Glutathione S-transferase zeta 1

Overview
NameGlutathione S-transferase zeta 1
Smed IDSMED30003431
Length (bp)771
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutathione S-transferase zeta 1 (SMED30003431) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutathione S-transferase zeta 1 (SMED30003431) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutathione S-transferase zeta 1 (SMED30003431) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutathione S-transferase zeta 1 (SMED30003431) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Human
Match: GSTZ1 (glutathione S-transferase zeta 1 [Source:HGNC Symbol;Acc:HGNC:4643])

HSP 1 Score: 223.402 bits (568), Expect = 6.918e-73
Identity = 108/194 (55.67%), Postives = 146/194 (75.26%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            LYSY+RSS S+RVRIALALK + +ET+PIN+IKDGG+Q S+ +  +NPM+QVPT+ IDG+T+ QS++IIEY++E+  +  +LLP  P +RA  R I+++I  GIQPLQNLS LK V +     WA + I  GF A+E IL  TA  YCVGDE+++AD+CLVPQV NA RFKV++  +P I+ IN++L   EAFQ
Sbjct:    9 LYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPT-PRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQ 201          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Human
Match: GSTZ1 (glutathione S-transferase zeta 1 [Source:HGNC Symbol;Acc:HGNC:4643])

HSP 1 Score: 223.016 bits (567), Expect = 7.229e-73
Identity = 108/194 (55.67%), Postives = 146/194 (75.26%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            LYSY+RSS S+RVRIALALK + +ET+PIN+IKDGG+Q S+ +  +NPM+QVPT+ IDG+T+ QS++IIEY++E+  +  +LLP  P +RA  R I+++I  GIQPLQNLS LK V +     WA + I  GF A+E IL  TA  YCVGDE+++AD+CLVPQV NA RFKV++  +P I+ IN++L   EAFQ
Sbjct:    8 LYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPT-PRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQ 200          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Human
Match: GSTZ1 (glutathione S-transferase zeta 1 [Source:HGNC Symbol;Acc:HGNC:4643])

HSP 1 Score: 195.282 bits (495), Expect = 4.735e-62
Identity = 99/194 (51.03%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            LYSY+RSS S+RVRIALALK + +ET+PIN+IKDGG+Q S+ +  +NPM+Q              ++IIEY++E+  +  +LLP  P +RA  R I+++I  GIQPLQNLS LK V +     WA + I  GF A+E IL  TA  YCVGDE+++AD+CLVPQV NA RFKV++  +P I+ IN++L   EAFQ
Sbjct:    8 LYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQ--------------LAIIEYLEEMRPT-PRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQ 186          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Human
Match: GSTZ1 (glutathione S-transferase zeta 1 [Source:HGNC Symbol;Acc:HGNC:4643])

HSP 1 Score: 177.948 bits (450), Expect = 1.498e-55
Identity = 94/194 (48.45%), Postives = 125/194 (64.43%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            LYSY+RSS S+RVRIALALK + +ET+PIN+IKDGG+Q                           ++IIEY++E+  +  +LLP  P +RA  R I+++I  GIQPLQNLS LK V +     WA + I  GF A+E IL  TA  YCVGDE+++AD+CLVPQV NA RFKV++  +P I+ IN++L   EAFQ
Sbjct:    8 LYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQ---------------------------LAIIEYLEEMRPT-PRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQ 173          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Human
Match: GSTZ1 (glutathione S-transferase zeta 1 [Source:HGNC Symbol;Acc:HGNC:4643])

HSP 1 Score: 165.236 bits (417), Expect = 1.193e-50
Identity = 88/194 (45.36%), Postives = 115/194 (59.28%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            LYSY+RSS S+RVRIALALK + +ET+PIN+IKDGG+Q S+ +  +NPM+QVPT+ IDG+T+ QS                                           NLS LK V +     WA + I  GF A+E IL  TA  YCVGDE+++AD+CLVPQV NA RFKV++  +P I+ IN++L   EAFQ
Sbjct:    8 LYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQS-------------------------------------------NLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQ 158          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Celegans
Match: gst-43 (Glutathione S-Transferase [Source:UniProtKB/TrEMBL;Acc:Q9N4H6])

HSP 1 Score: 158.688 bits (400), Expect = 4.106e-48
Identity = 84/199 (42.21%), Postives = 131/199 (65.83%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPN----WAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKA 681
            LYSY+RSS ++RVRIALALKN+ +E  PI++  +  + ++E ++  NP ++VPT+VI+G++LT+S++IIEY+DE +      LP    +R+ +R IA  I + IQPLQ ++  K +    P     W +  ++ GF A+E +L K +  YCVGD+++IADI L   +YNA  +KV+M ++P ITRIN+ L     F+ A
Sbjct:    6 LYSYWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKNNAE-FVKHNPAKKVPTLVINGLSLTESLAIIEYLDEAYPD-PPFLPKELDKRSYSRAIALHIVASIQPLQAINIHKMLNEKEPGYGDFWCNHFVNKGFLALEELLKKHSGKYCVGDQLTIADINLPSIIYNAKIYKVDMSKYPTITRINEILAEDFRFKLA 202          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Celegans
Match: gst-42 (Probable maleylacetoacetate isomerase [Source:UniProtKB/Swiss-Prot;Acc:Q18938])

HSP 1 Score: 156.377 bits (394), Expect = 4.096e-47
Identity = 82/196 (41.84%), Postives = 124/196 (63.27%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTL----KAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAF 672
            LYSY+RSS S+RVRIALALKN+ +E   ++++    E+   K   INP  +VPT V+DG  +T+S++IIEY++E       LLP  P++RA AR I+ ++ SGIQPL NL  L    K   G    +A   + +G  A+E +L + +  Y VGD+++IAD+ + P +Y+ANRF +++  +P + RIN+ L    AF
Sbjct:    8 LYSYWRSSCSWRVRIALALKNVDYEYKTVDLL---SEEAKSKLKEINPAAKVPTFVVDGQVITESLAIIEYLEETHPD-VPLLPKDPIKRAHARAISLLVASGIQPLHNLKVLQLLNKKEAGFGGQFAKQFVVEGLTALEILLKQHSGKYAVGDDVTIADLSIPPLIYSANRFNLDLSPYPTVNRINETLADIPAF 199          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Celegans
Match: Y53G8B.1 (pep chromosome:WBcel235:III:3129277:3131399:1 gene:WBGene00021817.1 transcript:Y53G8B.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y53G8B.1)

HSP 1 Score: 141.354 bits (355), Expect = 2.151e-41
Identity = 87/200 (43.50%), Postives = 120/200 (60.00%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPN----WAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNA-NRFKVNMDQFPLITRINQKLNSHEAFQKA 681
            LYS + S  S RVR ALALK + +E  P+N++    EQ   ++   NP  +VP + I+G+TLT+S++IIEY+DE++     LLP  P  +A+AR IA  I S IQPLQN      +    P     W    I  GFKA+E +L   +  +CVG++ISIADICL   VYNA  ++ V+M  +P+ITRI+ KL     FQ A
Sbjct:    7 LYSSWSSGCSSRVRTALALKKIDYEYQPVNLLNKQKEQ---EFHGNNPAEKVPILKINGLTLTESMAIIEYLDEIYPD-PPLLPKEPELKARARAIAFHIASNIQPLQNKPIYLMLNEKEPGYGDFWCQHFISKGFKALEELLQMHSGDFCVGNQISIADICLPSIVYNAIEKYHVDMTPYPIITRISNKLAELPEFQVA 202          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Celegans
Match: gst-37 (Glutathione S-Transferase [Source:UniProtKB/TrEMBL;Acc:Q9BPM4])

HSP 1 Score: 61.6178 bits (148), Expect = 2.797e-11
Identity = 50/191 (26.18%), Postives = 88/191 (46.07%), Query Frame = 1
Query:  133 VRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPN----WAHDVIHDG----FKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKV-NMDQFPLITRINQKLNSHEAFQK 678
             RI   L  +PFE   +      G+   EK     P  +VP + +DG+ + QS +II Y+   F    +    TP ++A    I + +   + P ++L  L  + G  P+     A +    G    FK+I  IL K+   + VGD+++ AD+ +V  V    + K+ N  + P +  + +K+ +  A +K
Sbjct:   18 ARILFQLAGVPFEDYRMT----HGDGTWEKLKDKTPFGKVPFLTVDGLEIPQSHAIIRYLGNKFGYAGQ----TPEEKAWVDAICDQVKDFMVPFRDL-ILAEMAGKKPDEIAKLAKETFVPGRDAYFKSINKILGKSKSGFLVGDKLTFADLVVVENVTTLEKNKLFNASEQPKLAALRKKVYAIPAIKK 199          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Celegans
Match: gst-31 (Glutathione S-Transferase [Source:UniProtKB/TrEMBL;Acc:Q9NAA9])

HSP 1 Score: 56.9954 bits (136), Expect = 1.036e-9
Identity = 56/192 (29.17%), Postives = 89/192 (46.35%), Query Frame = 1
Query:  136 RIALALKNLPFETIPINIIKDG-GEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQ-PLQNLSTLKAVQGTHPNWAHDVIHDGF--------KAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKV-NMDQFPLITRINQKLNSHEAFQK 678
            RI   L  +PFE I I I  DG  EQ  +K     P  QVP + I+G  + QS +II Y+   F    K    TP ++A A  I + +   +  P +++   K V  T       +I++GF        K I  IL K    + VGD I+ ADI +V  +    + ++    ++P +  + +K+ +  A +K
Sbjct:   19 RILFHLAGVPFEDIRI-IHGDGTWEQIKDK----TPFGQVPVLNINGFEIPQSTAIIRYLATKFGYAGK----TPEEQAWADAICDQVRDFMAVPFKDIVVAKRVGKTEEE-VSQLINEGFVPGRDAYFKIITRILEKNKSGFLVGDGITFADIVVVENLTTLQKNQLFEASKYPELAALREKVYAIPAIKK 200          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Fly
Match: GstZ2 (gene:FBgn0037697 transcript:FBtr0082041)

HSP 1 Score: 202.601 bits (514), Expect = 4.994e-65
Identity = 101/196 (51.53%), Postives = 137/196 (69.90%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKA 681
            LYSY+RSS S+RVRIA+ LK +P++  PI++IK GGEQH  +Y  +NPM QVP + IDG TL +S++I+ Y++E       LLP    +RA+ R+I EII SGIQPLQNL  L  V +     WA   I  GF+A+E  L+ +A  YCVGDEIS+AD CLVPQV+NA RF V++  +P+I RI+++L S+ AF+ A
Sbjct:   11 LYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMHYLEET-RPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILRIDRELESNPAFRAA 205          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Fly
Match: GstZ2 (gene:FBgn0037697 transcript:FBtr0082043)

HSP 1 Score: 202.216 bits (513), Expect = 6.807e-65
Identity = 101/196 (51.53%), Postives = 137/196 (69.90%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKA 681
            LYSY+RSS S+RVRIA+ LK +P++  PI++IK GGEQH  +Y  +NPM QVP + IDG TL +S++I+ Y++E       LLP    +RA+ R+I EII SGIQPLQNL  L  V +     WA   I  GF+A+E  L+ +A  YCVGDEIS+AD CLVPQV+NA RF V++  +P+I RI+++L S+ AF+ A
Sbjct:    6 LYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMHYLEET-RPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILRIDRELESNPAFRAA 200          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Fly
Match: GstZ2 (gene:FBgn0037697 transcript:FBtr0082042)

HSP 1 Score: 202.216 bits (513), Expect = 8.530e-65
Identity = 105/216 (48.61%), Postives = 147/216 (68.06%), Query Frame = 1
Query:   37 FNISLYPD*SIAHIEMVNIKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKA 681
             + +L P+ S + I+ +   LYSY+RSS S+RVRIA+ LK +P++  PI++IK GGEQH  +Y  +NPM QVP + IDG TL +S++I+ Y++E       LLP    +RA+ R+I EII SGIQPLQNL  L  V +     WA   I  GF+A+E  L+ +A  YCVGDEIS+AD CLVPQV+NA RF V++  +P+I RI+++L S+ AF+ A
Sbjct:    1 MSTNLCPNASSSDIQPI---LYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMHYLEET-RPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILRIDRELESNPAFRAA 212          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Fly
Match: GstZ1 (gene:FBgn0037696 transcript:FBtr0082044)

HSP 1 Score: 179.874 bits (455), Expect = 7.663e-56
Identity = 87/195 (44.62%), Postives = 133/195 (68.21%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKD-GGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHP-NWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            LYSY+ SS S+RVR+ALA+K + ++  P +++K   G  ++++Y  +NPM++VP++ IDG TL  S++II Y++E       LLP  P++RA+ R+I E+I SGIQPLQN+S L  +       WA   I  GF+ +E +L+ +A  +CVGDE+S+ADICLVPQV NA R+K ++  +P I R+NQ+L   + F+
Sbjct:   36 LYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTLCDSVAIIHYLEETRPQPA-LLPQDPVKRAKIREIVELICSGIQPLQNVSVLDHIGKDQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRNARRYKADLTPYPTIVRLNQELQELDVFK 229          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Fly
Match: GstE5 (gene:FBgn0063495 transcript:FBtr0086673)

HSP 1 Score: 70.4774 bits (171), Expect = 2.861e-14
Identity = 57/206 (27.67%), Postives = 96/206 (46.60%), Query Frame = 1
Query:   82 MVNIKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQ-----IAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRF-KVNMDQFPLITRINQKLNSHEAFQKA 681
            MV + LY    S     V++ LA   LP+E + +NI   G EQ SE+Y+  NP   VPT+  DG  +  S +II Y+   +     L P   LQRA   Q        +  +GI+ +        +    P   +D I + +  +E+ LA     Y  GD+++IAD  L+  + +   F +++  ++P I    ++L     +++A
Sbjct:    1 MVKLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNI--SGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDSHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRI-PKERYDAIVEIYDFVETFLA--GHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRLEKLPYYEEA 201          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Zebrafish
Match: gstz1 (glutathione S-transferase zeta 1 [Source:ZFIN;Acc:ZDB-GENE-040718-184])

HSP 1 Score: 231.106 bits (588), Expect = 4.155e-76
Identity = 111/195 (56.92%), Postives = 145/195 (74.36%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKA 681
            LY YYRSS S+RVRIA ALK + +E  PIN+IKDGG+Q ++++  INPM+QVP + IDG+TL+QS++II+YI+E      +LLP  P+QRA  R I +II SGIQPLQNL  L+ +      WA   I+ GF+A+E +L +TA  YCVGDEIS+ADICLVPQVYNA+RFKV+M Q+P I R+NQ L   EAF+ +
Sbjct:   13 LYGYYRSSCSWRVRIAFALKGIEYEQKPINLIKDGGQQLTDQFKAINPMQQVPAVSIDGITLSQSLAIIQYIEETRPE-PRLLPADPMQRAHVRIICDIIASGIQPLQNLYVLQKIGEDKVQWAQHFINRGFQALEPVLKETAGKYCVGDEISMADICLVPQVYNADRFKVDMTQYPTIRRLNQTLVEIEAFKAS 206          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Zebrafish
Match: gstz1 (glutathione S-transferase zeta 1 [Source:ZFIN;Acc:ZDB-GENE-040718-184])

HSP 1 Score: 230.72 bits (587), Expect = 4.248e-76
Identity = 111/195 (56.92%), Postives = 145/195 (74.36%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKA 681
            LY YYRSS S+RVRIA ALK + +E  PIN+IKDGG+Q ++++  INPM+QVP + IDG+TL+QS++II+YI+E      +LLP  P+QRA  R I +II SGIQPLQNL  L+ +      WA   I+ GF+A+E +L +TA  YCVGDEIS+ADICLVPQVYNA+RFKV+M Q+P I R+NQ L   EAF+ +
Sbjct:    9 LYGYYRSSCSWRVRIAFALKGIEYEQKPINLIKDGGQQLTDQFKAINPMQQVPAVSIDGITLSQSLAIIQYIEETRPE-PRLLPADPMQRAHVRIICDIIASGIQPLQNLYVLQKIGEDKVQWAQHFINRGFQALEPVLKETAGKYCVGDEISMADICLVPQVYNADRFKVDMTQYPTIRRLNQTLVEIEAFKAS 202          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Zebrafish
Match: gstz1 (glutathione S-transferase zeta 1 [Source:ZFIN;Acc:ZDB-GENE-040718-184])

HSP 1 Score: 168.318 bits (425), Expect = 2.508e-52
Identity = 82/147 (55.78%), Postives = 107/147 (72.79%), Query Frame = 1
Query:  241 MRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKA 681
            M+QVP + IDG+TL+QS++II+YI+E      +LLP  P+QRA  R I +II SGIQPLQNL  L+ +      WA   I+ GF+A+E +L +TA  YCVGDEIS+ADICLVPQVYNA+RFKV+M Q+P I R+NQ L   EAF+ +
Sbjct:    1 MQQVPAVSIDGITLSQSLAIIQYIEET-RPEPRLLPADPMQRAHVRIICDIIASGIQPLQNLYVLQKIGEDKVQWAQHFINRGFQALEPVLKETAGKYCVGDEISMADICLVPQVYNADRFKVDMTQYPTIRRLNQTLVEIEAFKAS 146          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Zebrafish
Match: gsto1 (glutathione S-transferase omega 1 [Source:ZFIN;Acc:ZDB-GENE-040718-365])

HSP 1 Score: 59.6918 bits (143), Expect = 3.638e-10
Identity = 45/165 (27.27%), Postives = 75/165 (45.45%), Query Frame = 1
Query:   88 NIKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVI-DGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVP 579
            +I+LYS      + R R+ L  K + ++TI IN+     +   + ++  NP+  VP +    G  + +S    EY+DEV+    KLLP  P +RAQ R + E+  S + P      +   +G   +     + D       IL K    +  GD I++ D  + P
Sbjct:   22 HIRLYSMRFCPFAQRTRLVLNAKGIKYDTININL-----KNKPDWFLEKNPLGLVPVLETQSGQVIYESPITCEYLDEVYPE-KKLLPFDPFERAQQRMLLELF-SKVTPYFYKIPVNRTKGEDVSALETELKDKLSQFNEILLKKKSKFFGGDSITMIDYMMWP 179          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Zebrafish
Match: gsto2 (glutathione S-transferase omega 2 [Source:ZFIN;Acc:ZDB-GENE-041114-67])

HSP 1 Score: 54.6842 bits (130), Expect = 1.961e-8
Identity = 46/175 (26.29%), Postives = 74/175 (42.29%), Query Frame = 1
Query:   91 IKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTI-VIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVN 612
            I+LYS      + R R+ L  K +  + I IN++        + ++  NP   VP +    G  + +S    EY+DEV+    KLLP  P +RAQ + + E+ +  I     +S  K  +G   + A     +    +   LA     Y  GD I++ D  + P    A    V 
Sbjct:   23 IRLYSMRFCPFAQRTRLVLTAKGVKHDIININLV-----SKPDWFLKKNPFGTVPVLETSSGQVIYESPITCEYLDEVYPE-KKLLPSDPFERAQQKMLLELYSKVIPYFYKISMGKK-RGEDVSTAEAEFTEKLVQLNEALANKKTKYFGGDSITMIDYLIWPWFERAEMMGVK 190          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Xenopus
Match: GSTZ1 (glutathione S-transferase zeta 1 [Source:NCBI gene;Acc:100145591])

HSP 1 Score: 208.379 bits (529), Expect = 4.543e-67
Identity = 104/193 (53.89%), Postives = 135/193 (69.95%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            LY Y+RSS S+RVRIALA K + ++   IN++KDGG Q S +Y  +NPM+QVP + IDGVTL+QS++IIEY++E       LLP  P +RAQ R I++ I SGIQPLQNL  L+ +  T   WA   I  GF+A+E +L  TA  YCVGDE++IAD+CLVPQV NA RFKV++  +P I  IN+ L   EAFQ
Sbjct:    9 LYGYFRSSCSWRVRIALAFKGIEYDQQVINLVKDGGMQLSNEYKQVNPMQQVPALCIDGVTLSQSLAIIEYLEET-RPNPPLLPRDPKKRAQVRMISDQIASGIQPLQNLCVLQKIGETKLEWAKHFITRGFQALEKLLQTTAGRYCVGDEVTIADLCLVPQVANAVRFKVDLAPYPTIVGINESLLQLEAFQ 200          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Xenopus
Match: GSTZ1 (glutathione S-transferase zeta 1 [Source:NCBI gene;Acc:100145591])

HSP 1 Score: 186.422 bits (472), Expect = 1.261e-58
Identity = 92/169 (54.44%), Postives = 119/169 (70.41%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRF 603
            LY Y+RSS S+RVRIALA K + ++   IN++KDGG Q S +Y  +NPM+QVP + IDGVTL+QS++IIEY++E       LLP  P +RAQ R I++ I SGIQPLQNL  L+ +  T   WA   I  GF+A+E +L  TA  YCVGDE++IAD+CLVPQV NA R 
Sbjct:    9 LYGYFRSSCSWRVRIALAFKGIEYDQQVINLVKDGGMQLSNEYKQVNPMQQVPALCIDGVTLSQSLAIIEYLEET-RPNPPLLPRDPKKRAQVRMISDQIASGIQPLQNLCVLQKIGETKLEWAKHFITRGFQALEKLLQTTAGRYCVGDEVTIADLCLVPQVANAVRL 176          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Xenopus
Match: gsto2 (glutathione S-transferase omega 2 [Source:NCBI gene;Acc:448662])

HSP 1 Score: 52.7582 bits (125), Expect = 1.014e-7
Identity = 44/164 (26.83%), Postives = 74/164 (45.12%), Query Frame = 1
Query:   91 IKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTI-VIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVP 579
            I++YS      + R R+ LA K +  E I IN+     +   + +I  +P   VP++    G  + +S  + +Y+DEV+  G KL P  P Q+AQ + I E   S I  L     L        +     + +    ++ ILAK    +  G ++S+ D  + P
Sbjct:   23 IRVYSMRFCPYAQRARLVLAAKGIKHEVININL-----KNKPDWFIEKSPFGLVPSLETSSGQVIYESPIVCDYLDEVY-PGKKLTPADPFQKAQQKMIVEHF-SKISTLFYKILLAKKNNEDVSGVKAEVQEKLVKLDEILAKQNGLFFGGSDVSMVDYMIWP 179          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Xenopus
Match: gsto2 (glutathione S-transferase omega 2 [Source:NCBI gene;Acc:448662])

HSP 1 Score: 52.7582 bits (125), Expect = 1.037e-7
Identity = 44/164 (26.83%), Postives = 74/164 (45.12%), Query Frame = 1
Query:   91 IKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTI-VIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVP 579
            I++YS      + R R+ LA K +  E I IN+     +   + +I  +P   VP++    G  + +S  + +Y+DEV+  G KL P  P Q+AQ + I E   S I  L     L        +     + +    ++ ILAK    +  G ++S+ D  + P
Sbjct:   14 IRVYSMRFCPYAQRARLVLAAKGIKHEVININL-----KNKPDWFIEKSPFGLVPSLETSSGQVIYESPIVCDYLDEVY-PGKKLTPADPFQKAQQKMIVEHF-SKISTLFYKILLAKKNNEDVSGVKAEVQEKLVKLDEILAKQNGLFFGGSDVSMVDYMIWP 170          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Mouse
Match: Gstz1 (glutathione transferase zeta 1 (maleylacetoacetate isomerase) [Source:MGI Symbol;Acc:MGI:1341859])

HSP 1 Score: 224.557 bits (571), Expect = 1.230e-73
Identity = 109/194 (56.19%), Postives = 145/194 (74.74%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            LYSY+RSS S+RVRIALALK + +E +PIN+IKDGG+Q +E++ T+NPM+QVP + IDG+T+ QS++I+EY++E      +LLP  P +RA  R I+++I SGIQPLQNLS LK V Q     WA  VI  GF A+E IL  TA  YCVGDE+S+AD+CLVPQV NA RFKV++  +P I+ IN++L + E FQ
Sbjct:    8 LYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGITIVQSLAIMEYLEET-RPIPRLLPQDPQKRAIVRMISDLIASGIQPLQNLSVLKQVGQENQMQWAQKVITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERFKVDLSPYPTISHINKELLALEVFQ 200          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Mouse
Match: Gstz1 (glutathione transferase zeta 1 (maleylacetoacetate isomerase) [Source:MGI Symbol;Acc:MGI:1341859])

HSP 1 Score: 224.557 bits (571), Expect = 1.244e-73
Identity = 109/194 (56.19%), Postives = 145/194 (74.74%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            LYSY+RSS S+RVRIALALK + +E +PIN+IKDGG+Q +E++ T+NPM+QVP + IDG+T+ QS++I+EY++E      +LLP  P +RA  R I+++I SGIQPLQNLS LK V Q     WA  VI  GF A+E IL  TA  YCVGDE+S+AD+CLVPQV NA RFKV++  +P I+ IN++L + E FQ
Sbjct:    7 LYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGITIVQSLAIMEYLEET-RPIPRLLPQDPQKRAIVRMISDLIASGIQPLQNLSVLKQVGQENQMQWAQKVITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERFKVDLSPYPTISHINKELLALEVFQ 199          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Mouse
Match: Gstz1 (glutathione transferase zeta 1 (maleylacetoacetate isomerase) [Source:MGI Symbol;Acc:MGI:1341859])

HSP 1 Score: 155.606 bits (392), Expect = 2.361e-47
Identity = 78/146 (53.42%), Postives = 103/146 (70.55%), Query Frame = 1
Query:  241 MRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            M+QVP + IDG+T+ QS++I+EY++E      +LLP  P +RA  R I+++I SGIQPLQNLS LK V Q     WA  VI  GF A+E IL  TA  YCVGDE+S+AD+CLVPQV NA RFKV++  +P I+ IN++L + E FQ
Sbjct:    1 MKQVPALKIDGITIVQSLAIMEYLEET-RPIPRLLPQDPQKRAIVRMISDLIASGIQPLQNLSVLKQVGQENQMQWAQKVITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERFKVDLSPYPTISHINKELLALEVFQ 145          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Mouse
Match: Gstz1 (glutathione transferase zeta 1 (maleylacetoacetate isomerase) [Source:MGI Symbol;Acc:MGI:1341859])

HSP 1 Score: 155.606 bits (392), Expect = 2.361e-47
Identity = 78/146 (53.42%), Postives = 103/146 (70.55%), Query Frame = 1
Query:  241 MRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            M+QVP + IDG+T+ QS++I+EY++E      +LLP  P +RA  R I+++I SGIQPLQNLS LK V Q     WA  VI  GF A+E IL  TA  YCVGDE+S+AD+CLVPQV NA RFKV++  +P I+ IN++L + E FQ
Sbjct:    1 MKQVPALKIDGITIVQSLAIMEYLEET-RPIPRLLPQDPQKRAIVRMISDLIASGIQPLQNLSVLKQVGQENQMQWAQKVITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERFKVDLSPYPTISHINKELLALEVFQ 145          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Mouse
Match: Gsto2 (glutathione S-transferase omega 2 [Source:MGI Symbol;Acc:MGI:1915464])

HSP 1 Score: 50.0618 bits (118), Expect = 3.921e-7
Identity = 43/164 (26.22%), Postives = 70/164 (42.68%), Query Frame = 1
Query:   91 IKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLT-QSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVP 579
            I++YS      S R R+ L  K +  E I IN+     +   + Y T +P  Q+P +      L  +S+   EY+D+V+  G KL P  P +RA+ + + E+    + PL     +    G         +      +E IL      +  GD IS+ D  + P
Sbjct:   24 IRIYSMRFCPYSHRARLVLKAKGIRHEVININL-----KSKPDWYYTKHPFGQIPVLENSQCQLVYESVIACEYLDDVY-PGRKLFPYDPYERARQKMLLELF-CKVPPLSKECLIALRCGRDCTDLKVALRQELCNMEEILEYQNTTFFGGDCISMIDYLVWP 180          
BLAST of Glutathione S-transferase zeta 1 vs. UniProt/SwissProt
Match: sp|Q9WVL0|MAAI_MOUSE (Maleylacetoacetate isomerase OS=Mus musculus OX=10090 GN=Gstz1 PE=1 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 8.604e-73
Identity = 109/194 (56.19%), Postives = 145/194 (74.74%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            LYSY+RSS S+RVRIALALK + +E +PIN+IKDGG+Q +E++ T+NPM+QVP + IDG+T+ QS++I+EY++E      +LLP  P +RA  R I+++I SGIQPLQNLS LK V Q     WA  VI  GF A+E IL  TA  YCVGDE+S+AD+CLVPQV NA RFKV++  +P I+ IN++L + E FQ
Sbjct:    8 LYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGITIVQSLAIMEYLEET-RPIPRLLPQDPQKRAIVRMISDLIASGIQPLQNLSVLKQVGQENQMQWAQKVITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERFKVDLSPYPTISHINKELLALEVFQ 200          
BLAST of Glutathione S-transferase zeta 1 vs. UniProt/SwissProt
Match: sp|P57113|MAAI_RAT (Maleylacetoacetate isomerase OS=Rattus norvegicus OX=10116 GN=Gstz1 PE=1 SV=2)

HSP 1 Score: 222.246 bits (565), Expect = 7.049e-72
Identity = 109/194 (56.19%), Postives = 143/194 (73.71%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            LYSY+RSS S+RVRIALALK + +E +PIN+IKDGG+Q SE++ T+NPM+QVP + IDG+T+ QS++I+EY++E      +LLP  P +RA  R I+++I SGIQPLQNLS LK V Q     WA   I  GF A+E IL  TA  YCVGDE+S+AD+CL PQV NA RFKV++  +P I+ IN+ L + EAFQ
Sbjct:    8 LYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVPALKIDGITIGQSLAILEYLEET-RPIPRLLPQDPQKRAIVRMISDLIASGIQPLQNLSVLKQVGQENQMPWAQKAITSGFNALEKILQSTAGKYCVGDEVSMADVCLAPQVANAERFKVDLSPYPTISHINKALLALEAFQ 200          
BLAST of Glutathione S-transferase zeta 1 vs. UniProt/SwissProt
Match: sp|O43708|MAAI_HUMAN (Maleylacetoacetate isomerase OS=Homo sapiens OX=9606 GN=GSTZ1 PE=1 SV=3)

HSP 1 Score: 218.009 bits (554), Expect = 3.262e-70
Identity = 106/194 (54.64%), Postives = 145/194 (74.74%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            LYSY+RSS S+RVRIALALK + ++T+PIN+IKD G+Q S+ +  +NPM+QVPT+ IDG+T+ QS++IIEY++E+  +  +LLP  P +RA  R I+++I  GIQPLQNLS LK V +     WA + I  GF A+E IL  TA  YCVGDE+++AD+CLVPQV NA RFKV++  +P I+ IN++L   EAFQ
Sbjct:    8 LYSYFRSSCSWRVRIALALKGIDYKTVPINLIKDRGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPT-PRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQ 200          
BLAST of Glutathione S-transferase zeta 1 vs. UniProt/SwissProt
Match: sp|Q9VHD2|MAAI2_DROME (Probable maleylacetoacetate isomerase 2 OS=Drosophila melanogaster OX=7227 GN=GstZ2 PE=1 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 8.551e-64
Identity = 105/216 (48.61%), Postives = 147/216 (68.06%), Query Frame = 1
Query:   37 FNISLYPD*SIAHIEMVNIKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKA 681
             + +L P+ S + I+ +   LYSY+RSS S+RVRIA+ LK +P++  PI++IK GGEQH  +Y  +NPM QVP + IDG TL +S++I+ Y++E       LLP    +RA+ R+I EII SGIQPLQNL  L  V +     WA   I  GF+A+E  L+ +A  YCVGDEIS+AD CLVPQV+NA RF V++  +P+I RI+++L S+ AF+ A
Sbjct:    1 MSTNLCPNASSSDIQPI---LYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMHYLEET-RPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILRIDRELESNPAFRAA 212          
BLAST of Glutathione S-transferase zeta 1 vs. UniProt/SwissProt
Match: sp|Q54YN2|MAAI_DICDI (Maleylacetoacetate isomerase OS=Dictyostelium discoideum OX=44689 GN=mai PE=3 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.396e-57
Identity = 91/192 (47.40%), Postives = 127/192 (66.15%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV------QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKL 654
            LYSY+RSS S+RVR+ALA K + +E   I+++KDGG+Q S++Y  +NPM+ +PT+ IDG  + QS++I+EY++E       L+P    +RA ARQ+ +II S IQPLQNL  L  +            WA  VI +GF  +E +L K +  +CVGD +S AD+CL  QVYNANRF V+M  +P ITR+NQ L
Sbjct:    8 LYSYWRSSCSWRVRVALAYKKIKYEYKAIHLLKDGGQQKSDEYSKLNPMKAIPTLEIDGHIIGQSLAILEYLEETHPE-NPLMPKGSYERAIARQMMQIIGSDIQPLQNLKVLGLIAQYSGDDSKKSEWARTVITNGFNGLEKLLEKHSGKFCVGDSVSFADLCLPAQVYNANRFNVDMTPYPNITRVNQHL 198          
BLAST of Glutathione S-transferase zeta 1 vs. TrEMBL
Match: A0A5F8HAS3 (Glutathione S-transferase zeta 1 OS=Monodelphis domestica OX=13616 GN=GSTZ1 PE=3 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 2.661e-75
Identity = 112/194 (57.73%), Postives = 152/194 (78.35%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            LYSY+RSS S+RVRIALALK + ++ +PIN++KDGG+Q+S+++ T+NPM+QVPT+ IDG+T+TQS++IIEY++E   +  +LLP  P +RA  R I+++I SGIQPLQNLS LK V Q T   WA  VI  GFKA+ES+L  TA  YC+G+EIS+AD+CLVPQV NA R+KV++  +P ITRI + L + EAFQ
Sbjct:    8 LYSYFRSSCSWRVRIALALKGIDYDIVPINLVKDGGQQYSKEFETLNPMKQVPTLKIDGITITQSLAIIEYLEETRPTAPRLLPLDPKERASVRMISDLIASGIQPLQNLSILKKVGQETQLAWAQAVISSGFKALESVLQSTAGKYCLGNEISMADLCLVPQVANAERYKVDLSPYPTITRIYKTLLTVEAFQ 201          
BLAST of Glutathione S-transferase zeta 1 vs. TrEMBL
Match: A0A5N5N4G1 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00016460 PE=4 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 3.984e-75
Identity = 108/193 (55.96%), Postives = 148/193 (76.68%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            L+ Y+RSS S+RVRIA ALK + ++ +P++++KDGG+Q +++Y T+NPM+QVP + IDG+TL+QS++II+YIDE    G +LLP  P QRAQ R I+++I SGIQPLQNL  ++ +      WA   I+ GF A+ESIL +T+  YCVG+EIS+ADICLVPQVYNA RFKV++DQ+P I RINQ L   EAF+
Sbjct:    9 LHGYFRSSCSWRVRIAFALKGIEYDQVPVSLVKDGGQQLTDQYKTVNPMQQVPAVTIDGITLSQSLAIIQYIDET-RPGPRLLPADPQQRAQVRMISDLIASGIQPLQNLHVIQKIGAEKVQWAQHFINKGFNALESILKQTSGTYCVGNEISMADICLVPQVYNAERFKVDLDQYPTIKRINQTLMELEAFK 200          
BLAST of Glutathione S-transferase zeta 1 vs. TrEMBL
Match: A0A2I4BL87 (maleylacetoacetate isomerase isoform X2 OS=Austrofundulus limnaeus OX=52670 GN=gstz1 PE=3 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 4.300e-75
Identity = 108/193 (55.96%), Postives = 146/193 (75.65%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            L+ Y+RSS S+RVRIA +LK + ++ +P+N+IKDGG+Q +E+Y  +NPM+QVP + IDG+TL+QS+++I+YIDE    G +LLP  P  RAQ R I+++I SGIQPLQNL  L+ +      WA   IH GF+A+E IL KT+  YCVGDEIS+ADICLVPQVYNA RFKV+++Q+P I RIN+ L   EAF+
Sbjct:    9 LHGYFRSSCSWRVRIAFSLKGIEYDQVPVNLIKDGGQQMTEQYQELNPMKQVPAVEIDGITLSQSLAVIQYIDET-RPGPRLLPADPKARAQVRMISDLIASGIQPLQNLYVLQKIGAEKAEWAQHFIHRGFQALEPILKKTSGKYCVGDEISMADICLVPQVYNAERFKVDVEQYPTIKRINETLLETEAFK 200          
BLAST of Glutathione S-transferase zeta 1 vs. TrEMBL
Match: A0A2I4BL61 (maleylacetoacetate isomerase isoform X1 OS=Austrofundulus limnaeus OX=52670 GN=gstz1 PE=3 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 4.543e-75
Identity = 108/193 (55.96%), Postives = 146/193 (75.65%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            L+ Y+RSS S+RVRIA +LK + ++ +P+N+IKDGG+Q +E+Y  +NPM+QVP + IDG+TL+QS+++I+YIDE    G +LLP  P  RAQ R I+++I SGIQPLQNL  L+ +      WA   IH GF+A+E IL KT+  YCVGDEIS+ADICLVPQVYNA RFKV+++Q+P I RIN+ L   EAF+
Sbjct:   13 LHGYFRSSCSWRVRIAFSLKGIEYDQVPVNLIKDGGQQMTEQYQELNPMKQVPAVEIDGITLSQSLAVIQYIDET-RPGPRLLPADPKARAQVRMISDLIASGIQPLQNLYVLQKIGAEKAEWAQHFIHRGFQALEPILKKTSGKYCVGDEISMADICLVPQVYNAERFKVDVEQYPTIKRINETLLETEAFK 204          
BLAST of Glutathione S-transferase zeta 1 vs. TrEMBL
Match: G1LAV2 (Glutathione S-transferase zeta 1 OS=Ailuropoda melanoleuca OX=9646 GN=GSTZ1 PE=3 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 5.527e-75
Identity = 114/194 (58.76%), Postives = 148/194 (76.29%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAV-QGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            LYSY+RSS S+RVRIALALK++ FET+PIN+IKDGG+Q SE++  +NPM+QVP + IDG+T+ QS++IIEY++E   +  +LLP  P +RAQ R I++II SGIQPLQNLS LK V Q     WA   I  GF A+E +L  TA  YCVGDE+S+AD+CLVPQV NA RFKV++  +P I+RIN+ L + EAFQ
Sbjct:    9 LYSYFRSSCSWRVRIALALKSIDFETVPINLIKDGGQQFSEEFQALNPMKQVPALKIDGITIAQSLAIIEYLEETRPT-PRLLPQDPKKRAQVRMISDIITSGIQPLQNLSVLKQVGQENQLTWAQKAIRPGFNALEQVLWSTAGKYCVGDEVSMADLCLVPQVANAERFKVDLTPYPTISRINKTLMALEAFQ 201          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Cavefish
Match: ENSAMXT00000050956.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:14342592:14351110:1 gene:ENSAMXG00000036436.1 transcript:ENSAMXT00000050956.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 5.211e-9
Identity = 43/165 (26.06%), Postives = 77/165 (46.67%), Query Frame = 1
Query:   88 NIKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVI-DGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVP 579
            ++++YS      + R R+ L  K + FET+ I++     ++  E Y+  NP   VPT+ + +G  + +S    EY+DEV+  G KL+   P ++AQ + + E   S I PL         +G   +     + +    +  +L      Y  GD +S+ D  + P
Sbjct:   34 HLRIYSMRFCPFAQRTRLVLQAKGINFETVNIDL-----KEKPEWYLEKNPQGLVPTLELPNGKVIYESPITCEYLDEVY-PGKKLMSSDPFEKAQQKMLLEDF-SKIVPLFYRIPGTKSKGEDISALETELKEKLSKLNKVLVNKKTKYFGGDSVSMIDYLIWP 191          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Cavefish
Match: gstt1a (glutathione S-transferase theta-1-like [Source:NCBI gene;Acc:103038409])

HSP 1 Score: 51.9878 bits (123), Expect = 1.343e-7
Identity = 43/190 (22.63%), Postives = 88/190 (46.32%), Query Frame = 1
Query:   91 IKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHP------------NWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQF 624
            ++LY    S     V I   L N+PFE   +++    GE + E +  ++ +R+VP +  +   LT+S +I++Y+ + +++     P    +RA+  +     ++ I+P  + S +   +G  P            + A + ++   K  E    +  K + +GD+IS+AD+  + +V     F   +D F
Sbjct:    3 LELYLDLHSQPCRSVYIFAKLANIPFEFKAVDL--SSGENYGEGFGKVSILRKVPVLKDEAFILTESTAILQYLAKKYSTPDHWYPADMQKRARVDEYLSWQHTNIRP--HGSKVFWFRGVLPVVTGAPVPKEKMDSAMEDLNTSLKLFEEKFLQD-KPFIIGDQISLADLVAIVEVMQP--FGTGLDVF 185          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Cavefish
Match: gstr (glutathione S-transferase rho [Source:ZFIN;Acc:ZDB-GENE-090507-1])

HSP 1 Score: 50.447 bits (119), Expect = 3.514e-7
Identity = 49/177 (27.68%), Postives = 78/177 (44.07%), Query Frame = 1
Query:  115 SSASFRVRIALALKNLP-FETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTS-GTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVI-----------HDGFKAIESILAKTAK-CYCVGDEISIADICLVPQVYNANRF 603
            S   +RV IAL  KNL  ++   ++  K+  E  +   + INP  Q+PT     V + +SI+   Y+   F S GT+L+P +  Q+A               LQ +   +A+Q       +DV+           H+  K  ES L +  K  Y  G + S+AD+ + P +    RF
Sbjct:   13 SPPCWRVMIALEEKNLQGYKNKHLSYEKN--EHKNPDVLQINPRGQIPTFKHGDVVVNESIAACLYLQNPFKSQGTQLMPDSVSQQALV-------------LQRMLEAEALQKK----IYDVLFYEYYVPEAERHESLKLWESYLQQMGKGSYLTGKDFSLADVAMFPDLAYLPRF 170          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Cavefish
Match: gstt1b (glutathione S-transferase theta-3-like [Source:NCBI gene;Acc:103023854])

HSP 1 Score: 48.521 bits (114), Expect = 1.936e-6
Identity = 37/149 (24.83%), Postives = 69/149 (46.31%), Query Frame = 1
Query:  157 NLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQP-----LQNLSTLKAVQGTH-PNWAHDVIHDGFKAIESILAKT---AKCYCVGDEISIADICLV 576
            ++PFE   I+++   GEQHSE +  IN +++VP I      L +S++I+ Y+ E + +     P    +RA+  +     ++ I+P     L     +  V G   P    D   +   +   +  +     + +  GD+IS+AD+  V
Sbjct:   25 SIPFEFKKISLM--AGEQHSEDFSKINILKKVPAIRDGDFCLAESVAIMIYLAEKYNTPDNWYPADLQKRARVNEFLSWQHTAIRPHGGRMLWLKVMIPKVMGVEVPQEKMDAALEDLDSSLKLFDEKFLQDRPFIAGDQISLADLFAV 171          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Cavefish
Match: gstt2 (glutathione S-transferase theta-1-like [Source:NCBI gene;Acc:111192043])

HSP 1 Score: 47.7506 bits (112), Expect = 3.244e-6
Identity = 43/183 (23.50%), Postives = 76/183 (41.53%), Query Frame = 1
Query:   91 IKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSG----------IQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIAD---ICLVPQVYNANR 600
            +K+Y  + S     + I L    +P     + + K  GE  S  +  +NPM++VP +  D   LT+S +I++Y+   +       P  P +RA+  +     ++            + L  + T +  +      A   +    K +E +  K     C GD+I+IAD   +C V Q   A R
Sbjct:    6 VKVYLDFLSQPCRALYIFLKHNKIPHTVQLVALRK--GEHKSPDFTRLNPMQRVPVMEHDKFVLTESDAILKYLANTYDVAEHWYPRDPKRRARVDEYTAWHHANTRLNVVKVFMTEVLLPMMTGQPAEQKKLEQALQELDQTLKKMEEMFLKRQAFLC-GDDITIADLLAVCEVMQPLGAGR 185          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001383.1 (pep scaffold:Pmarinus_7.0:GL477094:183111:188906:-1 gene:ENSPMAG00000001244.1 transcript:ENSPMAT00000001383.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 6.424e-20
Identity = 35/62 (56.45%), Postives = 48/62 (77.42%), Query Frame = 1
Query:  496 AIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKA 681
            A+E +L KTA  YCVGDE+++AD+CLVPQVYNA RFKV++  FP + R+++ L   EAF+ A
Sbjct:    1 AVEQMLQKTAGKYCVGDEVTMADLCLVPQVYNATRFKVDLAAFPTLRRVHEALEQLEAFRVA 62          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Nematostella
Match: EDO40157 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7Y8])

HSP 1 Score: 217.624 bits (553), Expect = 1.835e-71
Identity = 106/196 (54.08%), Postives = 141/196 (71.94%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHP-NWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKA 681
            LYSY+RSS S+RVR ALALK + +E  PI+++KDGGEQHS+ Y  +NP+ +VPT++IDG TLTQSI I+EY+DE       L  G P +RA  RQI+  I SGIQP+QNL  L+ V       W H  I  GF+ +E +L +TA  YCVGD+I++AD+CLVPQVYNANRFKV+M ++P I RI++ L   +AF++A
Sbjct:    6 LYSYFRSSCSWRVRTALALKGIEYEYHPIHLLKDGGEQHSDDYKKMNPIGEVPTLIIDGHTLTQSIGIMEYLDETRPDPPLLPRGDPHKRALVRQISMTIASGIQPIQNLKVLQYVGPDKKVEWGHYWIDRGFQCLEKMLVQTAGKYCVGDDITMADLCLVPQVYNANRFKVDMSRYPTIARIHEALEQVDAFKEA 201          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Nematostella
Match: EDO48375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJG9])

HSP 1 Score: 56.6102 bits (135), Expect = 1.235e-9
Identity = 34/107 (31.78%), Postives = 52/107 (48.60%), Query Frame = 1
Query:   94 KLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQP 414
            KLY+ +    + R  IA+  K   FE I  N      E     ++ INP   VP IV +G  + +S   IE+IDE F++   +LP  P +RA  R   + ++  + P
Sbjct:    7 KLYNAWFCPFAQRAWIAMLAKKAEFEYIEQNPYNKTPE-----WLAINPNGLVPVIVHNGNAVYESSICIEFIDEAFSTPVTILPKDPYKRAHGRMWGDFVSKKLVP 108          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Medaka
Match: gstz1 (glutathione S-transferase zeta 1 [Source:NCBI gene;Acc:101162171])

HSP 1 Score: 225.713 bits (574), Expect = 3.522e-74
Identity = 108/193 (55.96%), Postives = 143/193 (74.09%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            LYSY+RSS S+RVRIA ALK + +  +P+N+IKDGG+Q SE+Y  +NPM+QVP + IDG+TL QS+++I+YIDE    G  LLP  P  RA+ R I+++I SGIQP+QNLS L+ V      W    I+ GF+A+E IL +T+  YCVGDEIS+ADICLVPQVYNA RFKV++ Q+P I +IN+ L   EAF+
Sbjct:    9 LYSYFRSSCSWRVRIAFALKGIEYNLVPVNLIKDGGQQRSEQYSKLNPMQQVPAVEIDGITLCQSLAVIQYIDET-RPGPCLLPVDPKARAKVRMISDLIASGIQPIQNLSVLQKVGEEKVPWGQHFINRGFQALEPILKETSGKYCVGDEISMADICLVPQVYNAERFKVDIGQYPTIRKINETLLELEAFK 200          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Medaka
Match: gstz1 (glutathione S-transferase zeta 1 [Source:NCBI gene;Acc:101162171])

HSP 1 Score: 225.713 bits (574), Expect = 4.621e-74
Identity = 108/193 (55.96%), Postives = 143/193 (74.09%), Query Frame = 1
Query:   97 LYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            LYSY+RSS S+RVRIA ALK + +  +P+N+IKDGG+Q SE+Y  +NPM+QVP + IDG+TL QS+++I+YIDE    G  LLP  P  RA+ R I+++I SGIQP+QNLS L+ V      W    I+ GF+A+E IL +T+  YCVGDEIS+ADICLVPQVYNA RFKV++ Q+P I +IN+ L   EAF+
Sbjct:   13 LYSYFRSSCSWRVRIAFALKGIEYNLVPVNLIKDGGQQRSEQYSKLNPMQQVPAVEIDGITLCQSLAVIQYIDET-RPGPCLLPVDPKARAKVRMISDLIASGIQPIQNLSVLQKVGEEKVPWGQHFINRGFQALEPILKETSGKYCVGDEISMADICLVPQVYNAERFKVDIGQYPTIRKINETLLELEAFK 204          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Medaka
Match: gstz1 (glutathione S-transferase zeta 1 [Source:NCBI gene;Acc:101162171])

HSP 1 Score: 219.164 bits (557), Expect = 1.336e-71
Identity = 105/190 (55.26%), Postives = 140/190 (73.68%), Query Frame = 1
Query:  106 YYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQ 675
            Y+RSS S+RVRIA ALK + +  +P+N+IKDGG+Q SE+Y  +NPM+QVP + IDG+TL QS+++I+YIDE    G  LLP  P  RA+ R I+++I SGIQP+QNLS L+ V      W    I+ GF+A+E IL +T+  YCVGDEIS+ADICLVPQVYNA RFKV++ Q+P I +IN+ L   EAF+
Sbjct:   12 YFRSSCSWRVRIAFALKGIEYNLVPVNLIKDGGQQRSEQYSKLNPMQQVPAVEIDGITLCQSLAVIQYIDET-RPGPCLLPVDPKARAKVRMISDLIASGIQPIQNLSVLQKVGEEKVPWGQHFINRGFQALEPILKETSGKYCVGDEISMADICLVPQVYNAERFKVDIGQYPTIRKINETLLELEAFK 200          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Medaka
Match: gstt2 (glutathione S-transferase theta-1 [Source:NCBI gene;Acc:101170897])

HSP 1 Score: 53.9138 bits (128), Expect = 2.707e-8
Identity = 52/213 (24.41%), Postives = 94/213 (44.13%), Query Frame = 1
Query:   88 NIKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQP----------LQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIAD---ICLVPQVYNANRFKVNMDQFPLITRINQKLNS--HEAFQKA 681
             +++Y    S     V+I L    +P +   + + K  GE  + ++  +NPM++VP +V +G  LT+S +I++Y+           P  P +RA+  + A   ++  +P          L  + T   V       A   +      +ES+  +     C GD+I+IAD   +C + Q     R  +  D+ PL+ R   ++ S   EAF +A
Sbjct:    5 RLEVYLDLLSQPCRAVQILLTRTGIPHKVCAVALRK--GEHRTPEFTKLNPMQKVPVMVDNGFVLTESDAILKYLTTKPGVPEHWYPPQPDRRARVDEYAAWHHTNTRPHAAKVFLLEVLFPMQTGSPVDEARLQRALSELDGTLDKLESMFLRRQPFLC-GDDITIADLLAVCEIMQPLGGGR-DILKDR-PLLQRWKSRVQSAVGEAFDEA 212          
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Medaka
Match: ENSORLT00000031723.1 (glutathione S-transferase omega-1 [Source:NCBI gene;Acc:101171354])

HSP 1 Score: 47.7506 bits (112), Expect = 3.652e-6
Identity = 52/214 (24.30%), Postives = 89/214 (41.59%), Query Frame = 1
Query:   88 NIKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVID-GVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVP-----QVYNA----------NRFKVNMDQFPLITRINQKLNSHEAFQKA 681
            +I+LYS      + R R+ L  K + FETI I++     ++  E +   NP+  VP +    G  + +S    EY+DE +    KLLP +   +AQ R + E  +  I     + + K           ++     K  E ++ K  K +  GD I++ D  + P     +VY             ++   M + P +        +HEAF K+
Sbjct:   21 HIRLYSMRFCPFAQRTRLVLHTKGIKFETINIHL-----KEKPEWFFQKNPLGLVPVLETPAGEIICESSITSEYLDEAYPE-KKLLPSSAYAKAQQRMMLEHFSKIIPFFYRIPSAKRNGEDVSGMEAELKEKLGKLNEELVQKKTKFFG-GDSITMIDYMMWPHFERTEVYGVQNCLEHTPELKKWMGRMLEDPAVKATMFSKEAHEAFYKS 227          
BLAST of Glutathione S-transferase zeta 1 vs. Planmine SMEST
Match: SMESG000024871.1 (SMESG000024871.1)

HSP 1 Score: 414.846 bits (1065), Expect = 5.023e-149
Identity = 201/201 (100.00%), Postives = 201/201 (100.00%), Query Frame = 1
Query:   82 MVNIKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKAA 684
            MVNIKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKAA
Sbjct:    1 MVNIKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKAA 201          
BLAST of Glutathione S-transferase zeta 1 vs. Planmine SMEST
Match: SMESG000024875.1 (SMESG000024875.1)

HSP 1 Score: 223.016 bits (567), Expect = 9.572e-73
Identity = 107/185 (57.84%), Postives = 141/185 (76.22%), Query Frame = 1
Query:  130 RVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKAA 684
            RVRIAL LK L +E I I++ K  GEQ +E Y ++NP+ QVPT+VID  + TQSISIIEY+DEV+TS +KLLP   + RAQAR IAEIINSGIQPLQN+  LK +      W H VI+DGFK++E++L KT+  YCVG++I++ADI LVPQVYNA RFK+++++FP I+RI +    HEA +KA+
Sbjct:   46 RVRIALELKKLSYEIIAIDLYKGDGEQFNETYGSVNPLHQVPTLVIDEESFTQSISIIEYLDEVYTSNSKLLPTDLILRAQARTIAEIINSGIQPLQNVRLLKTLHEGKQVWVHKVINDGFKSLETMLKKTSGLYCVGNDITVADIFLVPQVYNAKRFKIDINEFPHISRIYKTFCQHEAVEKAS 230          
BLAST of Glutathione S-transferase zeta 1 vs. Planmine SMEST
Match: SMESG000024875.1 (SMESG000024875.1)

HSP 1 Score: 223.016 bits (567), Expect = 1.058e-72
Identity = 107/185 (57.84%), Postives = 141/185 (76.22%), Query Frame = 1
Query:  130 RVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKAA 684
            RVRIAL LK L +E I I++ K  GEQ +E Y ++NP+ QVPT+VID  + TQSISIIEY+DEV+TS +KLLP   + RAQAR IAEIINSGIQPLQN+  LK +      W H VI+DGFK++E++L KT+  YCVG++I++ADI LVPQVYNA RFK+++++FP I+RI +    HEA +KA+
Sbjct:   44 RVRIALELKKLSYEIIAIDLYKGDGEQFNETYGSVNPLHQVPTLVIDEESFTQSISIIEYLDEVYTSNSKLLPTDLILRAQARTIAEIINSGIQPLQNVRLLKTLHEGKQVWVHKVINDGFKSLETMLKKTSGLYCVGNDITVADIFLVPQVYNAKRFKIDINEFPHISRIYKTFCQHEAVEKAS 228          
BLAST of Glutathione S-transferase zeta 1 vs. Planmine SMEST
Match: SMESG000024875.1 (SMESG000024875.1)

HSP 1 Score: 222.631 bits (566), Expect = 1.109e-72
Identity = 107/185 (57.84%), Postives = 141/185 (76.22%), Query Frame = 1
Query:  130 RVRIALALKNLPFETIPINIIKDGGEQHSEKYITINPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQIAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKCYCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKAA 684
            RVRIAL LK L +E I I++ K  GEQ +E Y ++NP+ QVPT+VID  + TQSISIIEY+DEV+TS +KLLP   + RAQAR IAEIINSGIQPLQN+  LK +      W H VI+DGFK++E++L KT+  YCVG++I++ADI LVPQVYNA RFK+++++FP I+RI +    HEA +KA+
Sbjct:   40 RVRIALELKKLSYEIIAIDLYKGDGEQFNETYGSVNPLHQVPTLVIDEESFTQSISIIEYLDEVYTSNSKLLPTDLILRAQARTIAEIINSGIQPLQNVRLLKTLHEGKQVWVHKVINDGFKSLETMLKKTSGLYCVGNDITVADIFLVPQVYNAKRFKIDINEFPHISRIYKTFCQHEAVEKAS 224          
The following BLAST results are available for this feature:
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GSTZ16.918e-7355.67glutathione S-transferase zeta 1 [Source:HGNC Symb... [more]
GSTZ17.229e-7355.67glutathione S-transferase zeta 1 [Source:HGNC Symb... [more]
GSTZ14.735e-6251.03glutathione S-transferase zeta 1 [Source:HGNC Symb... [more]
GSTZ11.498e-5548.45glutathione S-transferase zeta 1 [Source:HGNC Symb... [more]
GSTZ11.193e-5045.36glutathione S-transferase zeta 1 [Source:HGNC Symb... [more]
back to top
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gst-434.106e-4842.21Glutathione S-Transferase [Source:UniProtKB/TrEMB... [more]
gst-424.096e-4741.84Probable maleylacetoacetate isomerase [Source:Uni... [more]
Y53G8B.12.151e-4143.50pep chromosome:WBcel235:III:3129277:3131399:1 gene... [more]
gst-372.797e-1126.18Glutathione S-Transferase [Source:UniProtKB/TrEMB... [more]
gst-311.036e-929.17Glutathione S-Transferase [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GstZ24.994e-6551.53gene:FBgn0037697 transcript:FBtr0082041[more]
GstZ26.807e-6551.53gene:FBgn0037697 transcript:FBtr0082043[more]
GstZ28.530e-6548.61gene:FBgn0037697 transcript:FBtr0082042[more]
GstZ17.663e-5644.62gene:FBgn0037696 transcript:FBtr0082044[more]
GstE52.861e-1427.67gene:FBgn0063495 transcript:FBtr0086673[more]
back to top
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gstz14.155e-7656.92glutathione S-transferase zeta 1 [Source:ZFIN;Acc:... [more]
gstz14.248e-7656.92glutathione S-transferase zeta 1 [Source:ZFIN;Acc:... [more]
gstz12.508e-5255.78glutathione S-transferase zeta 1 [Source:ZFIN;Acc:... [more]
gsto13.638e-1027.27glutathione S-transferase omega 1 [Source:ZFIN;Acc... [more]
gsto21.961e-826.29glutathione S-transferase omega 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GSTZ14.543e-6753.89glutathione S-transferase zeta 1 [Source:NCBI gene... [more]
GSTZ11.261e-5854.44glutathione S-transferase zeta 1 [Source:NCBI gene... [more]
gsto21.014e-726.83glutathione S-transferase omega 2 [Source:NCBI gen... [more]
gsto21.037e-726.83glutathione S-transferase omega 2 [Source:NCBI gen... [more]
back to top
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gstz11.230e-7356.19glutathione transferase zeta 1 (maleylacetoacetate... [more]
Gstz11.244e-7356.19glutathione transferase zeta 1 (maleylacetoacetate... [more]
Gstz12.361e-4753.42glutathione transferase zeta 1 (maleylacetoacetate... [more]
Gstz12.361e-4753.42glutathione transferase zeta 1 (maleylacetoacetate... [more]
Gsto23.921e-726.22glutathione S-transferase omega 2 [Source:MGI Symb... [more]
back to top
BLAST of Glutathione S-transferase zeta 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WVL0|MAAI_MOUSE8.604e-7356.19Maleylacetoacetate isomerase OS=Mus musculus OX=10... [more]
sp|P57113|MAAI_RAT7.049e-7256.19Maleylacetoacetate isomerase OS=Rattus norvegicus ... [more]
sp|O43708|MAAI_HUMAN3.262e-7054.64Maleylacetoacetate isomerase OS=Homo sapiens OX=96... [more]
sp|Q9VHD2|MAAI2_DROME8.551e-6448.61Probable maleylacetoacetate isomerase 2 OS=Drosoph... [more]
sp|Q54YN2|MAAI_DICDI1.396e-5747.40Maleylacetoacetate isomerase OS=Dictyostelium disc... [more]
back to top
BLAST of Glutathione S-transferase zeta 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5F8HAS32.661e-7557.73Glutathione S-transferase zeta 1 OS=Monodelphis do... [more]
A0A5N5N4G13.984e-7555.96Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A2I4BL874.300e-7555.96maleylacetoacetate isomerase isoform X2 OS=Austrof... [more]
A0A2I4BL614.543e-7555.96maleylacetoacetate isomerase isoform X1 OS=Austrof... [more]
G1LAV25.527e-7558.76Glutathione S-transferase zeta 1 OS=Ailuropoda mel... [more]
back to top
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000050956.15.211e-926.06pep primary_assembly:Astyanax_mexicanus-2.0:25:143... [more]
gstt1a1.343e-722.63glutathione S-transferase theta-1-like [Source:NCB... [more]
gstr3.514e-727.68glutathione S-transferase rho [Source:ZFIN;Acc:ZDB... [more]
gstt1b1.936e-624.83glutathione S-transferase theta-3-like [Source:NCB... [more]
gstt23.244e-623.50glutathione S-transferase theta-1-like [Source:NCB... [more]
back to top
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001383.16.424e-2056.45pep scaffold:Pmarinus_7.0:GL477094:183111:188906:-... [more]
back to top
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO401571.835e-7154.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483751.235e-931.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutathione S-transferase zeta 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gstz13.522e-7455.96glutathione S-transferase zeta 1 [Source:NCBI gene... [more]
gstz14.621e-7455.96glutathione S-transferase zeta 1 [Source:NCBI gene... [more]
gstz11.336e-7155.26glutathione S-transferase zeta 1 [Source:NCBI gene... [more]
gstt22.707e-824.41glutathione S-transferase theta-1 [Source:NCBI gen... [more]
ENSORLT00000031723.13.652e-624.30glutathione S-transferase omega-1 [Source:NCBI gen... [more]
back to top
BLAST of Glutathione S-transferase zeta 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000024871.15.023e-149100.00SMESG000024871.1[more]
SMESG000024875.19.572e-7357.84SMESG000024875.1[more]
SMESG000024875.11.058e-7257.84SMESG000024875.1[more]
SMESG000024875.11.109e-7257.84SMESG000024875.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003431 ID=SMED30003431|Name=Glutathione S-transferase zeta 1|organism=Schmidtea mediterranea sexual|type=transcript|length=771bp
CAAAATTTTCTCGTGACTTCGTAATTAAATTATAATTTTAATATTTCACT
TTATCCTGACTGATCAATTGCTCATATTGAAATGGTTAATATCAAGTTAT
ATTCATATTATCGAAGTTCTGCGTCATTTCGAGTAAGAATTGCTTTAGCA
TTGAAAAATCTTCCATTTGAAACGATTCCGATTAACATAATTAAAGATGG
CGGCGAACAACACAGTGAAAAGTACATAACGATCAATCCGATGCGCCAAG
TTCCAACTATTGTTATTGACGGTGTCACTTTGACCCAATCAATCAGTATT
ATTGAATATATTGATGAGGTGTTCACGTCTGGTACTAAATTATTACCAGG
TACCCCCTTACAACGGGCACAAGCACGTCAAATCGCTGAAATTATTAATT
CTGGCATCCAGCCATTGCAAAATCTTTCTACTCTTAAAGCAGTTCAAGGC
ACCCATCCAAATTGGGCACATGACGTGATTCATGACGGTTTTAAAGCAAT
CGAATCGATATTAGCGAAGACGGCGAAATGCTATTGTGTTGGTGATGAAA
TTTCAATCGCTGACATTTGTCTTGTCCCACAAGTGTATAATGCCAATCGG
TTCAAAGTGAATATGGATCAATTCCCTTTGATCACTAGAATAAATCAAAA
ATTGAACTCACATGAGGCATTCCAAAAGGCTGCACCAAATAATCAACCTG
ATTTCCCCGATAATTAATGATTAACAATTTTCTAGTTCAAATTGATTTTT
TACAATTTTTATTTGATTGGC
back to top

protein sequence of SMED30003431-orf-1

>SMED30003431-orf-1 ID=SMED30003431-orf-1|Name=SMED30003431-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=212bp
MVNIKLYSYYRSSASFRVRIALALKNLPFETIPINIIKDGGEQHSEKYIT
INPMRQVPTIVIDGVTLTQSISIIEYIDEVFTSGTKLLPGTPLQRAQARQ
IAEIINSGIQPLQNLSTLKAVQGTHPNWAHDVIHDGFKAIESILAKTAKC
YCVGDEISIADICLVPQVYNANRFKVNMDQFPLITRINQKLNSHEAFQKA
APNNQPDFPDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000204ovary
PLANA:0000231vitelline gland
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005955GST_Zeta
IPR036249Thioredoxin-like_sf
IPR040079Glutathione_S-Trfase
IPR034330GST_Zeta_C
IPR034333GST_Zeta_N
IPR036282Glutathione-S-Trfase_C_sf
IPR010987Glutathione-S-Trfase_C-like
IPR004045Glutathione_S-Trfase_N
IPR012336Thioredoxin-like_fold
IPR004046GST_C
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003824catalytic activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0009072aromatic amino acid family metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004045Glutathione S-transferase, N-terminalPFAMPF02798GST_Ncoord: 4..79
e-value: 1.8E-14
score: 53.8
IPR004045Glutathione S-transferase, N-terminalPROSITEPS50404GST_NTERcoord: 2..85
score: 24.57
IPR005955Glutathione S-transferases, class ZetaTIGRFAMTIGR01262TIGR01262coord: 5..208
e-value: 6.9E-77
score: 255.8
IPR004046Glutathione S-transferase, C-terminalPFAMPF14497GST_C_3coord: 128..197
e-value: 2.7E-6
score: 27.5
NoneNo IPR availableGENE3DG3DSA:1.20.1050.10coord: 89..211
e-value: 8.9E-49
score: 166.7
NoneNo IPR availableSFLDSFLDG00358Main_(cytGST)coord: 4..191
e-value: 4.0E-38
score: 125.8
NoneNo IPR availablePANTHERPTHR42673FAMILY NOT NAMEDcoord: 4..210
NoneNo IPR availablePANTHERPTHR42673:SF4MALEYLACETOACETATE ISOMERASEcoord: 4..210
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 6..82
e-value: 7.7E-25
score: 89.0
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 3..109
IPR040079Glutathione Transferase familySFLDSFLDS00019Glutathione_Transferase_(cytocoord: 4..191
e-value: 4.0E-38
score: 125.8
IPR010987Glutathione S-transferase, C-terminal-likePROSITEPS50405GST_CTERcoord: 91..210
score: 19.234
IPR034330Glutathione S-transferases, class Zeta , C-terminalCDDcd03191GST_C_Zetacoord: 92..205
e-value: 4.99378E-59
score: 179.7
IPR034333Glutathione S-transferases, class Zeta , N-terminalCDDcd03042GST_N_Zetacoord: 4..78
e-value: 7.26069E-38
score: 124.219
IPR036282Glutathione S-transferase, C-terminal domain superfamilySUPERFAMILYSSF47616GST C-terminal domain-likecoord: 86..209