLMVIAFFVFMESVTRLLDPP-NINTDMLTPVSVGGLLVNLVGICAF-SHAHSHGGKSCQSH---DHGHSHGERDPEPNALMSSAGVFLHVLADTLGSVGVIISTLLIR-QFGWLIADPICSLFIATLIFLSVIPLLKEACEVLLLRTPPEHEKVLNGALEKIDKLEGVLSHRDAHFWRHSANMVAGTIHLQVMSDVVEQRITQQVTALLKDA-GVNNLSVQVEK 652          
BLAST of slc30a-8 vs. Planmine SMEST
Match: SMESG000013136.1 (SMESG000013136.1)

HSP 1 Score: 791.956 bits (2044), Expect = 0.000e+0
Identity = 384/384 (100.00%), Postives = 384/384 (100.00%), Query Frame = 1
Query:   64 MAKEFVKRNIPSVVRGAIFHEHKEDQQVLIENDACINYYGSSTGITRTSSDFSDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 1215
            MAKEFVKRNIPSVVRGAIFHEHKEDQQVLIENDACINYYGSSTGITRTSSDFSDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD
Sbjct:    1 MAKEFVKRNIPSVVRGAIFHEHKEDQQVLIENDACINYYGSSTGITRTSSDFSDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD 384          
BLAST of slc30a-8 vs. Planmine SMEST
Match: SMESG000022672.1 (SMESG000022672.1)

HSP 1 Score: 450.669 bits (1158), Expect = 4.132e-157
Identity = 227/385 (58.96%), Postives = 285/385 (74.03%), Query Frame = 1
Query:  133 EDQQVLIENDACINYYGSSTGITRTSSDFSDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHG--------------------------HSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDP 1209
            +D  ++IE +  I    S   +    +  +DHCH  SE  G+D+ AR+KLL+AS LCLIFMI EIVGG +A+SLAIMTDAAHLL+DFASFMISLFA++LASRPATKRMSFGWHRAEV+GALVSVL+IWVVTGILVY+AV+R+++ ++ IE  IMLITS  G+++NLIMA +LHQH H+H +   N    +E+                            S+    K NINVRAAFIHVIGDLVQS GV IAA VIY KP +KIADPICTFIFSILVL TTINILRDTM VLMEGTPK LDF++VK    +L GV+ +HNLR+WSLT +KTALSVH+A+DP++E   IL++A+ +L  +F I+D TIQLENYV++M +C++C+ P
Sbjct:    7 QDDSLIIEENGNIEIANSE--LAHRDNIETDHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACSLHQHSHSHETHPHNEPLSEEYDVENAQYSDSDALLDDDKKSDLVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDVKETLLELEGVVLLHNLRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 389          
BLAST of slc30a-8 vs. Planmine SMEST
Match: SMESG000022672.1 (SMESG000022672.1)

HSP 1 Score: 450.669 bits (1158), Expect = 6.716e-157
Identity = 222/356 (62.36%), Postives = 274/356 (76.97%), Query Frame = 1
Query:  220 SDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHTHGSSKSNNETDKEHG--------------------------HSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQCQDP 1209
            +DHCH  SE  G+D+ AR+KLL+AS LCLIFMI EIVGG +A+SLAIMTDAAHLL+DFASFMISLFA++LASRPATKRMSFGWHRAEV+GALVSVL+IWVVTGILVY+AV+R+++ ++ IE  IMLITS  G+++NLIMA +LHQH H+H +   N    +E+                            S+    K NINVRAAFIHVIGDLVQS GV IAA VIY KP +KIADPICTFIFSILVL TTINILRDTM VLMEGTPK LDF++VK    +L GV+ +HNLR+WSLT +KTALSVH+A+DP++E   IL++A+ +L  +F I+D TIQLENYV++M +C++C+ P
Sbjct:   48 TDHCHSDSETDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACSLHQHSHSHETHPHNEPLSEEYDVENAQYSDSDALLDDDKKSDLVEVRIKSNNPIRKTNINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDVKETLLELEGVVLLHNLRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLENYVADMDDCKKCKTP 403          
BLAST of slc30a-8 vs. Planmine SMEST
Match: SMESG000002070.1 (SMESG000002070.1)

HSP 1 Score: 320.857 bits (821), Expect = 4.366e-106
Identity = 156/367 (42.51%), Postives = 235/367 (64.03%), Query Frame = 1
Query:  253 GVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHT-------------------------------HGSSKSNNETDKEH-----------------GHSHGKSEK----ENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQ 1197
             +D+ A+ KL++A +LC++F +GEI+GG +A+SLAI+TD+AHL +D +SF+ISL A+ L++R +TK M+FGWHRAE++GAL SVL+IW+VTG+L+Y A++R+++  + I   IMLI S  G+IIN+++A  LH   H                                  S   N+  D EH                 G    KS+     +NIN+RAAFIHVIGD++QS GV  AA +IY KP++KIADPICTF+FS LV++TTI I RD + VL+E  P+ +++N+V      +PG++++HNLR+WS+T++KTALS H+ +D  Q++ +IL    +M  + F+I+++TIQ+E+     A C Q
Sbjct:   37 NMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHLFSDLSSFLISLGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQSHGHSHGGGGHGHSHGHGHSNGGGGHGHGHGHGHRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 403          
BLAST of slc30a-8 vs. Planmine SMEST
Match: SMESG000075723.1 (SMESG000075723.1)

HSP 1 Score: 147.517 bits (371), Expect = 2.069e-39
Identity = 91/332 (27.41%), Postives = 172/332 (51.81%), Query Frame = 1
Query:  295 ILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATL-HQHGHTHGS--------------------SKSNNETDKE--------HGHSHGKSEKE---NINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYK----------IADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLE 1164
            +L L++ + E++ G M +S+ ++ D+ H+L+DF + +I + A  +   P + + +FGW RAEVVG+LV+ +M+  +T  ++  ++ R +  E   +  I+    + G+++N+I    L + HGH+HG                     S   N  D +         G +HG S+K+   ++N+RA ++HV+ DL  SI V I+A+V++  P ++          + DP+ + +  +L+LI+T+ +L+ + ++L++  PKD+   E+K    ++ G+ +VH+L +W L       +VHI      E +         L   F+I   TIQ E
Sbjct:    3 VLVLLYFLVELIVGHMLNSITLIADSFHMLSDFIALIIGIAARRIGKWPKSSKNTFGWQRAEVVGSLVNTVMLTTLTFTILIKSIQRFIQPEEIEKPHIIFYVGLGGLLVNIIGLIILRNHHGHSHGPETAILLKEEEEELVDDDIPESPVPNLVDGDVKIVIKDNEGENHGHSQKKGASHMNMRAVYLHVLADLFGSIAVVISAIVLWQVPNFQNPPKTDYWKLMVDPLISVLMVVLILISTVPLLKQSALILLQSVPKDVSIKELKDRMENIEGIEKVHDLHVWLLQSDVIIGTVHIRC--SNENYVTASKKVKKLFHEFRIHCTTIQAE 332          
The following BLAST results are available for this feature:
BLAST of slc30a-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC30A23.401e-12850.52solute carrier family 30 member 2 [Source:HGNC Sym... [more]
SLC30A32.255e-10846.61solute carrier family 30 member 3 [Source:HGNC Sym... [more]
SLC30A85.978e-9846.41solute carrier family 30 member 8 [Source:HGNC Sym... [more]
SLC30A85.978e-9846.41solute carrier family 30 member 8 [Source:HGNC Sym... [more]
SLC30A85.978e-9846.41solute carrier family 30 member 8 [Source:HGNC Sym... [more]
back to top
BLAST of slc30a-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdf-22.862e-11447.37Cation Diffusion Facilitator family [Source:UniPr... [more]
ttm-14.818e-8344.17Toxin-regulated Targets of MAPK [Source:UniProtKB... [more]
ttm-16.002e-8345.86Toxin-regulated Targets of MAPK [Source:UniProtKB... [more]
ttm-12.198e-8245.86Toxin-regulated Targets of MAPK [Source:UniProtKB... [more]
Y105E8A.32.480e-1223.08pep chromosome:WBcel235:I:14358502:14367594:1 gene... [more]
back to top
BLAST of slc30a-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZnT33D8.380e-11149.58gene:FBgn0051860 transcript:FBtr0302984[more]
ZnT35C1.291e-5656.47gene:FBgn0028516 transcript:FBtr0080715[more]
ZnT35C3.122e-5662.33gene:FBgn0028516 transcript:FBtr0080714[more]
ZnT33D5.815e-3855.75gene:FBgn0051860 transcript:FBtr0302985[more]
ZnT41F2.996e-3449.23gene:FBgn0025693 transcript:FBtr0086054[more]
back to top
BLAST of slc30a-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc30a21.036e-12747.78solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a22.292e-12751.76solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a21.831e-12351.50solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a81.708e-11848.61solute carrier family 30 member 8 [Source:ZFIN;Acc... [more]
slc30a81.780e-11848.35solute carrier family 30 member 8 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc30a-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc30a22.831e-14157.69solute carrier family 30 member 2 [Source:NCBI gen... [more]
slc30a23.162e-14157.69solute carrier family 30 member 2 [Source:NCBI gen... [more]
ENSXETT00000033890.19.585e-12551.91solute carrier family 30 (zinc transporter), membe... [more]
nbr13.335e-11048.82neighbor of BRCA1 gene 1 [Source:Xenbase;Acc:XB-GE... [more]
gmip2.025e-8041.00GEM interacting protein [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of slc30a-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc30a23.425e-12755.94solute carrier family 30 (zinc transporter), membe... [more]
Slc30a21.869e-11955.78solute carrier family 30 (zinc transporter), membe... [more]
Slc30a21.869e-11955.78solute carrier family 30 (zinc transporter), membe... [more]
Slc30a31.035e-10547.02solute carrier family 30 (zinc transporter), membe... [more]
Slc30a33.169e-10547.02solute carrier family 30 (zinc transporter), membe... [more]
back to top
BLAST of slc30a-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2HJ10|ZNT2_MOUSE2.396e-12655.94Zinc transporter 2 OS=Mus musculus OX=10090 GN=Slc... [more]
sp|Q62941|ZNT2_RAT3.599e-11952.54Zinc transporter 2 OS=Rattus norvegicus OX=10116 G... [more]
sp|Q5XHB4|ZNT8_XENTR2.599e-10848.52Zinc transporter 8 OS=Xenopus tropicalis OX=8364 G... [more]
sp|Q08E25|ZNT3_BOVIN3.869e-10846.90Zinc transporter 3 OS=Bos taurus OX=9913 GN=SLC30A... [more]
sp|Q99726|ZNT3_HUMAN1.083e-10746.61Zinc transporter 3 OS=Homo sapiens OX=9606 GN=SLC3... [more]
back to top
BLAST of slc30a-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKE40.000e+0100.00Slc30a-8 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A504YFT63.166e-15760.55Zinc transporter OS=Fasciola gigantica OX=46835 GN... [more]
A0A267DB272.041e-15562.29Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DEN54.677e-15562.29Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A4E0RCI36.703e-15560.00Zinc transporter OS=Fasciola hepatica OX=6192 GN=D... [more]
back to top
BLAST of slc30a-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc30a24.299e-12649.30zinc transporter 2 [Source:NCBI gene;Acc:103036936... [more]
slc30a86.510e-12347.09solute carrier family 30 member 8 [Source:ZFIN;Acc... [more]
SLC30A27.570e-11248.35zinc transporter 2-like [Source:NCBI gene;Acc:1030... [more]
SLC30A29.990e-11248.35zinc transporter 2-like [Source:NCBI gene;Acc:1030... [more]
slc30a82.972e-10945.53solute carrier family 30 member 8 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc30a-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc30a23.558e-11751.08solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a23.791e-6353.97solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a23.600e-5652.98solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a107.915e-2826.52solute carrier family 30 member 10 [Source:ZFIN;Ac... [more]
slc30a104.138e-2324.50solute carrier family 30 member 10 [Source:ZFIN;Ac... [more]
back to top
BLAST of slc30a-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
ZRC11.237e-2725.74Vacuolar membrane zinc transporter; transports zin... [more]
COT15.676e-1627.71Vacuolar transporter that mediates zinc transport ... [more]
MSC22.396e-924.29Endoplasmic reticulum zinc transporter; part of a ... [more]
MMT22.058e-736.11Putative metal transporter involved in mitochondri... [more]
back to top
BLAST of slc30a-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO305549.971e-12454.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436124.619e-11455.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488571.315e-6534.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346177.243e-1819.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297865.765e-727.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc30a-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc30a27.164e-12248.88solute carrier family 30 member 3 [Source:NCBI gen... [more]
slc30a84.604e-11447.90solute carrier family 30 member 8 [Source:NCBI gen... [more]
slc30a84.604e-11447.90solute carrier family 30 member 8 [Source:NCBI gen... [more]
slc30a44.063e-7840.75solute carrier family 30 member 4 [Source:NCBI gen... [more]
slc30a53.144e-2725.50solute carrier family 30 member 5 [Source:NCBI gen... [more]
back to top
BLAST of slc30a-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013136.10.000e+0100.00SMESG000013136.1[more]
SMESG000022672.14.132e-15758.96SMESG000022672.1[more]
SMESG000022672.16.716e-15762.36SMESG000022672.1[more]
SMESG000002070.14.366e-10642.51SMESG000002070.1[more]
SMESG000075723.12.069e-3927.41SMESG000075723.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30003463
GenBankAKN21628.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003463 ID=SMED30003463|Name=slc30a-8|organism=Schmidtea mediterranea sexual|type=transcript|length=1361bp
GAAAGCACCTGCACCCTTTCTCAATTTACATATAGTTGAATTATATTCCA
TCATCACTAGAAAATGGCCAAAGAGTTTGTGAAAAGAAATATCCCATCAG
TTGTCAGAGGAGCCATATTTCATGAACACAAAGAAGATCAACAGGTGCTA
ATAGAAAACGATGCGTGCATAAATTACTATGGTTCGAGTACGGGAATAAC
AAGAACATCGAGTGATTTTAGTGATCATTGCCATGGTCCCTCAGAAGCCA
TAGGTGTGGATAAAAATGCAAGAAAAAAATTATTAGTGGCAAGTATTTTA
TGCTTAATTTTCATGATTGGAGAAATTGTAGGAGGAGCAATGGCAAGTAG
TTTAGCTATCATGACAGATGCAGCTCATTTGCTGACAGATTTTGCAAGCT
TTATGATAAGTTTGTTTGCTATTTATTTGGCGTCCAGACCCGCAACAAAA
CGAATGAGTTTCGGTTGGCACAGAGCTGAAGTAGTTGGCGCTTTGGTATC
AGTTCTCATGATATGGGTGGTTACAGGAATTCTCGTCTATTTAGCGGTTA
TGCGAGTTGTCAGCATGGAATTTAAAATCGAAGGCGGAATTATGCTGATT
ACGTCTATTGCTGGGATAATTATTAATCTAATAATGGCTGCCACACTTCA
TCAACATGGTCATACACATGGGTCCAGTAAATCTAATAATGAAACGGACA
AGGAGCATGGTCATAGTCATGGGAAATCCGAAAAAGAAAACATCAATGTT
CGCGCAGCCTTTATACATGTTATAGGTGATTTAGTACAAAGTATCGGAGT
ATTTATTGCAGCTCTTGTCATTTATCTCAAGCCAAAATACAAAATTGCAG
ATCCAATATGCACATTCATCTTCTCCATTTTGGTCCTGATTACTACAATT
AATATTCTACGAGACACTATGGTTGTTTTGATGGAGGGGACACCCAAAGA
TTTAGATTTCAATGAAGTAAAGGCAGCATTCTATGATTTACCTGGAGTAA
TTGAAGTTCATAATTTACGAATGTGGAGTTTAACAATAAGTAAAACTGCT
CTTTCCGTTCACATTGCTATAGATCCTGATCAAGAAACGCATACTATTCT
ACGAGATGCCAGCAATATGCTAAGACAGAGATTCCAGATCGCCGACGTAA
CAATCCAGCTAGAGAACTATGTAAGTGAAATGGCAGAATGCCAACAATGC
CAAGATCCGGCAGATTAATTGTCTGTTATAAATGAAACTGGTTGCTGATT
TTATTATCAATTATGTGAAATTCTTGTTATCACTTAATATTTAGATGATT
ACTGTCGTTTTGTCGATTGTGTTTTGTTTTATCGTTAGAATAAATATTTA
ACGTTTTGAAA
back to top

protein sequence of SMED30003463-orf-1

>SMED30003463-orf-1 ID=SMED30003463-orf-1|Name=SMED30003463-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=385bp
MAKEFVKRNIPSVVRGAIFHEHKEDQQVLIENDACINYYGSSTGITRTSS
DFSDHCHGPSEAIGVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIM
TDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMI
WVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGH
THGSSKSNNETDKEHGHSHGKSEKENINVRAAFIHVIGDLVQSIGVFIAA
LVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFN
EVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDAS
NMLRQRFQIADVTIQLENYVSEMAECQQCQDPAD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036837Cation_efflux_CTD_sf
IPR027470Cation_efflux_CTD
IPR027469Cation_efflux_TMD_sf
IPR002524Cation_efflux
IPR009057Homeobox-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0008324cation transmembrane transporter activity
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006812cation transport
GO:0055085transmembrane transport
GO:0098655cation transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002524Cation efflux proteinPFAMPF01545Cation_effluxcoord: 73..290
e-value: 2.5E-48
score: 164.5
IPR002524Cation efflux proteinTIGRFAMTIGR01297TIGR01297coord: 70..369
e-value: 4.8E-89
score: 296.4
IPR027469Cation efflux transmembrane domain superfamilyGENE3DG3DSA:1.20.1510.10coord: 69..290
e-value: 1.9E-28
score: 101.4
IPR027469Cation efflux transmembrane domain superfamilySUPERFAMILYSSF161111Cation efflux protein transmembrane domain-likecoord: 67..291
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 201..223
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 203..223
NoneNo IPR availablePANTHERPTHR11562CATION EFFLUX PROTEIN/ ZINC TRANSPORTERcoord: 39..382
NoneNo IPR availablePANTHERPTHR11562:SF84LD05335Pcoord: 39..382
NoneNo IPR availableTMHMMTMhelixcoord: 73..95
NoneNo IPR availableTMHMMTMhelixcoord: 265..282
NoneNo IPR availableTMHMMTMhelixcoord: 110..127
NoneNo IPR availableTMHMMTMhelixcoord: 172..194
NoneNo IPR availableTMHMMTMhelixcoord: 140..162
NoneNo IPR availableTMHMMTMhelixcoord: 233..255
IPR036837Cation efflux protein, cytoplasmic domain superfamilySUPERFAMILYSSF160240Cation efflux protein cytoplasmic domain-likecoord: 295..367