Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30003438
Length (bp)2389
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30003438) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30003438) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30003438) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30003438) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003438

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30003438SMESG000036603.1 dd_Smed_v4_1972_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003438SMESG000036603.1 dd_Smed_v4_1972_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: IKBKE (inhibitor of nuclear factor kappa B kinase subunit epsilon [Source:HGNC Symbol;Acc:HGNC:14552])

HSP 1 Score: 191.045 bits (484), Expect = 6.378e-51
Identity = 117/330 (35.45%), Postives = 174/330 (52.73%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKC--------SKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLYL 1033
            MQ    Y+   +  LG+GATA VY           A+K          ++   +E  +L+ L+H NIV+ +         ++V+VMEYC+ GSL   +E  +   GL ++ FL +L C+  G+++LR   +VHRDIKPGN+M      G    K+ D G A+ ++DD+ F S+ GTEEYLHP+MY R +  +  Q      VDLWSIGVTLYHA    LPFIP+   R   R KE +  +   K AG I+G Q  +N   + WS  LP  C+LS  L+     ++  ++E        +++FF E + ILQ+    +F+     L  +Y+
Sbjct:    1 MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLRKLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVVAGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPR---RNKEIMYRITTEKPAGAIAGAQRREN-GPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFAETSDILQRVVVHVFSLSQAVLHHIYI 326          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: IKBKE (inhibitor of nuclear factor kappa B kinase subunit epsilon [Source:HGNC Symbol;Acc:HGNC:14552])

HSP 1 Score: 191.045 bits (484), Expect = 1.297e-50
Identity = 117/330 (35.45%), Postives = 174/330 (52.73%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKC--------SKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLYL 1033
            MQ    Y+   +  LG+GATA VY           A+K          ++   +E  +L+ L+H NIV+ +         ++V+VMEYC+ GSL   +E  +   GL ++ FL +L C+  G+++LR   +VHRDIKPGN+M      G    K+ D G A+ ++DD+ F S+ GTEEYLHP+MY R +  +  Q      VDLWSIGVTLYHA    LPFIP+   R   R KE +  +   K AG I+G Q  +N   + WS  LP  C+LS  L+     ++  ++E        +++FF E + ILQ+    +F+     L  +Y+
Sbjct:    1 MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLRKLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVVAGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPR---RNKEIMYRITTEKPAGAIAGAQRREN-GPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFAETSDILQRVVVHVFSLSQAVLHHIYI 326          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: TBK1 (TANK binding kinase 1 [Source:HGNC Symbol;Acc:HGNC:11584])

HSP 1 Score: 182.956 bits (463), Expect = 4.300e-49
Identity = 131/406 (32.27%), Postives = 212/406 (52.22%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSKQ---------QLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFN--SLTGELQFLYLDNLT--YNNLVEQTSKLLGYPREDFIILTKLKRLEPLSDSQSECLQSVPIKGHLTYDLTDNTILVMVTKPV 1240
            MQ  + ++   +  LG+GATA+V+ G         A+K             Q++ E  +LK L+H NIV+ +    +     +V++ME+C  GSLY  +E      GL ++ FL +L  +  G+++LR   +VHRDIKPGN+M  + ED    +  K+ D G A+ +EDD+ F SL GTEEYLHP+MY R +  +  Q K+ A VDLWSIGVT YHA    LPF P+   R   R KE +  +   K +G ISG Q ++N   I WS  +P  C LSR L+ + + ++  ++E        +++FF E + IL +    +F+   +T    +++  N    ++ LV + +K++   +E   ++ + +RL          L+   +  H      +N I V+  +P+
Sbjct:    1 MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMR-EFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVY--KLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPR---RNKEVMYKIITGKPSGAISGVQKAEN-GPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQE---LIYEGRRL---------VLEPGRLAQHFPKTTEENPIFVVSREPL 387          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: TBK1 (TANK binding kinase 1 [Source:HGNC Symbol;Acc:HGNC:11584])

HSP 1 Score: 183.341 bits (464), Expect = 5.378e-49
Identity = 131/406 (32.27%), Postives = 212/406 (52.22%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSKQ---------QLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFN--SLTGELQFLYLDNLT--YNNLVEQTSKLLGYPREDFIILTKLKRLEPLSDSQSECLQSVPIKGHLTYDLTDNTILVMVTKPV 1240
            MQ  + ++   +  LG+GATA+V+ G         A+K             Q++ E  +LK L+H NIV+ +    +     +V++ME+C  GSLY  +E      GL ++ FL +L  +  G+++LR   +VHRDIKPGN+M  + ED    +  K+ D G A+ +EDD+ F SL GTEEYLHP+MY R +  +  Q K+ A VDLWSIGVT YHA    LPF P+   R   R KE +  +   K +G ISG Q ++N   I WS  +P  C LSR L+ + + ++  ++E        +++FF E + IL +    +F+   +T    +++  N    ++ LV + +K++   +E   ++ + +RL          L+   +  H      +N I V+  +P+
Sbjct:    1 MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMR-EFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVY--KLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPR---RNKEVMYKIITGKPSGAISGVQKAEN-GPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQE---LIYEGRRL---------VLEPGRLAQHFPKTTEENPIFVVSREPL 387          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: TBK1 (TANK binding kinase 1 [Source:HGNC Symbol;Acc:HGNC:11584])

HSP 1 Score: 183.726 bits (465), Expect = 7.228e-49
Identity = 131/406 (32.27%), Postives = 212/406 (52.22%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSKQ---------QLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFN--SLTGELQFLYLDNLT--YNNLVEQTSKLLGYPREDFIILTKLKRLEPLSDSQSECLQSVPIKGHLTYDLTDNTILVMVTKPV 1240
            MQ  + ++   +  LG+GATA+V+ G         A+K             Q++ E  +LK L+H NIV+ +    +     +V++ME+C  GSLY  +E      GL ++ FL +L  +  G+++LR   +VHRDIKPGN+M  + ED    +  K+ D G A+ +EDD+ F SL GTEEYLHP+MY R +  +  Q K+ A VDLWSIGVT YHA    LPF P+   R   R KE +  +   K +G ISG Q ++N   I WS  +P  C LSR L+ + + ++  ++E        +++FF E + IL +    +F+   +T    +++  N    ++ LV + +K++   +E   ++ + +RL          L+   +  H      +N I V+  +P+
Sbjct:    1 MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMR-EFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVY--KLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPR---RNKEVMYKIITGKPSGAISGVQKAEN-GPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQE---LIYEGRRL---------VLEPGRLAQHFPKTTEENPIFVVSREPL 387          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: Y43D4A.6 (pep chromosome:WBcel235:IV:16787327:16788510:1 gene:WBGene00012792.1 transcript:Y43D4A.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y43D4A.6)

HSP 1 Score: 92.0485 bits (227), Expect = 6.024e-20
Identity = 62/212 (29.25%), Postives = 110/212 (51.89%), Query Frame = 2
Query:  125 KCLGRGATADVYLGLKIDDA-TQCAMK------CSKQ---QLKKEISILKDLDHYNIVRYYDSLI--KFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKR-VEDDQ--LFQSLVGTEEYLHPEMYIRYLEGIQIKHKA-NVDLWSIGVTLYHALVTELPF 712
            K +G+GA   V+L  K+++   + AMK        K+   Q+++E  I K++ H NIV+ Y   +  +FC     +  E+   G L++ I+   G+  N     L+ L  G+ Y+ G  +VHRDIKP N++++  +     +K+ D G + R + DD+  L    +GT  ++ PE++ +       KH+   VD+WS G+ ++  L   LP+
Sbjct:   10 KSIGKGAFGQVFLAEKLNNPRIKVAMKKINIFGAPKEFLEQIQQEYYIQKNMKHKNIVKMYGMSMDTEFC----YLFQEFVTGGDLFEKIDFENGMPVNQVKGYLKQLMSGLKYIHGCGIVHRDIKPDNLLINSSDA----LKIADFGLSTRFIVDDKEILLHERIGTTPFMAPELFAKK------KHRGPPVDIWSAGILVFSLLTGNLPW 207          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: air-2 (Aurora/IPL1-related protein kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:O01427])

HSP 1 Score: 88.9669 bits (219), Expect = 4.536e-19
Identity = 70/238 (29.41%), Postives = 114/238 (47.90%), Query Frame = 2
Query:   65 PSKSENKQMQGKNKYII-DF--NKCLGRGATADVYLG----------LKIDDATQCAMKCSKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQV-IVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRT 736
            P K      Q   K+ I DF   + LG+G    VYL           +K+   +Q      + QL++EI I   L+H NI++ Y     F   +++ +V+EY   G +Y  + + +   +    K +  + + +SY   K ++HRDIKP N+++         +K+GD G +     ++  Q++ GT +YL PEM    + G    H   VDLW+IGV  Y  LV + PF   + S+T
Sbjct:   11 PEKETVNTPQKGGKFTINDFEIGRPLGKGKFGSVYLARTKTGHFHVAIKVLFKSQLISGGVEHQLEREIEIQSHLNHPNIIKLYTY---FWDAKKIYLVLEYAPGGEMYKQLTVSKRFSEPTAAKYMYEIADALSYCHRKNVIHRDIKPENLLIGSQG----ELKIGDFGWSVHAPSNKR-QTMCGTMDYLPPEM----VNGAD--HSDAVDLWAIGVLCYEFLVGKPPFEHEDQSKT 234          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-51 (Serine/threonine-protein kinase unc-51 [Source:UniProtKB/Swiss-Prot;Acc:Q23023])

HSP 1 Score: 89.7373 bits (221), Expect = 4.110e-18
Identity = 66/216 (30.56%), Postives = 103/216 (47.69%), Query Frame = 2
Query:  131 LGRGATADVYLGLKIDDA-TQCAMKC--------SKQQLKKEISILKDLD---HYNIVRYYDSLIKFCGYEQV---IVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMV------HEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFI 715
            LG GA A VY G  +D      A+K         SK  L KEI ILK+L    H N+V     L+K C        +VME+CN G L D+++    L ++     +  +   +  +  K +VHRD+KP N+++         +     IK+ D G A+ + D  +  +L G+  Y+ PE+       + +++ A  DLWSIG  L+  L  + PF+
Sbjct:   15 LGHGAFAIVYRGRYVDRTDVPVAIKAIAKKNISKSKNLLTKEIKILKELSSLKHENLV----GLLK-CTETPTHVYLVMEFCNGGDLADYLQQKTTLNEDTIQHFVVQIAHALEAINKKGIVHRDLKPQNILLCNNSRTQNPHFTDIVIKLADFGFARFLNDGVMAATLCGSPMYMAPEVI------MSMQYDAKADLWSIGTILFQCLTGKAPFV 219          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pig-1 (Maternal embryonic leucine zipper kinase [Source:UniProtKB/Swiss-Prot;Acc:U4PR86])

HSP 1 Score: 88.5817 bits (218), Expect = 7.806e-18
Identity = 64/209 (30.62%), Postives = 101/209 (48.33%), Query Frame = 2
Query:  131 LGRGATADVYLGLKIDDATQCAMKC-SKQQL-------KKEISILKDLDHYNIVRYY---DSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVE----DDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPF 712
            LG G    V L   +    + A+K   K+QL       + E+  L++L H NI R Y   ++  KF      IVMEYC+ G ++D+I   + L ++        L   I+++  +   HRD+KP N+++ ED     H+K+ D G   + E    D     +  G+  Y  PE+    ++G+Q K     D+WS+G+ LY  LV  LPF
Sbjct:   17 LGSGGFGKVRLATHLLTNQKVAIKIIDKKQLGHDLPRVQTEMDALRNLSHQNICRLYHYIETEDKF-----FIVMEYCSGGEMFDYIVRKERLEESEARHFFRQLVSAIAFVHSQGYAHRDLKPENLLLTED----LHLKLIDFGLCAKTEKGRIDKHNLDTCCGSPAYAAPEL----IQGLQYKGN-EADVWSMGILLYTLLVGALPF 211          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: par-1 (Serine/threonine-protein kinase par-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW45])

HSP 1 Score: 88.9669 bits (219), Expect = 8.007e-18
Identity = 58/208 (27.88%), Postives = 100/208 (48.08%), Query Frame = 2
Query:  125 KCLGRGATADVYLGLKIDDATQCAMK---------CSKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVI--VMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYI-RYLEGIQIKHKANVDLWSIGVTLYHALVTELPF 712
            K +G+G  A V L   +    + A+K          S Q+L +E+ I+K LDH NIV+ Y    +    EQ +  V+EY + G ++D++  H  + +         +   + YL  K ++HRD+K  N+++ +D     +IK+ D G +          +  G+  Y  PE++  +  +G +      VD+WS+GV LY  +   LPF
Sbjct:  110 KTIGKGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSLQKLFREVKIMKQLDHPNIVKLY----QVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLDQD----MNIKIADFGFSNTFSLGNKLDTFCGSPPYAAPELFSGKKYDGPE------VDVWSLGVILYTLVSGSLPF 303          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: IKKepsilon (gene:FBgn0086657 transcript:FBtr0336824)

HSP 1 Score: 197.978 bits (502), Expect = 2.484e-53
Identity = 133/367 (36.24%), Postives = 194/367 (52.86%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCA---------MKCSKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFI---ELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLME--RTDTNTYERFFDEANKILQKKRA-LMFNSLTGELQFLYLDNLTYNNLVEQTSKLLGYPREDFIILTKLKRLE 1132
            ++G   Y+      LG+GAT  V+ G+        A         M+ +  Q++ E   LK ++H NIV+         G  +VIVME C  GSL++ +   E   GL ++ FL +LE L  G+ +LR   LVHRD+KPGN+M  + ED    +  K+ D G A+ +ED+Q F SL GTEEYLHP++Y R +  + IQ    ANVDLWSIGVTLYH     LPF P+       + +ET+  +   K +G+ISG Q S+N   I WS  LP    LS+ LK + + L+  L+E  R  T +++RFF E   IL+K+   + F + T  ++     +   +N  E+       P E  I+L   + LE
Sbjct:    4 LRGSVSYVWCTTSVLGKGATGSVFQGVNKITGESVAVKTFNPYSHMRPADVQMR-EFEALKKVNHENIVKLLAIEEDQEGRGKVIVMELCTGGSLFNILDDPENSYGLPEHEFLLVLEHLCAGMKHLRDNKLVHRDLKPGNIMKFISEDGQTIY--KLTDFGAARELEDNQPFASLYGTEEYLHPDLYERAVLRKSIQRSFTANVDLWSIGVTLYHVATGNLPFRPFG----GRKNRETMHQITTKKASGVISGTQLSEN-GPIEWSTTLPPHAHLSQGLKTLVTPLLAGLLEENREKTWSFDRFFHEVTLILRKRVIHVFFTNRTSSVEVFLEPDEQIDNFRERIFLQTEVPLEKQILLFNNEHLE 362          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: IKKepsilon (gene:FBgn0086657 transcript:FBtr0081390)

HSP 1 Score: 197.978 bits (502), Expect = 2.484e-53
Identity = 133/367 (36.24%), Postives = 194/367 (52.86%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCA---------MKCSKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFI---ELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLME--RTDTNTYERFFDEANKILQKKRA-LMFNSLTGELQFLYLDNLTYNNLVEQTSKLLGYPREDFIILTKLKRLE 1132
            ++G   Y+      LG+GAT  V+ G+        A         M+ +  Q++ E   LK ++H NIV+         G  +VIVME C  GSL++ +   E   GL ++ FL +LE L  G+ +LR   LVHRD+KPGN+M  + ED    +  K+ D G A+ +ED+Q F SL GTEEYLHP++Y R +  + IQ    ANVDLWSIGVTLYH     LPF P+       + +ET+  +   K +G+ISG Q S+N   I WS  LP    LS+ LK + + L+  L+E  R  T +++RFF E   IL+K+   + F + T  ++     +   +N  E+       P E  I+L   + LE
Sbjct:    4 LRGSVSYVWCTTSVLGKGATGSVFQGVNKITGESVAVKTFNPYSHMRPADVQMR-EFEALKKVNHENIVKLLAIEEDQEGRGKVIVMELCTGGSLFNILDDPENSYGLPEHEFLLVLEHLCAGMKHLRDNKLVHRDLKPGNIMKFISEDGQTIY--KLTDFGAARELEDNQPFASLYGTEEYLHPDLYERAVLRKSIQRSFTANVDLWSIGVTLYHVATGNLPFRPFG----GRKNRETMHQITTKKASGVISGTQLSEN-GPIEWSTTLPPHAHLSQGLKTLVTPLLAGLLEENREKTWSFDRFFHEVTLILRKRVIHVFFTNRTSSVEVFLEPDEQIDNFRERIFLQTEVPLEKQILLFNNEHLE 362          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: KP78a (gene:FBgn0026064 transcript:FBtr0301426)

HSP 1 Score: 93.5893 bits (231), Expect = 2.953e-19
Identity = 60/208 (28.85%), Postives = 103/208 (49.52%), Query Frame = 2
Query:  125 KCLGRGATADVYLGLKIDDATQCAMK---------CSKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQV--IVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYI-RYLEGIQIKHKANVDLWSIGVTLYHALVTELPF 712
            K LG+G  A V L + +    + A+K          ++Q+L +E+ I+K L+H NIVR    L +    E+   +VMEY ++G L+D +  +  + +     +   L   I Y   K +VHRD+K  N+++ +    + +IK+ D G     + +   ++  G+  Y  PE+++ R   G +      VD WS+GV LY  +   LPF
Sbjct:  102 KTLGKGNFAKVKLAIHVPTGREVAIKVIDKTQLNTSARQKLYREVKIMKLLNHPNIVR----LFQVIESERTLYLVMEYASRGELFDHLVKNGRMRERDARVIFRQLVSAIQYCHSKFVVHRDLKAENLLLDQ----HMNIKIADFGFGNTFDPNAQLETFCGSPPYAAPELFMGRKYAGPE------VDAWSLGVVLYTLVSGSLPF 295          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Atg1 (gene:FBgn0260945 transcript:FBtr0300561)

HSP 1 Score: 93.5893 bits (231), Expect = 3.045e-19
Identity = 73/235 (31.06%), Postives = 110/235 (46.81%), Query Frame = 2
Query:  131 LGRGATADVYLGLKIDDATQCAMKC--SKQQLK------KEISILKDL---DHYNIVRYYDSLIKFCGYEQ---VIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHED------NMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYE 775
            LG GA A VY G         A+KC   K QLK      KEI ILK+L    H N+V   D     C   Q    +VMEYCN G L D++ +   L ++     L  L   +  L  K +VHRD+KP N+++  +            +K+ D G A+ + +  +  +L G+  Y+ PE+       + +++ +  DLWS+G  +Y  L  + PF    Y++T +     LK  YE
Sbjct:   15 LGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILKELTELHHENVVALLD-----CKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGAMKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGSPMYMAPEVI------MSLQYDSKADLWSLGTIVYQCLTGKAPF----YAQTPNE----LKSYYE 230          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Atg1 (gene:FBgn0260945 transcript:FBtr0075945)

HSP 1 Score: 93.5893 bits (231), Expect = 3.281e-19
Identity = 92/306 (30.07%), Postives = 136/306 (44.44%), Query Frame = 2
Query:  131 LGRGATADVYLGLKIDDATQCAMKC--SKQQLK------KEISILKDL---DHYNIVRYYDSLIKFCGYEQ---VIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHED------NMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTNTYERFFDEANKILQKKRA 988
            LG GA A VY G         A+KC   K QLK      KEI ILK+L    H N+V   D     C   Q    +VMEYCN G L D++ +   L ++     L  L   +  L  K +VHRD+KP N+++  +            +K+ D G A+ + +  +  +L G+  Y+ PE+       + +++ +  DLWS+G  +Y  L  + PF    Y++T +     LK  YE          QN++    I  S + PD   L   L    SK         D  +YE FF   ++ LQ K+A
Sbjct:   15 LGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILKELTELHHENVVALLD-----CKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGAMKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGSPMYMAPEVI------MSLQYDSKADLWSLGTIVYQCLTGKAPF----YAQTPNE----LKSYYE----------QNANLAPKIP-SGVSPDLRDLLLCLLRRNSK---------DRISYESFF--VHRFLQGKKA 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: tbk1 (TANK-binding kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060512-359])

HSP 1 Score: 191.43 bits (485), Expect = 6.638e-51
Identity = 123/342 (35.96%), Postives = 183/342 (53.51%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSKQ---------QLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLYLDNLTYNNLVEQ 1066
            MQ    Y+   +  LG+GATA+VY G         A+K             Q++ E  +LK L+H NIV+ +    +     +V+VMEYC  GSLY  +E      GL ++ FL +L+ +  G+++LR   +VHRDIKPGN+M    + G+   K+ D G A+ +EDD+ F SL GTEEYLHP+MY R +  +  Q K+ A VDLWSIGVT YHA    LPF P+   R   R KE +  +   K  G ISG Q  +N   I WS+ +P  C LS+ L+ + + ++  ++E        +++FF E + IL +    +F+     L  +Y+      NL ++
Sbjct:    1 MQSTANYLWMMSDLLGQGATANVYRGRHKKTGDLYAVKVFNNLSFLRPLDVQMR-EFEVLKKLNHKNIVKLFAVEEESNTRHKVLVMEYCPCGSLYTVLEEPTNAYGLPEDEFLIVLQDVVAGMNHLREYGIVHRDIKPGNIMRVIGDDGFSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPR---RNKEVMYKIITEKPPGAISGHQKFEN-GKIEWSSEMPISCSLSKGLQSLLTPVLANILEADQEKCWGFDQFFAETSDILHRIVVYVFSLQQATLHHVYIHTYNTANLFQE 337          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: ikbke (inhibitor of nuclear factor kappa B kinase subunit epsilon [Source:ZFIN;Acc:ZDB-GENE-040718-251])

HSP 1 Score: 173.711 bits (439), Expect = 6.925e-45
Identity = 112/323 (34.67%), Postives = 171/323 (52.94%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKC--------SKQQLKKEISILKDLDHYNIVRYY--DSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGI--QIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFN 1000
            M     Y+      LG+GATA+VY           A+K           +   +E  +L+ L+H NIV+ +  + +I     ++++VMEYC+ GSL + +E  +   GL ++ FL +L C+  G+++LR   +VHRDIKPGN+M  V ED    +  K+ D G A+ +EDD+ F S+ GTEEYLHP MY R +  I  Q  +  +VDLWSIGVT+YH     LPF P+   R   + K+ +  +   K AG I+G Q  ++   I W + LP  C+LS  LK     ++  ++   D     + +FF   N IL +    +F+
Sbjct:    1 MTSTANYLWSQEDILGQGATANVYKARNKKTGELVAVKVFNLVSYNRPYEVQMREFEVLQLLNHVNIVKLFAVEEIIS-NPKQKILVMEYCSGGSLLNMLEQPEHAFGLPESEFLIVLHCVAHGMNHLRENSVVHRDIKPGNIMRQVGEDGRSVY--KLADFGAARELEDDEKFVSIYGTEEYLHPHMYERAVLRIPQQKAYGVSVDLWSIGVTIYHMATGSLPFRPFGGPR---KNKQMMHKITTEKPAGTIAGVQKEED-GPIEWRDKLPLSCQLSEGLKTQLVPVLANILLADDEKCWKFPQFFSATNDILNRITIYIFS 316          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: ikbke (inhibitor of nuclear factor kappa B kinase subunit epsilon [Source:ZFIN;Acc:ZDB-GENE-040718-251])

HSP 1 Score: 172.94 bits (437), Expect = 1.172e-44
Identity = 111/323 (34.37%), Postives = 170/323 (52.63%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKC--------SKQQLKKEISILKDLDHYNIVRYY--DSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFN 1000
            M     Y+      LG+GATA+VY           A+K           +   +E  +L+ L+H NIV+ +  + +I     ++++VMEYC+ GSL + +E  +   GL ++ FL +L C+  G+++LR   +VHRDIKPGN+M  V ED    +  K+ D G A+ +EDD+ F S+ GTEEYLHP MY R +     Q  +  +VDLWSIGVT+YH     LPF P+   R   + K+ +  +   K AG I+G Q  ++   I W + LP  C+LS  LK     ++  ++   D     + +FF   N IL +    +F+
Sbjct:    1 MTSTANYLWSQEDILGQGATANVYKARNKKTGELVAVKVFNLVSYNRPYEVQMREFEVLQLLNHVNIVKLFAVEEIIS-NPKQKILVMEYCSGGSLLNMLEQPEHAFGLPESEFLIVLHCVAHGMNHLRENSVVHRDIKPGNIMRQVGEDGRSVY--KLADFGAARELEDDEKFVSIYGTEEYLHPHMYERAVLRSPQQKAYGVSVDLWSIGVTIYHMATGSLPFRPFGGPR---KNKQMMHKITTEKPAGTIAGVQKEED-GPIEWRDKLPLSCQLSEGLKTQLVPVLANILLADDEKCWKFPQFFSATNDILNRITIYIFS 316          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: ikbke (inhibitor of nuclear factor kappa B kinase subunit epsilon [Source:ZFIN;Acc:ZDB-GENE-040718-251])

HSP 1 Score: 172.94 bits (437), Expect = 1.172e-44
Identity = 111/323 (34.37%), Postives = 170/323 (52.63%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKC--------SKQQLKKEISILKDLDHYNIVRYY--DSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFN 1000
            M     Y+      LG+GATA+VY           A+K           +   +E  +L+ L+H NIV+ +  + +I     ++++VMEYC+ GSL + +E  +   GL ++ FL +L C+  G+++LR   +VHRDIKPGN+M  V ED    +  K+ D G A+ +EDD+ F S+ GTEEYLHP MY R +     Q  +  +VDLWSIGVT+YH     LPF P+   R   + K+ +  +   K AG I+G Q  ++   I W + LP  C+LS  LK     ++  ++   D     + +FF   N IL +    +F+
Sbjct:    1 MTSTANYLWSQEDILGQGATANVYKARNKKTGELVAVKVFNLVSYNRPYEVQMREFEVLQLLNHVNIVKLFAVEEIIS-NPKQKILVMEYCSGGSLLNMLEQPEHAFGLPESEFLIVLHCVAHGMNHLRENSVVHRDIKPGNIMRQVGEDGRSVY--KLADFGAARELEDDEKFVSIYGTEEYLHPHMYERAVLRSPQQKAYGVSVDLWSIGVTIYHMATGSLPFRPFGGPR---KNKQMMHKITTEKPAGTIAGVQKEED-GPIEWRDKLPLSCQLSEGLKTQLVPVLANILLADDEKCWKFPQFFSATNDILNRITIYIFS 316          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: ikbke (inhibitor of nuclear factor kappa B kinase subunit epsilon [Source:ZFIN;Acc:ZDB-GENE-040718-251])

HSP 1 Score: 172.555 bits (436), Expect = 1.765e-44
Identity = 111/323 (34.37%), Postives = 170/323 (52.63%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKC--------SKQQLKKEISILKDLDHYNIVRYY--DSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFN 1000
            M     Y+      LG+GATA+VY           A+K           +   +E  +L+ L+H NIV+ +  + +I     ++++VMEYC+ GSL + +E  +   GL ++ FL +L C+  G+++LR   +VHRDIKPGN+M  V ED    +  K+ D G A+ +EDD+ F S+ GTEEYLHP MY R +     Q  +  +VDLWSIGVT+YH     LPF P+   R   + K+ +  +   K AG I+G Q  ++   I W + LP  C+LS  LK     ++  ++   D     + +FF   N IL +    +F+
Sbjct:    1 MTSTANYLWSQEDILGQGATANVYKARNKKTGELVAVKVFNLVSYNRPYEVQMREFEVLQLLNHVNIVKLFAVEEIIS-NPKQKILVMEYCSGGSLLNMLEQPEHAFGLPESEFLIVLHCVAHGMNHLRENSVVHRDIKPGNIMRQVGEDGRSVY--KLADFGAARELEDDEKFVSIYGTEEYLHPHMYERAVLRSPQQKAYGVSVDLWSIGVTIYHMATGSLPFRPFGGPR---KNKQMMHKITTEKPAGTIAGVQKEED-GPIEWRDKLPLSCQLSEGLKTQLVPVLANILLADDEKCWKFPQFFSATNDILNRITIYIFS 316          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: slc6a13 (solute carrier family 6 (neurotransmitter transporter), member 13 [Source:Xenbase;Acc:XB-GENE-5947897])

HSP 1 Score: 185.267 bits (469), Expect = 2.871e-50
Identity = 122/355 (34.37%), Postives = 184/355 (51.83%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSK--------QQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLY-LDNLTYNNLVEQTSKLLGYPRED 1099
            MQ    Y+ + +  LG+GATA VY         + A+K           +   +E  +L+ L+H NIV+ +         ++V+VMEYC+ GSL   +E  +   GL +  FL +L+C+  G+++LR   +VHRDIKPGN+M  + ED    +  K+ D G A+ ++DD+ F S+ GTEEYLHP++Y R +  +  Q  +   VDLWSIGVT YHA    LPFIPY   R   R KE +  +   K    I+G Q  + +  I W   LP  CRLS  LK     ++  ++E        +++FF E N IL++    +F+     +  +Y L   +  N +E  SK  G   E+
Sbjct:    1 MQSTPNYLWELDDVLGQGATASVYKARNKKSGEEVAVKVFNNLSYLRPLEVQMREFEMLRKLNHVNIVKLFAVEETGNSKQKVLVMEYCSSGSLLSVLEDPENAYGLSEAEFLIVLQCVVAGMNHLRQNGIVHRDIKPGNIMRLIGEDGRSIY--KLTDFGAARELDDDEKFLSIYGTEEYLHPDIYERAVLKKPQQKAYGVTVDLWSIGVTFYHAACGSLPFIPYGGPR---RNKEIMHKIITEKPPRAIAGVQRKE-KGPIEWIYELPISCRLSVGLKVHLENILPNILEADQEKCWGFDKFFSETNNILERIVVHVFSLPHATMHMVYVLACSSVVNFMEAVSKQTGVAFEN 349          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: slc6a13 (solute carrier family 6 (neurotransmitter transporter), member 13 [Source:Xenbase;Acc:XB-GENE-5947897])

HSP 1 Score: 185.267 bits (469), Expect = 4.907e-50
Identity = 122/355 (34.37%), Postives = 184/355 (51.83%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSK--------QQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLY-LDNLTYNNLVEQTSKLLGYPRED 1099
            MQ    Y+ + +  LG+GATA VY         + A+K           +   +E  +L+ L+H NIV+ +         ++V+VMEYC+ GSL   +E  +   GL +  FL +L+C+  G+++LR   +VHRDIKPGN+M  + ED    +  K+ D G A+ ++DD+ F S+ GTEEYLHP++Y R +  +  Q  +   VDLWSIGVT YHA    LPFIPY   R   R KE +  +   K    I+G Q  + +  I W   LP  CRLS  LK     ++  ++E        +++FF E N IL++    +F+     +  +Y L   +  N +E  SK  G   E+
Sbjct:    1 MQSTPNYLWELDDVLGQGATASVYKARNKKSGEEVAVKVFNNLSYLRPLEVQMREFEMLRKLNHVNIVKLFAVEETGNSKQKVLVMEYCSSGSLLSVLEDPENAYGLSEAEFLIVLQCVVAGMNHLRQNGIVHRDIKPGNIMRLIGEDGRSIY--KLTDFGAARELDDDEKFLSIYGTEEYLHPDIYERAVLKKPQQKAYGVTVDLWSIGVTFYHAACGSLPFIPYGGPR---RNKEIMHKIITEKPPRAIAGVQRKE-KGPIEWIYELPISCRLSVGLKVHLENILPNILEADQEKCWGFDKFFSETNNILERIVVHVFSLPHATMHMVYVLACSSVVNFMEAVSKQTGVAFEN 349          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: slc6a13 (solute carrier family 6 (neurotransmitter transporter), member 13 [Source:Xenbase;Acc:XB-GENE-5947897])

HSP 1 Score: 184.882 bits (468), Expect = 6.392e-50
Identity = 122/355 (34.37%), Postives = 184/355 (51.83%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSK--------QQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLY-LDNLTYNNLVEQTSKLLGYPRED 1099
            MQ    Y+ + +  LG+GATA VY         + A+K           +   +E  +L+ L+H NIV+ +         ++V+VMEYC+ GSL   +E  +   GL +  FL +L+C+  G+++LR   +VHRDIKPGN+M  + ED    +  K+ D G A+ ++DD+ F S+ GTEEYLHP++Y R +  +  Q  +   VDLWSIGVT YHA    LPFIPY   R   R KE +  +   K    I+G Q  + +  I W   LP  CRLS  LK     ++  ++E        +++FF E N IL++    +F+     +  +Y L   +  N +E  SK  G   E+
Sbjct:    1 MQSTPNYLWELDDVLGQGATASVYKARNKKSGEEVAVKVFNNLSYLRPLEVQMREFEMLRKLNHVNIVKLFAVEETGNSKQKVLVMEYCSSGSLLSVLEDPENAYGLSEAEFLIVLQCVVAGMNHLRQNGIVHRDIKPGNIMRLIGEDGRSIY--KLTDFGAARELDDDEKFLSIYGTEEYLHPDIYERAVLKKPQQKAYGVTVDLWSIGVTFYHAACGSLPFIPYGGPR---RNKEIMHKIITEKPPRAIAGVQRKE-KGPIEWIYELPISCRLSVGLKVHLENILPNILEADQEKCWGFDKFFSETNNILERIVVHVFSLPHATMHMVYVLACSSVVNFMEAVSKQTGVAFEN 349          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: slc6a13 (solute carrier family 6 (neurotransmitter transporter), member 13 [Source:Xenbase;Acc:XB-GENE-5947897])

HSP 1 Score: 186.037 bits (471), Expect = 4.519e-49
Identity = 122/355 (34.37%), Postives = 184/355 (51.83%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSK--------QQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLY-LDNLTYNNLVEQTSKLLGYPRED 1099
            MQ    Y+ + +  LG+GATA VY         + A+K           +   +E  +L+ L+H NIV+ +         ++V+VMEYC+ GSL   +E  +   GL +  FL +L+C+  G+++LR   +VHRDIKPGN+M  + ED    +  K+ D G A+ ++DD+ F S+ GTEEYLHP++Y R +  +  Q  +   VDLWSIGVT YHA    LPFIPY   R   R KE +  +   K    I+G Q  + +  I W   LP  CRLS  LK     ++  ++E        +++FF E N IL++    +F+     +  +Y L   +  N +E  SK  G   E+
Sbjct:    1 MQSTPNYLWELDDVLGQGATASVYKARNKKSGEEVAVKVFNNLSYLRPLEVQMREFEMLRKLNHVNIVKLFAVEETGNSKQKVLVMEYCSSGSLLSVLEDPENAYGLSEAEFLIVLQCVVAGMNHLRQNGIVHRDIKPGNIMRLIGEDGRSIY--KLTDFGAARELDDDEKFLSIYGTEEYLHPDIYERAVLKKPQQKAYGVTVDLWSIGVTFYHAACGSLPFIPYGGPR---RNKEIMHKIITEKPPRAIAGVQRKE-KGPIEWIYELPISCRLSVGLKVHLENILPNILEADQEKCWGFDKFFSETNNILERIVVHVFSLPHATMHMVYVLACSSVVNFMEAVSKQTGVAFEN 349          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: psmc1 (proteasome 26S subunit, ATPase 1 [Source:Xenbase;Acc:XB-GENE-950579])

HSP 1 Score: 176.022 bits (445), Expect = 1.804e-47
Identity = 113/315 (35.87%), Postives = 169/315 (53.65%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKC---------SKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQK 979
            MQ    ++   +  LG+GATA+VY G         A+K          +  Q++ E  +LK L+H NIV+ +    +     +V+VME+C   SLY  +E      GL ++ FL +   +  G+++LR   ++HRDIKPGN+M  + ED    +  K+ D G A+ ++DD+ F SL GTEEYLHP+MY R +  +  Q K+ A VDLWSIGVT YHA    LPF P+   R   R KE +  +   K +G ISG Q ++N   I WS  LP  C LS  L+ + + ++  ++E        +E+FF   N +  +
Sbjct:    1 MQSTANHLWLLSDILGQGATANVYRGRNKKTGDLYAVKVFNNLSFLRPADVQMR-EFEVLKKLNHKNIVKLFAIEEEMSSRHKVLVMEFCPCASLYSVLEEPANAYGLPESEFLIVSRDVVAGMNHLRENGIIHRDIKPGNIMRVIGEDGQSVY--KLTDFGAARELDDDEQFVSLYGTEEYLHPDMYERAVLRKEHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPR---RNKEVMYKIIAGKPSGAISGVQRAEN-GPIEWSGELPVTCNLSMGLQTLFTPVLANILEADQEKCWGFEQFFAVTNDVFNR 308          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ikbke (inhibitor of kappaB kinase epsilon [Source:MGI Symbol;Acc:MGI:1929612])

HSP 1 Score: 193.356 bits (490), Expect = 1.392e-51
Identity = 118/330 (35.76%), Postives = 174/330 (52.73%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKC--------SKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLYL 1033
            MQ    Y+   +  LG+GATA VY           A+K           +   +E  +L+ L+H NIV+ +         ++V++MEYC+ GSL   +E  +   GL +  FL +L C+  G+++LR   +VHRDIKPGN+M      G    K+ D G A++++DD+ F S+ GTEEYLHP+MY R +  +  Q      VDLWSIGVTLYHA    LPFIP+   R   R KE +  +   K AG ISG Q  +N   + WS  LP  CRLS  L+     ++  ++E  +     +++FF E + ILQ+    +F+     L  +Y+
Sbjct:    1 MQSTTNYLWHTDDLLGQGATASVYKARNKKSGEVVAVKVFNSASYRRPPEVQVREFEVLRRLNHQNIVKLFAVEETGGSRQKVLIMEYCSSGSLLSVLEDPENTFGLSEEEFLVVLRCVVAGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLSDFGAARKLDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPR---RNKEIMYRITTEKPAGAISGTQKQEN-GPLEWSYSLPITCRLSMGLQNQLVPILANILEVEEDKCWGFDQFFAETSDILQRTVIHVFSLPQAVLHHVYI 326          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Tbk1 (TANK-binding kinase 1 [Source:MGI Symbol;Acc:MGI:1929658])

HSP 1 Score: 179.874 bits (455), Expect = 6.661e-47
Identity = 113/315 (35.87%), Postives = 174/315 (55.24%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSKQ---------QLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQK 979
            MQ  + ++   +  LG+GATA+V+ G         A+K             Q++ E  +LK L+H NIV+ +    +     +V++ME+C  GSLY  +E      GL ++ FL +L  +  G+++LR   +VHRDIKPGN+M  + ED    +  K+ D G A+ +EDD+ F SL GTEEYLHP+MY R +  +  Q K+ A VDLWS+GVT YHA    LPF P+   R   R KE +  +   K +G ISG Q ++N   I WS  +P  C LS+ L+ + + ++  ++E        +++FF E + +L +
Sbjct:    1 MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNNISFLRPVDVQMR-EFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVY--KLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSVGVTFYHAATGSLPFRPFEGPR---RNKEVMYKIITGKPSGAISGVQKAEN-GPIDWSGDMPLSCSLSQGLQALLTPVLANILEADQEKCWGFDQFFAETSDVLHR 308          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ikbke (inhibitor of kappaB kinase epsilon [Source:MGI Symbol;Acc:MGI:1929612])

HSP 1 Score: 179.104 bits (453), Expect = 8.921e-47
Identity = 113/323 (34.98%), Postives = 165/323 (51.08%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSKQQLKKEISILKDLDHYNIVRYYDSL-IKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLYL 1033
            MQ    Y+   +  LG+GATA VY           A+K                  +N   Y     ++    ++V++MEYC+ GSL   +E  +   GL +  FL +L C+  G+++LR   +VHRDIKPGN+M      G    K+ D G A++++DD+ F S+ GTEEYLHP+MY R +  +  Q      VDLWSIGVTLYHA    LPFIP+   R   R KE +  +   K AG ISG Q  +N   + WS  LP  CRLS  L+     ++  ++E  +     +++FF E + ILQ+    +F+     L  +Y+
Sbjct:    1 MQSTTNYLWHTDDLLGQGATASVYKARNKKSGEVVAVKV-----------------FNSASYRRPPEVQGGSRQKVLIMEYCSSGSLLSVLEDPENTFGLSEEEFLVVLRCVVAGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLSDFGAARKLDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPR---RNKEIMYRITTEKPAGAISGTQKQEN-GPLEWSYSLPITCRLSMGLQNQLVPILANILEVEEDKCWGFDQFFAETSDILQRTVIHVFSLPQAVLHHVYI 302          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ulk2 (unc-51 like kinase 2 [Source:MGI Symbol;Acc:MGI:1352758])

HSP 1 Score: 104.375 bits (259), Expect = 2.559e-22
Identity = 67/219 (30.59%), Postives = 106/219 (48.40%), Query Frame = 2
Query:  110 IIDFNKC----LGRGATADVYLG---------LKIDDATQCAMKCSKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMV-----HEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPF 712
            + DF  C    +G GA A V+ G         + I    +  +  S+  L KEI ILK+L H NIV  YD  ++       +VMEYCN G L D+++    L ++     L  +   +  L  K ++HRD+KP N+++      + N+    IK+ D G A+ +  + +  +L G+  Y+ PE+ +         + A  DLWSIG  +Y  LV + PF
Sbjct:    4 VGDFEYCKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSKSQILLGKEIKILKELQHENIVALYD--VQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMRILHSKGIIHRDLKPQNILLSYANRRKSNVSGIRIKIADFGFARYLHSNTMAATLCGSPMYMAPEVIMSQ------HYDAKADLWSIGTVIYQCLVGKPPF 214          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Dapk3 (death-associated protein kinase 3 [Source:MGI Symbol;Acc:MGI:1203520])

HSP 1 Score: 95.5153 bits (236), Expect = 2.330e-21
Identity = 51/171 (29.82%), Postives = 96/171 (56.14%), Query Frame = 2
Query:  203 CSKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFI 715
             S++++++E+SIL+++ H NI+  +D        + V+++E  + G L+DF+   + L ++   + L+ + +G+ YL  K + H D+KP N+M+ + +     IK+ D G A R+E    F+++ GT E++ PE+      G++       D+WSIGV  Y  L    PF+
Sbjct:   56 VSREEIEREVSILREIRHPNIITLHDVFENKT--DVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKHAASPRIKLIDFGIAHRIEAGSEFKNIFGTPEFVAPEIVNYEPLGLE------ADMWSIGVITYILLSGASPFL 218          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9R0T8|IKKE_MOUSE (Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Mus musculus OX=10090 GN=Ikbke PE=1 SV=2)

HSP 1 Score: 193.356 bits (490), Expect = 9.736e-51
Identity = 118/330 (35.76%), Postives = 174/330 (52.73%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKC--------SKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLYL 1033
            MQ    Y+   +  LG+GATA VY           A+K           +   +E  +L+ L+H NIV+ +         ++V++MEYC+ GSL   +E  +   GL +  FL +L C+  G+++LR   +VHRDIKPGN+M      G    K+ D G A++++DD+ F S+ GTEEYLHP+MY R +  +  Q      VDLWSIGVTLYHA    LPFIP+   R   R KE +  +   K AG ISG Q  +N   + WS  LP  CRLS  L+     ++  ++E  +     +++FF E + ILQ+    +F+     L  +Y+
Sbjct:    1 MQSTTNYLWHTDDLLGQGATASVYKARNKKSGEVVAVKVFNSASYRRPPEVQVREFEVLRRLNHQNIVKLFAVEETGGSRQKVLIMEYCSSGSLLSVLEDPENTFGLSEEEFLVVLRCVVAGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLSDFGAARKLDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPR---RNKEIMYRITTEKPAGAISGTQKQEN-GPLEWSYSLPITCRLSMGLQNQLVPILANILEVEEDKCWGFDQFFAETSDILQRTVIHVFSLPQAVLHHVYI 326          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q14164|IKKE_HUMAN (Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Homo sapiens OX=9606 GN=IKBKE PE=1 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 6.228e-50
Identity = 117/330 (35.45%), Postives = 174/330 (52.73%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKC--------SKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLYL 1033
            MQ    Y+   +  LG+GATA VY           A+K          ++   +E  +L+ L+H NIV+ +         ++V+VMEYC+ GSL   +E  +   GL ++ FL +L C+  G+++LR   +VHRDIKPGN+M      G    K+ D G A+ ++DD+ F S+ GTEEYLHP+MY R +  +  Q      VDLWSIGVTLYHA    LPFIP+   R   R KE +  +   K AG I+G Q  +N   + WS  LP  C+LS  L+     ++  ++E        +++FF E + ILQ+    +F+     L  +Y+
Sbjct:    1 MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLRKLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVVAGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPR---RNKEIMYRITTEKPAGAIAGAQRREN-GPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFAETSDILQRVVVHVFSLSQAVLHHIYI 326          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UHD2|TBK1_HUMAN (Serine/threonine-protein kinase TBK1 OS=Homo sapiens OX=9606 GN=TBK1 PE=1 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 2.694e-47
Identity = 131/406 (32.27%), Postives = 212/406 (52.22%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSKQ---------QLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFN--SLTGELQFLYLDNLT--YNNLVEQTSKLLGYPREDFIILTKLKRLEPLSDSQSECLQSVPIKGHLTYDLTDNTILVMVTKPV 1240
            MQ  + ++   +  LG+GATA+V+ G         A+K             Q++ E  +LK L+H NIV+ +    +     +V++ME+C  GSLY  +E      GL ++ FL +L  +  G+++LR   +VHRDIKPGN+M  + ED    +  K+ D G A+ +EDD+ F SL GTEEYLHP+MY R +  +  Q K+ A VDLWSIGVT YHA    LPF P+   R   R KE +  +   K +G ISG Q ++N   I WS  +P  C LSR L+ + + ++  ++E        +++FF E + IL +    +F+   +T    +++  N    ++ LV + +K++   +E   ++ + +RL          L+   +  H      +N I V+  +P+
Sbjct:    1 MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMR-EFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVY--KLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPR---RNKEVMYKIITGKPSGAISGVQKAEN-GPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQE---LIYEGRRL---------VLEPGRLAQHFPKTTEENPIFVVSREPL 387          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DFJ6|TBK1_XENLA (Serine/threonine-protein kinase TBK1 OS=Xenopus laevis OX=8355 GN=tbk1 PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 9.463e-47
Identity = 133/405 (32.84%), Postives = 205/405 (50.62%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKC----SKQQLK----KEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLYLDNL----TYNNLVEQTSKLLGYPREDFIILTKLKRLEPLSDSQSECLQSVPIKGHLTYDLTDNTILVMVTKPV 1240
            MQ    Y+   +  LG+GATA+VY G         A+K     S Q+      +E  +LK L+H NIV+ +    +     +V+VME+C   SLY  +E      GL ++ FL +   +  G+++LR   ++HRDIKPGN+M  + ED    +  K+ D G A+ +EDD+ F SL GTEEYLHP+MY R +  +  Q K+ A VDLWSIGVT YHA    LPF P+   R   R KE +  +   K +G ISG Q ++N   I WS  LP  C LS  L+ + + ++  ++E        +E+FF   N I  +    +F+        +Y++       +++LV + +K+ G  +E   +L + +RL          L+   +  H      +N I V+  + V
Sbjct:    1 MQSTANYLWMLSDILGQGATANVYRGRNKKTGDLYAVKVFNSLSFQRPADVQMREFEVLKKLNHKNIVKLFAIEEEMSSRHKVLVMEFCPCASLYSVLEEPTNSYGLPESEFLIVSRDVVAGMNHLRENGIIHRDIKPGNIMREIGEDGKSVY--KLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKEHQKKYSATVDLWSIGVTFYHAATGSLPFRPFEGPR---RNKEVMYKIIAGKPSGAISGVQRAEN-GPIEWSGELPATCNLSMGLQTLFTPVLANILEADQEKCWGFEQFFAVTNDIFNRIVVHVFSLQQMTPHKIYINTYDKVPDFHDLVYKQTKIPGQNQE---LLFEGRRL---------VLEQGRLAQHFPITTDENPIFVLTREMV 387          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9WUN2|TBK1_MOUSE (Serine/threonine-protein kinase TBK1 OS=Mus musculus OX=10090 GN=Tbk1 PE=1 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 4.659e-46
Identity = 113/315 (35.87%), Postives = 174/315 (55.24%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSKQ---------QLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQK 979
            MQ  + ++   +  LG+GATA+V+ G         A+K             Q++ E  +LK L+H NIV+ +    +     +V++ME+C  GSLY  +E      GL ++ FL +L  +  G+++LR   +VHRDIKPGN+M  + ED    +  K+ D G A+ +EDD+ F SL GTEEYLHP+MY R +  +  Q K+ A VDLWS+GVT YHA    LPF P+   R   R KE +  +   K +G ISG Q ++N   I WS  +P  C LS+ L+ + + ++  ++E        +++FF E + +L +
Sbjct:    1 MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNNISFLRPVDVQMR-EFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVY--KLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSVGVTFYHAATGSLPFRPFEGPR---RNKEVMYKIITGKPSGAISGVQKAEN-GPIDWSGDMPLSCSLSQGLQALLTPVLANILEADQEKCWGFDQFFAETSDVLHR 308          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: K1PYC1 (Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Crassostrea gigas OX=29159 GN=CGI_10003837 PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 8.085e-54
Identity = 118/325 (36.31%), Postives = 180/325 (55.38%), Query Frame = 2
Query:  107 YIIDFNKCLGRGATADVYLGLKIDDATQCAMK-CSK---QQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMY-IRYLEGIQIKHKA-----NVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLME--RTDTNTYERFFDEANKILQKKRALMFNSLTGELQFLYLD 1036
            Y+   ++C+GRGAT DVY G+       CA+K C     QQL++E+  ++ L H NI ++Y         + ++VME C KG+L + +       GL +  +L+    L  G+ +LR     HRDIKPGN++V   + G +  K+ D GTAK ++D   FQSLVGTEEYLHP+++   ++E    +H+      +VDLWS+G TLYH    ++PF P++        K T+  M   K  G+ISG Q S    DI WS  LP  CRLS+ L++  ++    L+E       T++ FF  A+ +LQ+ R   F+ +  EL ++Y+D
Sbjct:   10 YVYKTDECIGRGATGDVYKGVHKVTGEHCALKLCDSRFTQQLQREVEAMRQLQHPNITKFYQLEYDKESAKPILVMELCEKGNLLEVLREPSNAFGLPEEEYLRFFSHLVSGMKHLRQNGFSHRDIKPGNILVCIADDGSYVYKLSDFGTAKPLKDGDFFQSLVGTEEYLHPDIFKAAFIE----RHRPREFDISVDLWSLGATLYHTATGKVPFQPFH----GRGDKHTMFQMISHKDQGMISGEQTSAT-GDIIWSKELPKTCRLSKFLRDTLTEFFVRLLECHVHQMWTFDGFFVAAHDLLQEDRLYPFSVVDSELYYIYID 325          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A3S3NFL8 (Serine/threonine-protein kinase TBK1-like protein OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_08589 PE=4 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 8.180e-54
Identity = 141/377 (37.40%), Postives = 208/377 (55.17%), Query Frame = 2
Query:   80 NKQMQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKC--------SKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLY----DFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN---TYERFFDEANKILQKKRALMF--NSLTGELQFLYL-DNLTYNNLVEQTSKLLGYPREDFIILTKLKRLEPLSD 1144
            N  ++  N YI + N  LG+GAT  VY G+  +     A+KC          +  K+E  +LK ++H NIV+      +     +V++ME C  GSL+    D I  H GL +  FL +L+ L  G+ +LR   ++HRD+KPGN+M  V ED +  +  K+ D G A+ +EDDQ F SL GTEEYLHP+MY R +  +       ANVDLWSIGVTL+H     LPF P+       + KET+  +   KQ+GIISG Q+S+N  +I WS  LP  C LS  L+ + + L+  LME  D++   ++++FFD    IL  K   +F  N LT  + +L   +NLT  +L  Q   ++  P +  ++L   K++  L+D
Sbjct:    3 NSYLRSSNNYIWNVNNVLGKGATGAVYNGVNKNTGEAVAVKCFNHLSQMRPYEVQKREFEVLKKVNHQNIVKLLAIEEENDSKHKVLIMELCTGGSLFNILDDPINCH-GLEEKEFLNVLKHLSAGMKHLRDNNIIHRDLKPGNIMKYVGEDGISIY--KLTDFGAARELEDDQQFMSLYGTEEYLHPDMYERAVLRKSAGKSFHANVDLWSIGVTLFHIATGSLPFRPFG----GRKNKETMFKITTEKQSGIISGIQHSEN-GEIEWSRTLPKTCLLSPALQALVTPLLAGLME-CDSHKMWSFDKFFDTVTYILSHKIYHIFYINHLTDVVIYLLPQENLT--DLKHQIESIVNIPPKSQLLLFNKKQILDLTD 368          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A2R7WRJ8 (Protein kinase domain-containing protein OS=Oncopeltus fasciatus OX=7536 GN=OFAS_OFAS011587 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 8.966e-54
Identity = 136/364 (37.36%), Postives = 193/364 (53.02%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSKQQLK--------KEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN---TYERFFDEANKILQKKRALMFNSLTGELQFLYLDNL-TYNNLVEQTSKLLGYPREDFIILTKLKRL 1129
            ++G   Y+      LG+GAT  V+ G+   +    A+K   Q           +E  +LK + H NIV+      +  G  +VIVME C  GSL++ ++  +   GL +  FL +LE L  G+ +LR   LVHRD+KPGN+M    + G    K+ D G A+ +E+DQ F SL GTEEYLHP+MY R +  + +     A VDLWSIGVTLYH     LPF PY       R KET+ ++   K +G+ISG Q+S+N   I W   LP  C+LS  LK+  + L+  L+E  DT    ++E+FF E   IL +KR  +F+    +   +Y D L  Y N  EQ  +    P  + I+L   K L
Sbjct:    4 LRGSTNYVWCTTSVLGKGATGAVFQGVNKHNGEPVAVKTFNQLSHMRPHDVQIREFEVLKKVKHENIVKLLAIEEEQDGRGKVIVMELCTGGSLFNILDDPENTYGLQEEEFLLVLEHLSAGMKHLRDNNLVHRDLKPGNIMKFISDDGSTVYKLTDFGAARELEEDQQFMSLYGTEEYLHPDMYERAVLRKPVGKTFGATVDLWSIGVTLYHVATGNLPFRPYG----GRRNKETMYYITTKKASGVISGTQSSEN-GPIDWCRSLPKGCQLSNGLKKYITPLLAGLLE-VDTQKIWSFEKFFTEVTNILTRKRLHVFHIHKMQNIRIYFDPLEKYCNFKEQVCEQAEVPPNNQILLYSNKHL 361          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: K1QYZ7 (Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Crassostrea gigas OX=29159 GN=CGI_10012310 PE=4 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 3.418e-53
Identity = 119/325 (36.62%), Postives = 182/325 (56.00%), Query Frame = 2
Query:  107 YIIDFNKCLGRGATADVYLGLKIDDATQCAMK-CSK---QQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMY-IRYLEGIQIKHKA-----NVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLYLD 1036
            Y+   ++C+GRGAT DVY G+       CA+K C     QQL++E+  ++ L H NI ++Y         + ++VME C KG+L + +       GL +  +L+    L  G+ +LR     HRDIKPGN++V   + G +  K+ D GTAK ++D   FQSLVGTEEYLHP+++   ++E    +H+      +VDLWS+G TLYH    ++PF P++        K+T+  M   K  G+ISG Q S    DI WS  LP  CRLS+ L++  ++ +  L+E       T++ FF  A+ +LQK R  +F+ +  EL  +Y+D
Sbjct:   10 YVYKTDECIGRGATGDVYKGVHKVTGEHCALKLCDSRFTQQLQREVEAMRQLQHPNITKFYQLEYDKESAKPILVMELCEKGNLLEVLREPSNAFGLPEEEYLRFFSHLVSGMKHLRQNGFSHRDIKPGNILVCIADDGSYVYKLSDFGTAKPLKDGDFFQSLVGTEEYLHPDIFKAAFIE----RHRPREFDISVDLWSLGATLYHTATGKVPFQPFH----GRGDKQTMFQMISHKDPGVISGEQTSAT-GDIIWSKELPKTCRLSKYLRDTLTEFLVRLLECQANRMWTFDGFFVAADDLLQKHRLYLFSVVDSELYHIYMD 325          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: K1QHY5 (Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Crassostrea gigas OX=29159 GN=CGI_10012313 PE=4 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 3.730e-53
Identity = 119/325 (36.62%), Postives = 182/325 (56.00%), Query Frame = 2
Query:  107 YIIDFNKCLGRGATADVYLGLKIDDATQCAMK-CSK---QQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMY-IRYLEGIQIKHKA-----NVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLYLD 1036
            Y+   ++C+GRGAT DVY G+       CA+K C     QQL++E+  ++ L H NI ++Y         + ++VME C KG+L + +       GL +  +L+    L  G+ +LR     HRDIKPGN++V   + G +  K+ D GTAK ++D   FQSLVGTEEYLHP+++   ++E    +H+      +VDLWS+G TLYH    ++PF P++        K+T+  M   K  G+ISG Q S    DI WS  LP  CRLS+ L++  ++ +  L+E       T++ FF  A+ +LQK R  +F+ +  EL  +Y+D
Sbjct:   10 YVYKTDECIGRGATGDVYKGVHKVTGEHCALKLCDSRFTQQLQREVEAMRQLQHPNITKFYQLEYDKESAKPILVMELCEKGNLLEVLREPSNAFGLPEEEYLRFFSHLVSGMKHLRQNGFSHRDIKPGNILVCIADDGSYVYKLSDFGTAKPLKDGDFFQSLVGTEEYLHPDIFKAAFIE----RHRPREFDISVDLWSLGATLYHTATGKVPFQPFH----GRGDKQTMFQMISHKDPGVISGEQTSAT-GDIIWSKELPKTCRLSKYLRDTLTEFLVRLLECQANRMWTFDGFFVAADDLLQKHRLYLFSVVDSELYHIYMD 325          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: tbk1 (TANK-binding kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060512-359])

HSP 1 Score: 186.422 bits (472), Expect = 3.237e-49
Identity = 125/339 (36.87%), Postives = 183/339 (53.98%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSKQ---------QLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLME--RTDTNTYERFFDEANKILQKKRALMFNSLTGELQFLYLDNLTYN 1051
            MQ    Y+   +  LG+GATA+VY G         A+K             Q++ E  +LK L+H NIV+ +    +     +V+VMEYC  GSLY  +E      GL ++ FL +L+ +  G+++LR   +VHRDIKPGN+M  + ED    +  K+ D G A+ +EDD+ F SL GTEEYLHP+MY R +  +  Q K+ A VDLWSIGVT YHA    LPF P+   R   R KE +  +   K +G ISG Q  +N   I W   +P  C LSR L+ + + ++  ++E  +     +++FF E + IL +    +F+     L  +Y+   TYN
Sbjct:   12 MQSTTNYLWLLSDLLGQGATANVYRGRHKKTGDLYAVKVFNNLSFLRPLDVQMR-EFEVLKKLNHKNIVKLFAVEEESNSRHKVLVMEYCPYGSLYTVLEEPSNAYGLPEDEFLIVLQDVVAGMNHLREYGIVHRDIKPGNIMRVIGEDGRSVY--KLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGCLPFRPFEGPR---RNKEVMYKIITEKPSGAISGHQKFEN-GKIEWCAEMPVSCSLSRGLQCLLTPVLANILEVDQEKCWGFDQFFAETSDILHRTVVYVFSLQQATLHHVYIH--TYN 341          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ikbke (inhibitor of nuclear factor kappa B kinase subunit epsilon [Source:ZFIN;Acc:ZDB-GENE-040718-251])

HSP 1 Score: 184.882 bits (468), Expect = 5.855e-49
Identity = 119/314 (37.90%), Postives = 171/314 (54.46%), Query Frame = 2
Query:  131 LGRGATADVYLGLKIDDATQCAMKC--------SKQQLKKEISILKDLDHYNIVRYYD-SLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIR-YLEGIQIK-HKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALM--FNSLTG 1012
            LG+GATA+VY           A+K           +   +E  +L+ L+H NIV+ +    +     ++V+VME+C+ GSL + +E  +   GLC++ FL +L C+  GI +LR   +VHRDIKPGN+M  V ED    +  K+ D G A+ +EDD+ F S+ GTEEYLHP+MY R  L   Q K +   VDLWSIGVT YHA    LPFIP+   R   R K  +  +   K   +I+G Q  +N  +I WS  LPD C+LS  LK     ++  ++E        +++FF     ILQ  R ++  F + TG
Sbjct:   16 LGQGATANVYKARNKKKGEVVAVKVFNVASYSRPYEVQMREFDMLRRLNHVNIVKLFAVEEMHLNPKQKVLVMEFCSGGSLLNVLEEPKNAFGLCESEFLIVLRCVVHGIKHLRDNGMVHRDIKPGNIMRQVGEDGRSIY--KLTDFGAARELEDDETFMSIYGTEEYLHPDMYERAVLRKPQHKTYGVTVDLWSIGVTFYHAATGSLPFIPFGGPR---RNKPIMHKITTEKPDKVIAGVQKVEN-GEIEWSYQLPDFCQLSEGLKMQLVPVLANILEANQEKCWGFDQFFAATTDILQLFRLIIKFFQAQTG 323          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ikbke (inhibitor of nuclear factor kappa B kinase subunit epsilon [Source:ZFIN;Acc:ZDB-GENE-040718-251])

HSP 1 Score: 183.726 bits (465), Expect = 2.586e-48
Identity = 117/319 (36.68%), Postives = 171/319 (53.61%), Query Frame = 2
Query:  131 LGRGATADVYLGLKIDDATQCAMKC--------SKQQLKKEISILKDLDHYNIVRYYD-SLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIR-YLEGIQIK-HKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLYL 1033
            LG+GATA+VY           A+K           +   +E  +L+ L+H NIV+ +    +     ++V+VME+C+ GSL + +E  +   GLC++ FL +L C+  GI +LR   +VHRDIKPGN+M  V ED    +  K+ D G A+ +EDD+ F S+ GTEEYLHP+MY R  L   Q K +   VDLWSIGVT YHA    LPFIP+   R   R K  +  +   K   +I+G Q  +N  +I WS  LPD C+LS  LK     ++  ++E        +++FF     ILQ+    +F+        +Y+
Sbjct:   16 LGQGATANVYKARNKKKGEVVAVKVFNVASYSRPYEVQMREFDMLRRLNHVNIVKLFAVEEMHLNPKQKVLVMEFCSGGSLLNVLEEPKNAFGLCESEFLIVLRCVVHGIKHLRDNGMVHRDIKPGNIMRQVGEDGRSIY--KLTDFGAARELEDDETFMSIYGTEEYLHPDMYERAVLRKPQHKTYGVTVDLWSIGVTFYHAATGSLPFIPFGGPR---RNKPIMHKITTEKPDKVIAGVQKVEN-GEIEWSYQLPDFCQLSEGLKMQLVPVLANILEANQEKCWGFDQFFAATTDILQRIHIHIFSLQQATAHTIYI 328          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ikbke (inhibitor of nuclear factor kappa B kinase subunit epsilon [Source:ZFIN;Acc:ZDB-GENE-040718-251])

HSP 1 Score: 183.341 bits (464), Expect = 3.140e-48
Identity = 117/319 (36.68%), Postives = 171/319 (53.61%), Query Frame = 2
Query:  131 LGRGATADVYLGLKIDDATQCAMKC--------SKQQLKKEISILKDLDHYNIVRYYD-SLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIR-YLEGIQIK-HKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLYL 1033
            LG+GATA+VY           A+K           +   +E  +L+ L+H NIV+ +    +     ++V+VME+C+ GSL + +E  +   GLC++ FL +L C+  GI +LR   +VHRDIKPGN+M  V ED    +  K+ D G A+ +EDD+ F S+ GTEEYLHP+MY R  L   Q K +   VDLWSIGVT YHA    LPFIP+   R   R K  +  +   K   +I+G Q  +N  +I WS  LPD C+LS  LK     ++  ++E        +++FF     ILQ+    +F+        +Y+
Sbjct:   16 LGQGATANVYKARNKKKGEVVAVKVFNVASYSRPYEVQMREFDMLRRLNHVNIVKLFAVEEMHLNPKQKVLVMEFCSGGSLLNVLEEPKNAFGLCESEFLIVLRCVVHGIKHLRDNGMVHRDIKPGNIMRQVGEDGRSIY--KLTDFGAARELEDDETFMSIYGTEEYLHPDMYERAVLRKPQHKTYGVTVDLWSIGVTFYHAATGSLPFIPFGGPR---RNKPIMHKITTEKPDKVIAGVQKVEN-GEIEWSYQLPDFCQLSEGLKMQLVPVLANILEANQEKCWGFDQFFAATTDILQRIHIHIFSLQQATAHTIYI 328          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: tbk1 (TANK-binding kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060512-359])

HSP 1 Score: 173.711 bits (439), Expect = 3.665e-45
Identity = 112/278 (40.29%), Postives = 153/278 (55.04%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSKQ---------QLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSR 874
            MQ    Y+   +  LG+GATA+VY G         A+K             Q++ E  +LK L+H NIV+ +    +     +V+VMEYC  GSLY  +E      GL ++ FL +L+ +  G+++LR   +VHRDIKPGN+M  + ED    +  K+ D G A+ +EDD+ F SL GTEEYLHP+MY R +  +  Q K+ A VDLWSIGVT YHA    LPF P+   R   R KE +  +   K +G ISG Q  +N   I W   +P  C LSR
Sbjct:   12 MQSTTNYLWLLSDLLGQGATANVYRGRHKKTGDLYAVKVFNNLSFLRPLDVQMR-EFEVLKKLNHKNIVKLFAVEEESNSRHKVLVMEYCPYGSLYTVLEEPSNAYGLPEDEFLIVLQDVVAGMNHLREYGIVHRDIKPGNIMRVIGEDGRSVY--KLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGCLPFRPFEGPR---RNKEVMYKIITEKPSGAISGHQKFEN-GKIEWCAEMPVSCSLSR 282          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ikbke (inhibitor of nuclear factor kappa B kinase subunit epsilon [Source:ZFIN;Acc:ZDB-GENE-040718-251])

HSP 1 Score: 112.464 bits (280), Expect = 8.439e-26
Identity = 100/321 (31.15%), Postives = 155/321 (48.29%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSKQ---------QLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMY----IRYLEGIQIKHKANVDLWSIGVTL----YHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQK 979
            MQ    Y+   N  LG+GAT  VY G         A+K   Q         Q++ E  +L+ LDH NIV+ +    +    ++VI+ME C+ GSLY  ++  +   GL +  FL +L  +  G+++LR K ++HRD+KPGN+M  V ED    +  K+ D G A+++ED     SL GTEE L   +Y    I     ++ +  +    WS    L     H L   +  I Y       +   +L  +   K  G +SG Q  +    I W+  LP  C+LSR LK + + L+  +ME    +   +++FF  AN+IL +
Sbjct:    1 MQSTANYLWWTNDVLGQGATGSVYRGRNKKTGDLFAIKTFNQLSYMRPQDVQVR-EFDVLRRLDHKNIVKLFAIEDENNTKQKVIIMELCSGGSLYTILDEPENAYGLTEGEFLIVLRDVVSGMNHLREKGIIHRDLKPGNIMRVVGEDGRSVY--KLTDFGAARQLEDKGQLMSLYGTEESLKVNVYLLNNINSNFPLKREGSSTGGPWSRSGPLRYMALHHLEVHMREIRY-------KNLFSLYRITAEKPRGAVSGEQKEEG-GSIVWNEELPITCQLSRGLKLLLTPLLANIMEVNKQHCWNFDQFFAAANEILTR 310          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001278.1 (pep scaffold:Pmarinus_7.0:GL476529:253165:339525:-1 gene:ENSPMAG00000001147.1 transcript:ENSPMAT00000001278.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 2.092e-21
Identity = 57/190 (30.00%), Postives = 101/190 (53.16%), Query Frame = 2
Query:  212 QQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQ----VIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHM 769
            + +K+E+SIL++L H NI+  ++       YE      +++E  + G L+DF+   + L ++   + L+ + +G+SYL  + + H D+KP N+M+ E+     H+K+ D G A+ + D   F+ + GT E++ PE+      G+Q       D+WSIGV  Y  L    PF+        D  +ETL ++
Sbjct:   41 EDIKREVSILRELRHPNIISLHEV------YENDTDVTLILELVSGGELFDFLAHKESLSEDEATEFLKQILDGVSYLHCRRIAHFDLKPENIMLLENRAPKAHVKIIDFGLAQSIVDGVEFRHIFGTPEFVVPEIVNYEPLGVQ------ADMWSIGVMTYILLSGASPFL-------GDTKEETLSNI 211          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: nek2 (NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-752])

HSP 1 Score: 96.2857 bits (238), Expect = 2.572e-21
Identity = 62/194 (31.96%), Postives = 99/194 (51.03%), Query Frame = 2
Query:  209 KQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLK---MLECLKEGISYLR--------GKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLF-QSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKE 754
            KQ L  E+++L++L H NIVRY+D +I        IVMEYC  G L   I   +   D  FL+   +L  L + +  LR        G+ ++HRD+KP N+ +   +    ++K+GD G A+ ++ D  F ++ VGT  Y+ PE + R      + +    D+WS+G  LY       PF   N  + +++ KE
Sbjct:   18 KQMLVSEVNLLRELKHPNIVRYFDRIIDRSNTTLYIVMEYCECGDLASLISRCRR--DRRFLEEEFVLRVLAQLVLALRECHRRTAGGRTVLHRDLKPANVFLDARH----NVKLGDFGLARILQHDTSFAKTFVGTPYYMSPEQFSR------MSYNEKSDIWSLGCLLYELCALVPPFTAMNQKQLAEKIKE 199          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 95.5153 bits (236), Expect = 1.270e-20
Identity = 69/213 (32.39%), Postives = 108/213 (50.70%), Query Frame = 2
Query:  122 NKCLGRGATADVYLGLKIDDATQCAMK----------CSKQ--QLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVE----DDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPF 712
             K LG+GA   VYL    D   + A+K           SK+   L+ EI +LK+L H  IV+Y+  L         I MEY   GS+ D +  +  L +N+  K    + EG+S+L G ++VHRDIK  N++   D+ G  ++K+GD G +KR++         +S+ GT  ++ PE+    + G     KA  D+WS+G T+   L  + P+
Sbjct:  362 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETSKEVNALECEIQLLKNLQHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANIL--RDSTG--NVKLGDFGASKRLQTICSQGTAMRSVTGTPYWMSPEV----INGEGYGRKA--DIWSVGCTVVEMLTEKPPW 564          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008193.1 (pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-1 gene:ENSPMAG00000007385.1 transcript:ENSPMAT00000008193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 1.905e-20
Identity = 61/212 (28.77%), Postives = 103/212 (48.58%), Query Frame = 2
Query:   92 QGKNKYIIDFN-----KCLGRGATADVYLGLKIDDATQCAMKCSKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPF 712
             G + + + F      + LG GA   V+LG         A+K  ++Q + +I  L  L H NI+ +         Y   I+MEYC +G LY+ +   + +   + +     +  G+SYL    ++HRD+K  N+++  D+     +K+ D GT+K + +     S  GT  ++ PE+ IR  E +  K    VD+WS GV L+  L  E+P+
Sbjct:    2 HGADSWEVPFEEISELQWLGSGAQGAVFLGK--FRGEHVAVKKVREQKETDIKHLHKLRHPNIITFKGVCTHAPCY--CIIMEYCAQGQLYEVLRAGRRISPELLVGWTRGIARGMSYLHLHKIIHRDLKSPNVLITHDD----EVKISDFGTSKEMREKSTRMSFAGTVAWMAPEV-IRN-EPVSEK----VDIWSFGVVLWELLTGEIPY 199          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: ATG1 (Protein serine/threonine kinase; required for vesicle formation in autophagy and the cytoplasm-to-vacuole targeting (Cvt) pathway; structurally required for phagophore assembly site formation; during autophagy forms a complex with Atg13p and Atg17p; essential for cell cycle progression from G2/M to G1 under nitrogen starvation [Source:SGD;Acc:S000003148])

HSP 1 Score: 91.6633 bits (226), Expect = 1.937e-19
Identity = 91/337 (27.00%), Postives = 141/337 (41.84%), Query Frame = 2
Query:  125 KCLGRGATADVYLG-LKIDDATQCAMK-CSKQQLKK---------EISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFI------------------------ELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGY-----FH------------IKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTNTYERFFDEANKILQK 979
            K +G+G+ A VY G L  D +   A+K  S+ +LK          EI+ILK + H +IV   D   +    +  ++MEYC  G L   +                        E H GL     L  L+ L   + +LR K LVHRDIKP N+++    +GY     FH            +K+ D G A+ + +  L ++L G+  Y+ PE+ + Y      K+ A  DLWS+G  ++       PF          RA   L+   + K+A            ND+      P  C +   LKE+   L+ +  +      +E FF  ANK++ +
Sbjct:   28 KEIGKGSFATVYRGHLTSDKSQHVAIKEVSRAKLKNKKLLENLEIEIAILKKIKHPHIVGLID--CERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLLRTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKSFHELGFVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEI-LNYQ-----KYNAKADLWSVGTVVFEMCCGTPPF----------RASNHLELFKKIKRA------------NDVI---TFPSYCNIEPELKELICSLLTF--DPAQRIGFEEFF--ANKVVNE 327          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: GIN4 (Protein kinase involved in bud growth and assembly of the septin ring; proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Hsl1p; GIN4 has a paralog, KCC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002915])

HSP 1 Score: 83.5741 bits (205), Expect = 6.353e-17
Identity = 50/165 (30.30%), Postives = 89/165 (53.94%), Query Frame = 2
Query:  218 LKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPF 712
            +++EI I+K L+H N++R YD  +     +  +V+EY  KG L++ +     L ++  ++    +  G+SY     +VHRD+KP N+++       ++IK+ D G A    + +L ++  G+  Y  PE+    + GI  +  A+ D+WS GV L+  L   LPF
Sbjct:   78 IEREIIIMKLLNHPNVLRLYD--VWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK----YNIKIADFGMAALETEGKLLETSCGSPHYAAPEI----VSGIPYQGFAS-DVWSCGVILFALLTGRLPF 231          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KCC4 (Protein kinase of the bud neck involved in the septin checkpoint; associates with septin proteins, negatively regulates Swe1p by phosphorylation, shows structural homology to bud neck kinases Gin4p and Hsl1p; KCC4 has a paralog, GIN4, that arose from the whole genome duplication [Source:SGD;Acc:S000000529])

HSP 1 Score: 83.1889 bits (204), Expect = 9.398e-17
Identity = 50/165 (30.30%), Postives = 85/165 (51.52%), Query Frame = 2
Query:  218 LKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPF 712
            +++EI I+K L H N++  YD  +        +++EY  KG L++ +  H  L +   +     +  GISY     +VHRD+KP N+++      +++IK+ D G A    D  L ++  G+  Y  PE+    + G+  +  A+ D+WS GV L+  L   LPF
Sbjct:   74 IEREIVIMKLLSHPNVLSLYD--VWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLD----SFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI----VSGLPYEGFAS-DVWSCGVILFALLTGRLPF 227          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 82.8037 bits (203), Expect = 1.026e-16
Identity = 62/204 (30.39%), Postives = 99/204 (48.53%), Query Frame = 2
Query:  125 KCLGRGATADVYLGLKIDDATQCAMKCSKQQ-------LKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ-GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPF 712
            + +GRG+   VY  +        A+K    +       +  EIS+LK+L+H NIV+Y+  + K   YE  I++EYC  GSL   I     GL +N     +     G+ YL G+ ++HRDIK  N+++  DN     +K+ D G +  V    L  +L GT  ++ PE+      G +     + D+WS+G T+   L    P+
Sbjct:   29 QVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEISLLKNLNHNNIVKYHGFIRK--SYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNT----VKLADFGVSTIVNSSAL--TLAGTLNWMAPEIL-----GNRGASTLS-DIWSLGATVVEMLTKNPPY 218          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 80.4925 bits (197), Expect = 2.626e-16
Identity = 60/211 (28.44%), Postives = 99/211 (46.92%), Query Frame = 2
Query:  128 CLGRGATADVYLGLKIDDATQ--CAMKCSKQQ--------LKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELH--QGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFIPYN 724
            C+GRG   DVY    +D  TQ   A+K    +        L +EI  L +L    I  Y  ++++       IVMEYC  GS  D ++     GL +     ++  +  G+ YL  +  +HRDIK  N++++E+ M    +K+GD G +  +       + VGT  ++ PE+    ++G    +    D+WS+G+T Y  L    P   Y+
Sbjct:   23 CIGRGNFGDVYKA--VDRVTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKSPLITNYIATMLE--DVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGM----VKLGDFGVSGHIRSTLKRDTFVGTPYWMAPEVVCCEVDG----YNEKADIWSLGITTYELLKGLPPLSKYD 221          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO44386 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW41])

HSP 1 Score: 162.54 bits (410), Expect = 3.845e-44
Identity = 100/315 (31.75%), Postives = 165/315 (52.38%), Query Frame = 2
Query:   86 QMQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSK--------QQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM-VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKK 982
            + +  + YI +    LG+GAT  VY G         A+K S         +  K+E  +L  LDH NIV+ + S  +     ++IVME C+ GSL+  +E      GL +   + ++  +  G+ +L    +VHRD+KPGN+M V+ D+ G    K+ D G A+ + +   F S+ GTEEYLHP++Y R +  +       A VDLWSIGVT YH     LPF P+       + K+T+ H+   K +G+I+G Q S+   ++ W++ LPD   LS+  + + + L+  ++E       ++++FF     ++ +K
Sbjct:    2 ETRSSSNYIWNLKSVLGQGATGAVYTGRHKKSGDVVAVKTSNHLGMMRPLEVRKREFDVLSKLDHENIVKIFASETELRSQNEIIVMELCSGGSLFTMLEHPSNAYGLSEQDCIAVIRDVVAGMKHLHDNGIVHRDLKPGNIMRVYRDD-GSCVYKLTDFGAARELMESDQFVSIYGTEEYLHPDLYERGVLRKATGKTFGAQVDLWSIGVTFYHIATGRLPFRPFG----GRQNKDTMYHITTRKASGMIAGVQKSEG-GEVEWTDKLPDHTCLSQGFRNLLTPLLAGVLESDPAKMMSFDQFFAYVQDMVSRK 310          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4I8])

HSP 1 Score: 94.7449 bits (234), Expect = 4.550e-21
Identity = 64/204 (31.37%), Postives = 103/204 (50.49%), Query Frame = 2
Query:  131 LGRGATADVYLGLKI-DDATQCAMKCSKQQ---------LKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPF 712
            LG+G+ A VY   K  D+    A+KC K++         L  EI +L++L+H +IV+  D   ++      ++MEYC  G L  FI   + L + M  K L  L   + Y+R   + H D+KP N+++   +     +K+ D G A+++  +    ++ G+  Y+ PEM           + A+VDLWS+GV LY  L  E PF
Sbjct:   23 LGQGSYATVYKAFKKGDNRDVVAIKCIKKKTLSKAATENLLTEIELLRNLEHEHIVQLKD--FQWDENHIFLIMEYCGGGDLSRFIHSKRALPERMARKFLRQLACALQYMRSYDVAHMDLKPQNLLLSSRHNPV--LKIADFGFAQKLHPNSEASNIRGSPLYMAPEMICCQ------SYDASVDLWSVGVILYETLFGEPPF 216          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO37575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG8])

HSP 1 Score: 95.5153 bits (236), Expect = 5.092e-21
Identity = 60/214 (28.04%), Postives = 108/214 (50.47%), Query Frame = 2
Query:  101 NKYIIDFN-----KCLGRGATADVYLGLKIDDATQCAMKCSKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQV--IVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKA---NVDLWSIGVTLYHALVTELPF 712
            + ++I F      + LG GA   V+LG+  D+  Q A+K  + +   +I  L++L+H NI+R+       C    V  +VMEYC  G L++ +   + +   + +     + +G+ YL G  ++HRD+K  N++V  +++    +K+ D GT K   +     +  GT  ++ PE+         I+++     VD+WS GV L+  L  ELP+
Sbjct:   26 DSWVIPFEEIHELQWLGSGAQGAVFLGVYSDE--QVAVKKVRHEKDTDIKHLRNLNHPNIIRFKG----VCNQAPVYCVVMEYCPYGQLFEVLRDGREITPELLVGWTTQIADGMHYLHGNKIIHRDLKSPNILVSSNDI----LKISDFGTCKEFNEKSAKMTFAGTVAWMAPEV---------IRNEPCSEKVDVWSFGVLLWELLTGELPY 220          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO35437 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH0])

HSP 1 Score: 92.4337 bits (228), Expect = 2.050e-20
Identity = 73/233 (31.33%), Postives = 110/233 (47.21%), Query Frame = 2
Query:   92 QGK-NKYIIDFNKCLGRGATADVYLG----------LKIDDATQCAMKCSKQQLKKEISILKDLDHYNIVR----YYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDR 745
            QGK N    D  K LG+G   +VYL           LK+   +Q      + QL++EI I   L H NI+R    +YD    +      +++EY  +G LY  +   +   +    K +  L + ++Y   K ++HRDIKP N++++        IK+ D G +      +   +L GT +YL PEM    +EG +  H   VDLWSIGV  Y  LV + PF    ++ T  R
Sbjct:   40 QGKWNLSDFDIGKPLGKGKFGNVYLAREKKSKYIVALKVLFKSQLQKSNVEHQLRREIEIQSHLRHNNILRLFGYFYDDTRVY------LILEYAPRGELYKELTACEKFDEKRAAKYIRQLADALAYCHSKKVIHRDIKPENLLLNYKG----DIKIADFGWSVHAPSSRR-TTLCGTLDYLPPEM----IEGKE--HDEKVDLWSIGVLCYEFLVGKPPFEAEGHNETYRR 255          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO47821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL88])

HSP 1 Score: 85.1149 bits (209), Expect = 3.453e-18
Identity = 60/214 (28.04%), Postives = 105/214 (49.07%), Query Frame = 2
Query:  131 LGRGATADVYLGLKIDDATQCAMKCSK-------------QQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKR-------VEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPF 712
            LG+GA   V+LGL ++     A+K  +             ++L++E+ +LK L H NIV+Y  + +        I ME+   GS+   ++      + +F +    + +G+SYL    ++HRDIK GN+M+  + +    IK+ D G AK+       V    + +S+ GT  ++ PE+ IR     +  H    D+WSIG T++     + P+
Sbjct:   11 LGKGAFGTVFLGL-VNTGELIAVKQVELHPNNVDAAERQYEKLQEEVGLLKSLKHKNIVQYIGTCMDDSQCTINIFMEFVPGGSIAQALKRFGAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIKGGNIMLMPNGV----IKLIDFGCAKKICMVGAHVSKSNILRSMRGTPYWMAPEV-IR-----ETGHGRKSDIWSIGCTVFEMATGQPPW 213          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ikbke (inhibitor of nuclear factor kappa B kinase subunit epsilon [Source:NCBI gene;Acc:101168283])

HSP 1 Score: 179.489 bits (454), Expect = 6.074e-47
Identity = 112/328 (34.15%), Postives = 173/328 (52.74%), Query Frame = 2
Query:  107 YIIDFNKCLGRGATADVYLGLKIDDATQCAMKC--------SKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTN--TYERFFDEANKILQKKRALMFNSLTGELQFLYLDN 1039
            Y+      LG+GATA VY           A+K               +E  +L+ L+H NIVR   ++ +     +V+VME+C+ GSL + +E  +   GL +  FL +L+C+ +G+++LR   +VHRDIKPGN++  V ED    +  K+ D G A+ +EDD+ F S+ GTEEYLHP+MY R +  +  Q  +  +VDLWSIGVTLYH+    LPF P+   R   + K  +  +   K    I+G Q  +    I WS  LP  C+LSR LK +   ++  +ME        +++FF     ILQ++   +F+        +Y+ +
Sbjct:    8 YLWSLQDVLGQGATASVYKARHKRSGELVAVKVFNVLSYNRPHDVQMREFEMLRKLNHSNIVRLL-AVEELPSRHKVLVMEFCSGGSLLNLLEEPENAFGLPETEFLTVLQCIVQGMNHLRENGVVHRDIKPGNILRQVGEDGKSIY--KLTDFGAARELEDDEKFVSIYGTEEYLHPDMYERAVLRKHHQKTYGVSVDLWSIGVTLYHSATGSLPFTPFEGPR---KNKPVMHKITREKPIHAIAGVQRVEG-GPIEWSYHLPHSCQLSRGLKVLLVPVLAGIMEADQERCWVFDQFFTATTDILQRQPVHVFSLQQATAHSIYMHH 328          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: tbk1 (TANK binding kinase 1 [Source:NCBI gene;Acc:101168192])

HSP 1 Score: 141.739 bits (356), Expect = 1.234e-34
Identity = 95/232 (40.95%), Postives = 131/232 (56.47%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGL---KIDDATQCAMKCSKQQLK------KEISILKDLDHYNIVRYYDSLIKFCGY-EQVIVMEYCNKGSLYDFIELHQ---GLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--VHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYL--EGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSR 733
            MQ    Y+   +  LG+GATA+VY G    K  D     +  +   L+      +E  +LK L+H NIV+ +    +      +V+VMEYC  GSLY  +E      GL ++ FL +L  +  G+++LR   +VHRDIKPGN+M  + ED    +  K+ D G A+ +EDD+ F SL GTEEYLHP+MY R +  +  Q K+ A VDLWSIGVT YHA    LPF P+   R
Sbjct:    1 MQSTTNYLWLISDLLGQGATANVYRGRHKQKTGDLYAVKVFNNLSFLRPLDVQMREFEVLKKLNHKNIVKLFAVEEEQSNTRHKVLVMEYCPCGSLYTVLEEPSNAYGLPEDEFLIVLHDVA-GMNHLREYGIVHRDIKPGNIMRVIGEDGCSVY--KLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPR 229          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ulk2 (serine/threonine-protein kinase ULK2 [Source:NCBI gene;Acc:101160680])

HSP 1 Score: 103.99 bits (258), Expect = 2.362e-22
Identity = 63/208 (30.29%), Postives = 103/208 (49.52%), Query Frame = 2
Query:  131 LGRGATADVYLG---------LKIDDATQCAMKCSKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVH-----EDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPF 712
            +G GA A V+ G         + I    +  +  S+  L KEI ILK+L H NIV  YD  ++       +VMEYCN G L D+++    L ++     L+ +   +  L  K ++HRD+KP N+++        N+    +K+ D G A+ ++ + +  +L G+  Y+ PE+ +         + A  DLWSIG  +Y  LV + PF
Sbjct:   15 VGHGAFAVVFKGRHRKKTDWEVAIKSINKKNLTKSQILLGKEIKILKELQHENIVGLYD--VQETPNSVFLVMEYCNGGDLADYLQAKGTLREDTMRVFLQQIAAAMRVLNSKGIIHRDLKPQNILLSYSARKRSNVSSIRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQ------NYDAKADLWSIGTVIYQCLVGKPPF 214          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ulk1a (serine/threonine-protein kinase ULK1 [Source:NCBI gene;Acc:101167046])

HSP 1 Score: 103.219 bits (256), Expect = 3.542e-22
Identity = 70/223 (31.39%), Postives = 111/223 (49.78%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGL-KIDDATQCAMKC--------SKQQLKKEISILKDLDHYNIVRYYD-SLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMV-HEDNMGY----FHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPF 712
            M+   K+       +G GA A V+ G  K   + + A+KC        S+  L KEI ILK+L H NIVR  D   I  C Y   +VMEYCN G L +++     L ++     L+ + + +  L+ K ++HRD+KP N+++ H +          IK+ D G A+ ++ + +  +L G+  Y+ PE+ +         + A  DLWSIG  +Y  L  + PF
Sbjct:    1 MESVGKFEFSRKDLIGHGAFAVVFKGRHKEKHSWEVAVKCINKKNLAKSQSLLGKEIKILKELKHGNIVRLLDYQEIGGCVY---LVMEYCNGGDLAEYLHSKGTLSEDTIRIFLQQIAQAMKVLQSKGILHRDLKPQNILLCHPEGRKSSSINASIKIADFGFARHLQTNMMAATLCGSPMYMAPEVIMSQ------NYDAKADLWSIGTIMYQCLTGKAPF 214          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: dapk2b (death associated protein kinase 2 [Source:NCBI gene;Acc:101165975])

HSP 1 Score: 95.5153 bits (236), Expect = 9.722e-21
Identity = 61/211 (28.91%), Postives = 110/211 (52.13%), Query Frame = 2
Query:  149 ADVYLGLKIDDATQCAMKCSKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQ----VIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHM 769
            A  ++  +I  A++  +K  ++++++E+ IL+ L H NIV  +D       YE     V++ME  + G L+DF+   + L +    + ++ + +G+ YL  K + H D+KP N+M+ + N     IK+ D G A ++E    F+++ GT E++ PE+      G++       D+WSIGV  Y  L    PF+        D  +ETL ++
Sbjct:   45 AAKFIKKRISRASRRGVK--REEIEREVGILQQLQHPNIVALHDV------YENRTDVVLIMELVSGGELFDFLAQKESLSEEEATQFIKQILDGVQYLHSKRIAHFDLKPENIMLLDRNASLPRIKLIDFGLAHQIEAGADFKNIFGTPEFVAPEIVNYEQLGLE------ADMWSIGVITYILLSGASPFL-------GDTKQETLGNI 234          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000036603.1 (SMESG000036603.1)

HSP 1 Score: 1485.7 bits (3845), Expect = 0.000e+0
Identity = 715/716 (99.86%), Postives = 715/716 (99.86%), Query Frame = 2
Query:   89 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTNTYERFFDEANKILQKKRALMFNSLTGELQFLYLDNLTYNNLVEQTSKLLGYPREDFIILTKLKRLEPLSDSQSECLQSVPIKGHLTYDLTDNTILVMVTKPVEFKSSDSVGRELNISSKCELPNSKYKSLKEAMKYSDRLMRSIYNIATATNYIDCQTDCYKAIVTSFNENVMIDQLCLMNEALPWQMKAIRDTSLMTESLVNLTVTAISNSEVGICNQSSLTQCKSEIDQLRLKASEGEKCGEQYYYKIVEKREMVKYSKRNFDNDELRDKSFDDPLPFLVHLSEELVNEVKLIPEDKISSDESYKLEIWQRHMRQFKHYITGIEKHVGKAKNVKAMHQAFYTWMKQAINVMNRITMLRDFLKRQEERRSSLRTKFLQVNEFVEKIIASANIADRIKDEHTLLLSENEKIKSAILEIKELTEMTKNAFCRDNK 2236
            MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQ GIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTNTYERFFDEANKILQKKRALMFNSLTGELQFLYLDNLTYNNLVEQTSKLLGYPREDFIILTKLKRLEPLSDSQSECLQSVPIKGHLTYDLTDNTILVMVTKPVEFKSSDSVGRELNISSKCELPNSKYKSLKEAMKYSDRLMRSIYNIATATNYIDCQTDCYKAIVTSFNENVMIDQLCLMNEALPWQMKAIRDTSLMTESLVNLTVTAISNSEVGICNQSSLTQCKSEIDQLRLKASEGEKCGEQYYYKIVEKREMVKYSKRNFDNDELRDKSFDDPLPFLVHLSEELVNEVKLIPEDKISSDESYKLEIWQRHMRQFKHYITGIEKHVGKAKNVKAMHQAFYTWMKQAINVMNRITMLRDFLKRQEERRSSLRTKFLQVNEFVEKIIASANIADRIKDEHTLLLSENEKIKSAILEIKELTEMTKNAFCRDNK
Sbjct:    1 MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQPGIISGRQNSDNRNDITWSNMLPDKCRLSRMLKEMASKLIGYLMERTDTNTYERFFDEANKILQKKRALMFNSLTGELQFLYLDNLTYNNLVEQTSKLLGYPREDFIILTKLKRLEPLSDSQSECLQSVPIKGHLTYDLTDNTILVMVTKPVEFKSSDSVGRELNISSKCELPNSKYKSLKEAMKYSDRLMRSIYNIATATNYIDCQTDCYKAIVTSFNENVMIDQLCLMNEALPWQMKAIRDTSLMTESLVNLTVTAISNSEVGICNQSSLTQCKSEIDQLRLKASEGEKCGEQYYYKIVEKREMVKYSKRNFDNDELRDKSFDDPLPFLVHLSEELVNEVKLIPEDKISSDESYKLEIWQRHMRQFKHYITGIEKHVGKAKNVKAMHQAFYTWMKQAINVMNRITMLRDFLKRQEERRSSLRTKFLQVNEFVEKIIASANIADRIKDEHTLLLSENEKIKSAILEIKELTEMTKNAFCRDNK 716          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000066296.1 (SMESG000066296.1)

HSP 1 Score: 101.293 bits (251), Expect = 3.752e-22
Identity = 78/238 (32.77%), Postives = 127/238 (53.36%), Query Frame = 2
Query:   98 KNKYIIDFNKCLGRGATADVY-LGLKIDDATQCAMK------CSKQ----QLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ-------GLCD-NMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMG-----TAKRVE------DDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFIPY 721
            K+ YII     +G+GAT+ VY     I +  +CAMK      CS      ++KKEI  +++L + NIV YY SL+   G E  I+M+ C +GSL D I+  Q       G+ D N    +++ + +G+SY+    LVHRD+K GN++V +D +    I++ D G      A+ +E      DD+ F + VGT  ++ PE+ ++ ++G    +    D+WSIG+T+      + P+  Y
Sbjct:   20 KSDYII--KGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLV--AGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAV----IQIADFGVAGFLAARPMEATGMSLDDKRF-TFVGTPCWMAPEV-MQQVKG----YNQKADIWSIGITVIEMATGQAPYAKY 243          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000052774.1 (SMESG000052774.1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.485e-21
Identity = 70/254 (27.56%), Postives = 127/254 (50.00%), Query Frame = 2
Query:   74 SENKQMQGKNKYII--------DFNKCLGRGATADVY-----------LGLKIDDATQCAMKCSKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQ-------GLCD-NMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVE-----------DDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFIPY 721
            S++  + G N+ I+          N+ +G+GAT++VY             +KI +  +C      +++K+EI  +K++ + NIV YY S +   G E  I+M+ C +GSL D I+  Q       G+ D +    +L+ +  G++Y+    LVHRD+K GN++V +D +    I++ D G A  +            D++ F + VGT  ++ PE+ ++ ++G    H    D+WS+G+T       + P+  Y
Sbjct:   20 SDSNAVDGSNQTIVWSNKREDYKINRSIGQGATSNVYEAECLPLNNRLCAMKIINLEKCNSSSLLEEIKREIKSMKNMKNENIVTYYASFVN--GIELFIIMDVCQRGSLLDIIKRTQSKRDITYGVFDESTIATILKDVLRGLTYIHENGLVHRDLKCGNLLVKDDGI----IQIADFGVAAFLAAQPMHTTGASLDNKRF-TFVGTPCWMAPEV-MQQVKG----HNQKADIWSLGITAIELAAGQAPYAKY 261          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000057975.1 (SMESG000057975.1)

HSP 1 Score: 95.9005 bits (237), Expect = 4.530e-20
Identity = 76/257 (29.57%), Postives = 117/257 (45.53%), Query Frame = 2
Query:  131 LGRGATADVYLG-LKIDDATQCAMKC----------SKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMM--------VHEDNMGYFHIKV----GDMGTAKRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYHALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDI 832
            LG GA A VY G  K     + A+K           SK  L KEI++LKDL+H NIVR +D +I   G    + MEYCN G L   +   + L +     +L  L   +  +  + ++HRD+KPGN++        V + +      KV     D G A+ ++D  +  ++ G+  Y+ PE+ +         +  +VD+WS+GV +Y  L    PF   N         E LK +Y+ +   I    Q S    D+
Sbjct:   17 LGNGAFAIVYEGRFKEKPDQKVAIKAMRGSDRNLVKSKNLLSKEIAVLKDLNHPNIVRLFDHMIAPDGV--YLFMEYCNGGDLAKVLSERRTLSEENICSILSQLSSALDVMNLQGIMHRDLKPGNILLCYPPDIKVKKPSFDLIKSKVKYKLADFGFARFLQDGIMAVTMCGSPMYMAPEVLLCK------NYTISVDIWSMGVIIYQCLTGVAPFQASN--------PEALKAIYQKQLDPIRFPPQTSKYLRDV 257          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000015305.1 (SMESG000015305.1)

HSP 1 Score: 92.4337 bits (228), Expect = 6.943e-19
Identity = 60/218 (27.52%), Postives = 107/218 (49.08%), Query Frame = 2
Query:   95 GKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMK---------CSKQQLKKEISILKDLDHYNIVRYYDSLIKFCGYEQVI--VMEYCNKGSLYDFIELHQGLCDNMFLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTAKRVEDDQLFQSLVGTEEYLHPEMYI-RYLEGIQIKHKANVDLWSIGVTLYHALVTELPF 712
            GK K+I    + +G+G  A V LG+ +    + A+K          SK +L +E+ I+K L+H NIV+ Y+        ++++  VMEY + G ++D++  H  + +         +   + Y   + +VHRD+K  N+++  D     +IK+ D G A    +     +  G+  Y  PE++  +  +G +      VD+WS+GV LY  +   LPF
Sbjct:   52 GKYKFI----RTIGKGNFAKVKLGVHVTTQKEVAIKIIDKTQLNQSSKLKLSREVRIMKTLNHPNIVKLYE----IIENDKILYLVMEYASGGEVFDYLVAHGRMKEKEARSKFRQILSAVQYCHQRHIVHRDLKAENLLLDND----LNIKIADFGFANEFIEGNKLDTFCGSPPYAAPELFQGKKYDGPE------VDVWSLGVILYTLVSGSLPF 251          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IKBKE6.378e-5135.45inhibitor of nuclear factor kappa B kinase subunit... [more]
IKBKE1.297e-5035.45inhibitor of nuclear factor kappa B kinase subunit... [more]
TBK14.300e-4932.27TANK binding kinase 1 [Source:HGNC Symbol;Acc:HGNC... [more]
TBK15.378e-4932.27TANK binding kinase 1 [Source:HGNC Symbol;Acc:HGNC... [more]
TBK17.228e-4932.27TANK binding kinase 1 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y43D4A.66.024e-2029.25pep chromosome:WBcel235:IV:16787327:16788510:1 gen... [more]
air-24.536e-1929.41Aurora/IPL1-related protein kinase 2 [Source:UniP... [more]
unc-514.110e-1830.56Serine/threonine-protein kinase unc-51 [Source:Un... [more]
pig-17.806e-1830.62Maternal embryonic leucine zipper kinase [Source:... [more]
par-18.007e-1827.88Serine/threonine-protein kinase par-1 [Source:Uni... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IKKepsilon2.484e-5336.24gene:FBgn0086657 transcript:FBtr0336824[more]
IKKepsilon2.484e-5336.24gene:FBgn0086657 transcript:FBtr0081390[more]
KP78a2.953e-1928.85gene:FBgn0026064 transcript:FBtr0301426[more]
Atg13.045e-1931.06gene:FBgn0260945 transcript:FBtr0300561[more]
Atg13.281e-1930.07gene:FBgn0260945 transcript:FBtr0075945[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbk16.638e-5135.96TANK-binding kinase 1 [Source:ZFIN;Acc:ZDB-GENE-06... [more]
ikbke6.925e-4534.67inhibitor of nuclear factor kappa B kinase subunit... [more]
ikbke1.172e-4434.37inhibitor of nuclear factor kappa B kinase subunit... [more]
ikbke1.172e-4434.37inhibitor of nuclear factor kappa B kinase subunit... [more]
ikbke1.765e-4434.37inhibitor of nuclear factor kappa B kinase subunit... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a132.871e-5034.37solute carrier family 6 (neurotransmitter transpor... [more]
slc6a134.907e-5034.37solute carrier family 6 (neurotransmitter transpor... [more]
slc6a136.392e-5034.37solute carrier family 6 (neurotransmitter transpor... [more]
slc6a134.519e-4934.37solute carrier family 6 (neurotransmitter transpor... [more]
psmc11.804e-4735.87proteasome 26S subunit, ATPase 1 [Source:Xenbase;A... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ikbke1.392e-5135.76inhibitor of kappaB kinase epsilon [Source:MGI Sym... [more]
Tbk16.661e-4735.87TANK-binding kinase 1 [Source:MGI Symbol;Acc:MGI:1... [more]
Ikbke8.921e-4734.98inhibitor of kappaB kinase epsilon [Source:MGI Sym... [more]
Ulk22.559e-2230.59unc-51 like kinase 2 [Source:MGI Symbol;Acc:MGI:13... [more]
Dapk32.330e-2129.82death-associated protein kinase 3 [Source:MGI Symb... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9R0T8|IKKE_MOUSE9.736e-5135.76Inhibitor of nuclear factor kappa-B kinase subunit... [more]
sp|Q14164|IKKE_HUMAN6.228e-5035.45Inhibitor of nuclear factor kappa-B kinase subunit... [more]
sp|Q9UHD2|TBK1_HUMAN2.694e-4732.27Serine/threonine-protein kinase TBK1 OS=Homo sapie... [more]
sp|Q6DFJ6|TBK1_XENLA9.463e-4732.84Serine/threonine-protein kinase TBK1 OS=Xenopus la... [more]
sp|Q9WUN2|TBK1_MOUSE4.659e-4635.87Serine/threonine-protein kinase TBK1 OS=Mus muscul... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1PYC18.085e-5436.31Inhibitor of nuclear factor kappa-B kinase subunit... [more]
A0A3S3NFL88.180e-5437.40Serine/threonine-protein kinase TBK1-like protein ... [more]
A0A2R7WRJ88.966e-5437.36Protein kinase domain-containing protein OS=Oncope... [more]
K1QYZ73.418e-5336.62Inhibitor of nuclear factor kappa-B kinase subunit... [more]
K1QHY53.730e-5336.62Inhibitor of nuclear factor kappa-B kinase subunit... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbk13.237e-4936.87TANK-binding kinase 1 [Source:ZFIN;Acc:ZDB-GENE-06... [more]
ikbke5.855e-4937.90inhibitor of nuclear factor kappa B kinase subunit... [more]
ikbke2.586e-4836.68inhibitor of nuclear factor kappa B kinase subunit... [more]
ikbke3.140e-4836.68inhibitor of nuclear factor kappa B kinase subunit... [more]
tbk13.665e-4540.29TANK-binding kinase 1 [Source:ZFIN;Acc:ZDB-GENE-06... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ikbke8.439e-2631.15inhibitor of nuclear factor kappa B kinase subunit... [more]
ENSPMAT00000001278.12.092e-2130.00pep scaffold:Pmarinus_7.0:GL476529:253165:339525:-... [more]
nek22.572e-2131.96NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
map3k21.270e-2032.39mitogen-activated protein kinase kinase kinase 2 [... [more]
ENSPMAT00000008193.11.905e-2028.77pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ATG11.937e-1927.00Protein serine/threonine kinase; required for vesi... [more]
GIN46.353e-1730.30Protein kinase involved in bud growth and assembly... [more]
KCC49.398e-1730.30Protein kinase of the bud neck involved in the sep... [more]
CDC151.026e-1630.39Protein kinase of the Mitotic Exit Network; locali... [more]
SPS12.626e-1628.44Putative protein serine/threonine kinase; localize... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO443863.845e-4431.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413994.550e-2131.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375755.092e-2128.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354372.050e-2031.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478213.453e-1828.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ikbke6.074e-4734.15inhibitor of nuclear factor kappa B kinase subunit... [more]
tbk11.234e-3440.95TANK binding kinase 1 [Source:NCBI gene;Acc:101168... [more]
ulk22.362e-2230.29serine/threonine-protein kinase ULK2 [Source:NCBI ... [more]
ulk1a3.542e-2231.39serine/threonine-protein kinase ULK1 [Source:NCBI ... [more]
dapk2b9.722e-2128.91death associated protein kinase 2 [Source:NCBI gen... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036603.10.000e+099.86SMESG000036603.1[more]
SMESG000066296.13.752e-2232.77SMESG000066296.1[more]
SMESG000052774.11.485e-2127.56SMESG000052774.1[more]
SMESG000057975.14.530e-2029.57SMESG000057975.1[more]
SMESG000015305.16.943e-1927.52SMESG000015305.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003438 ID=SMED30003438|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2389bp
CATCATTTGTCTCCGGTATTAAACGTATTGATTCGAATTCTACTAGTTTT
CTATATTTTAACATCCTTCAAAATCAGAAAATAAACAAATGCAAGGAAAG
AACAAATATATTATTGATTTTAATAAATGCCTTGGTAGAGGTGCAACTGC
AGATGTTTATCTAGGATTAAAAATTGATGATGCCACACAATGTGCCATGA
AATGTTCGAAACAACAGTTAAAAAAAGAAATATCCATTTTAAAAGACCTA
GATCACTATAATATAGTGCGATATTATGATAGCCTGATAAAGTTTTGTGG
ATATGAGCAGGTTATTGTAATGGAATATTGTAATAAGGGTTCTCTATATG
ATTTCATAGAGCTCCACCAGGGGCTTTGTGATAACATGTTCTTGAAAATG
CTCGAATGTCTGAAAGAAGGAATATCTTATTTGAGAGGCAAAGTACTTGT
CCATCGGGATATAAAACCCGGAAACATGATGGTTCACGAAGATAATATGG
GTTACTTTCATATTAAAGTTGGTGATATGGGAACAGCTAAACGAGTCGAA
GACGATCAATTATTCCAGTCTCTTGTCGGAACTGAAGAATATCTTCATCC
AGAAATGTATATTAGATATCTTGAAGGAATTCAAATTAAACACAAAGCAA
ATGTTGATCTTTGGTCAATTGGAGTGACTCTTTATCATGCCCTAGTCACC
GAACTTCCTTTTATTCCATATAATTATTCCAGAACGTCAGATAGAGCAAA
GGAAACTTTAAAGCATATGTATGAGACAAAACAGGCAGGAATAATTTCTG
GCCGACAGAATAGTGATAATCGGAATGATATTACATGGAGCAACATGTTA
CCAGATAAATGTCGATTATCAAGAATGTTAAAAGAAATGGCATCAAAACT
TATTGGTTATTTAATGGAACGAACTGATACTAATACTTACGAACGATTTT
TTGACGAAGCAAATAAAATTCTACAAAAGAAGCGTGCTCTCATGTTTAAT
AGCCTAACTGGAGAATTGCAATTTCTTTATCTCGACAATCTCACTTACAA
TAATCTTGTCGAACAAACTTCAAAGTTACTAGGATATCCGAGAGAAGATT
TTATTATTCTAACCAAATTAAAGCGATTAGAACCGTTATCAGATTCCCAG
AGTGAGTGCTTACAATCAGTACCGATCAAAGGCCATCTCACTTACGATTT
GACCGATAACACAATTCTTGTTATGGTGACGAAACCAGTGGAGTTCAAAT
CATCGGATTCAGTTGGTCGTGAATTGAATATCTCAAGCAAATGTGAACTA
CCAAATTCCAAATACAAATCACTGAAAGAAGCTATGAAATATTCTGATCG
CTTGATGAGATCAATTTATAACATTGCCACTGCTACAAATTATATAGATT
GTCAGACAGACTGTTACAAGGCCATTGTTACATCATTCAATGAAAATGTA
ATGATCGATCAATTATGCTTGATGAATGAAGCACTTCCTTGGCAAATGAA
GGCAATCCGCGACACGAGTCTTATGACGGAATCATTGGTCAATCTCACTG
TAACCGCAATAAGCAATTCGGAAGTTGGAATCTGCAACCAATCAAGTTTA
ACTCAATGCAAATCAGAAATCGATCAACTGCGTTTGAAGGCTAGTGAAGG
AGAGAAATGCGGAGAACAATATTATTACAAAATTGTCGAGAAAAGAGAAA
TGGTTAAATATTCTAAAAGGAATTTCGATAATGACGAGTTGCGTGATAAA
AGCTTTGATGACCCTCTCCCTTTTCTTGTACATTTGTCAGAAGAATTGGT
AAATGAAGTCAAATTAATTCCAGAAGATAAAATAAGCTCTGATGAATCTT
ATAAATTGGAAATTTGGCAGAGACATATGCGACAATTTAAACATTATATT
ACTGGCATTGAAAAACATGTGGGTAAAGCCAAAAATGTCAAAGCCATGCA
TCAGGCCTTTTACACTTGGATGAAACAAGCTATAAATGTTATGAATAGGA
TTACAATGTTGCGAGATTTCCTCAAACGACAAGAAGAAAGACGAAGCAGT
CTACGAACGAAATTTTTGCAAGTCAATGAATTTGTGGAAAAAATCATTGC
ATCTGCGAATATTGCTGACAGAATAAAAGACGAGCACACTTTACTGTTAT
CAGAAAATGAAAAAATCAAATCTGCAATTCTGGAAATCAAAGAACTTACA
GAAATGACAAAAAATGCATTCTGTAGAGACAATAAAGGTAGTCAATAAAA
ATTAATCAATATGTGAATAATATATTTAGATTGATTTTTCAAACTGATGG
ATTAAATTAAATTAATATTTGTTGGTAATTTCTTGATTTTTTTTTAATAG
AAATTTTACGATTTGTATTTTAATCTCTTTTCTAATCCG
back to top

protein sequence of SMED30003438-orf-1

>SMED30003438-orf-1 ID=SMED30003438-orf-1|Name=SMED30003438-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=720bp
MQGKNKYIIDFNKCLGRGATADVYLGLKIDDATQCAMKCSKQQLKKEISI
LKDLDHYNIVRYYDSLIKFCGYEQVIVMEYCNKGSLYDFIELHQGLCDNM
FLKMLECLKEGISYLRGKVLVHRDIKPGNMMVHEDNMGYFHIKVGDMGTA
KRVEDDQLFQSLVGTEEYLHPEMYIRYLEGIQIKHKANVDLWSIGVTLYH
ALVTELPFIPYNYSRTSDRAKETLKHMYETKQAGIISGRQNSDNRNDITW
SNMLPDKCRLSRMLKEMASKLIGYLMERTDTNTYERFFDEANKILQKKRA
LMFNSLTGELQFLYLDNLTYNNLVEQTSKLLGYPREDFIILTKLKRLEPL
SDSQSECLQSVPIKGHLTYDLTDNTILVMVTKPVEFKSSDSVGRELNISS
KCELPNSKYKSLKEAMKYSDRLMRSIYNIATATNYIDCQTDCYKAIVTSF
NENVMIDQLCLMNEALPWQMKAIRDTSLMTESLVNLTVTAISNSEVGICN
QSSLTQCKSEIDQLRLKASEGEKCGEQYYYKIVEKREMVKYSKRNFDNDE
LRDKSFDDPLPFLVHLSEELVNEVKLIPEDKISSDESYKLEIWQRHMRQF
KHYITGIEKHVGKAKNVKAMHQAFYTWMKQAINVMNRITMLRDFLKRQEE
RRSSLRTKFLQVNEFVEKIIASANIADRIKDEHTLLLSENEKIKSAILEI
KELTEMTKNAFCRDNKGSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 686..706
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 86..306
e-value: 9.1E-36
score: 125.5
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 4..85
e-value: 9.1E-13
score: 50.2
NoneNo IPR availablePANTHERPTHR22969IKB KINASEcoord: 2..708
NoneNo IPR availablePANTHERPTHR22969:SF15FI05319P-RELATEDcoord: 2..708
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 9..313
e-value: 1.2E-33
score: 127.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 12..266
e-value: 2.3E-39
score: 135.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 9..288
score: 32.57
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 120..132
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 15..38
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 11..228