SMED30003430

Overview
NameSMED30003430
Smed IDSMED30003430
Length (bp)922
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30003430 (SMED30003430) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30003430 (SMED30003430) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30003430 (SMED30003430) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30003430 (SMED30003430) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003430

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30003430SMESG000001786.1 Contig3022GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30003430SMESG000001786.1 SMESG000001778.1 dd_Smed_v4_5241_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30003430 vs. Ensembl Human
Match: TSPAN6 (tetraspanin 6 [Source:HGNC Symbol;Acc:HGNC:11858])

HSP 1 Score: 47.3654 bits (111), Expect = 3.489e-6
Identity = 25/80 (31.25%), Postives = 39/80 (48.75%), Query Frame = 3
Query:  354 LTIVLAFNGVVFGTLYSLKANATIGNYLMDSINDYDSS---RSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESC 584
            L  ++     + G ++  +   +  N    ++  Y+S+   RS  +D IQ TL CCG   Y DW  T YYS    +P+SC
Sbjct:   11 LVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKG-FPKSC 89          
BLAST of SMED30003430 vs. Ensembl Human
Match: TSPAN6 (tetraspanin 6 [Source:HGNC Symbol;Acc:HGNC:11858])

HSP 1 Score: 46.9802 bits (110), Expect = 4.070e-6
Identity = 25/82 (30.49%), Postives = 40/82 (48.78%), Query Frame = 3
Query:  348 IGLTIVLAFNGVVFGTLYSLKANATIGNYLMDSINDYDSS---RSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESC 584
            + L  ++     + G ++  +   +  N    ++  Y+S+   RS  +D IQ TL CCG   Y DW  T YYS    +P+SC
Sbjct:    9 LTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYS-EKGFPKSC 89          
BLAST of SMED30003430 vs. Ensembl Human
Match: TSPAN6 (tetraspanin 6 [Source:HGNC Symbol;Acc:HGNC:11858])

HSP 1 Score: 48.1358 bits (113), Expect = 7.358e-6
Identity = 25/80 (31.25%), Postives = 39/80 (48.75%), Query Frame = 3
Query:  354 LTIVLAFNGVVFGTLYSLKANATIGNYLMDSINDYDSS---RSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESC 584
            L  ++     + G ++  +   +  N    ++  Y+S+   RS  +D IQ TL CCG   Y DW  T YYS    +P+SC
Sbjct:   99 LVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKG-FPKSC 177          
BLAST of SMED30003430 vs. Ensembl Zebrafish
Match: tspan7 (tetraspanin 7 [Source:ZFIN;Acc:ZDB-GENE-030131-5435])

HSP 1 Score: 47.7506 bits (112), Expect = 3.359e-6
Identity = 29/95 (30.53%), Postives = 50/95 (52.63%), Query Frame = 3
Query:  315 KNYIIASS-IFVIGLTIVLAFNGVVF----GTLYSLKANATIGNYLMDSINDYDSSRSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESC 584
            K ++I+ S IF   + +VL F   +     G ++  +  A +      + ++Y     +DLD IQ+TL CCG ++Y+ W +TTY+      P+SC
Sbjct:   18 KTFLISYSLIFWYAMFLVLVFLAELVAGISGFIFRHEIKAVLKGAYQKAESNYMGKDDEDLDRIQRTLQCCGEENYTSWANTTYFEKEG-IPKSC 111          
BLAST of SMED30003430 vs. Ensembl Zebrafish
Match: tspan7 (tetraspanin 7 [Source:ZFIN;Acc:ZDB-GENE-030131-5435])

HSP 1 Score: 47.7506 bits (112), Expect = 6.585e-6
Identity = 21/65 (32.31%), Postives = 36/65 (55.38%), Query Frame = 3
Query:  390 GTLYSLKANATIGNYLMDSINDYDSSRSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESC 584
            G ++  +  A +      + ++Y     +DLD IQ+TL CCG ++Y+ W +TTY+      P+SC
Sbjct:  111 GFIFRHEIKAVLKGAYQKAESNYMGKDDEDLDRIQRTLQCCGEENYTSWANTTYFEKEG-IPKSC 174          
BLAST of SMED30003430 vs. Ensembl Zebrafish
Match: tspan36 (tetraspanin 36 [Source:NCBI gene;Acc:437021])

HSP 1 Score: 47.3654 bits (111), Expect = 6.867e-6
Identity = 38/157 (24.20%), Postives = 66/157 (42.04%), Query Frame = 3
Query:  339 IFVIGLTIVLAFNGVVFGTLYSLKANATIGNYLMDSINDYD--SSRSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTE-YPESCYSQGM------------LCEVGCHDLLYHWSRKIF---IEVISISGAISFVLLGEICYLLSVTEKKSPYKPL 755
            + +I L         VFG +Y  +    +   + D    YD  +S +  +D +Q  L CCG ++ +DW  T++++ H    P+SC    M            L   GC   L    + +    + VI     I F  +  +C +++   KK+ Y+PL
Sbjct:   86 LIIIMLIFAAEVTAFVFGIIYRGRIRGDLEKSMNDVFLKYDGLNSETHAVDYLQSQLECCGVKNQTDWTLTSWFAQHNNTVPQSCCKANMTQCTGQLSQPDLLNTQGCEAKLEQVLQDVLSYAMLVILGFAIIKFFGMLSVC-VITCKSKKNEYQPL 241          
BLAST of SMED30003430 vs. Ensembl Zebrafish
Match: tspan36 (tetraspanin 36 [Source:NCBI gene;Acc:437021])

HSP 1 Score: 47.3654 bits (111), Expect = 6.867e-6
Identity = 38/157 (24.20%), Postives = 66/157 (42.04%), Query Frame = 3
Query:  339 IFVIGLTIVLAFNGVVFGTLYSLKANATIGNYLMDSINDYD--SSRSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTE-YPESCYSQGM------------LCEVGCHDLLYHWSRKIF---IEVISISGAISFVLLGEICYLLSVTEKKSPYKPL 755
            + +I L         VFG +Y  +    +   + D    YD  +S +  +D +Q  L CCG ++ +DW  T++++ H    P+SC    M            L   GC   L    + +    + VI     I F  +  +C +++   KK+ Y+PL
Sbjct:   86 LIIIMLIFAAEVTAFVFGIIYRGRIRGDLEKSMNDVFLKYDGLNSETHAVDYLQSQLECCGVKNQTDWTLTSWFAQHNNTVPQSCCKANMTQCTGQLSQPDLLNTQGCEAKLEQVLQDVLSYAMLVILGFAIIKFFGMLSVC-VITCKSKKNEYQPL 241          
BLAST of SMED30003430 vs. Ensembl Xenopus
Match: sertad4 (SERTA domain containing 4 [Source:Xenbase;Acc:XB-GENE-943347])

HSP 1 Score: 51.9878 bits (123), Expect = 3.344e-7
Identity = 22/45 (48.89%), Postives = 27/45 (60.00%), Query Frame = 3
Query:  450 NDYDSSRSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESC 584
            N     RSQ +D IQ+TL CCG  SY++W  T YY  H   P+SC
Sbjct:  134 NATGDPRSQAVDTIQRTLQCCGVNSYNEWGQTQYYKTH-GIPQSC 177          
BLAST of SMED30003430 vs. Ensembl Xenopus
Match: lrrk2 (leucine-rich repeat kinase 2 [Source:Xenbase;Acc:XB-GENE-5768572])

HSP 1 Score: 48.9062 bits (115), Expect = 2.807e-6
Identity = 25/85 (29.41%), Postives = 42/85 (49.41%), Query Frame = 3
Query:  339 IFVIGLTIVLAFNGVVFGTLYSLKANATIG---NYLMDSINDYDSSRSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESC 584
            +F+I +        ++ G ++  K N  +    + L  + N  D S S  +D IQ+ L CCG ++Y+DW  T +Y  +   P SC
Sbjct:   86 MFLISIIFAAGVAAMILGLVFVDKINPELEKNMDNLFKTYNGVDVS-SSTVDFIQERLECCGRKNYTDWEETDWYQTNKSLPMSC 169          
BLAST of SMED30003430 vs. Ensembl Xenopus
Match: lrrk2 (leucine-rich repeat kinase 2 [Source:Xenbase;Acc:XB-GENE-5768572])

HSP 1 Score: 48.521 bits (114), Expect = 4.894e-6
Identity = 25/85 (29.41%), Postives = 42/85 (49.41%), Query Frame = 3
Query:  339 IFVIGLTIVLAFNGVVFGTLYSLKANATIG---NYLMDSINDYDSSRSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESC 584
            +F+I +        ++ G ++  K N  +    + L  + N  D S S  +D IQ+ L CCG ++Y+DW  T +Y  +   P SC
Sbjct:   93 MFLISIIFAAGVAAMILGLVFVDKINPELEKNMDNLFKTYNGVDVS-SSTVDFIQERLECCGRKNYTDWEETDWYQTNKSLPMSC 176          
BLAST of SMED30003430 vs. Ensembl Mouse
Match: Tspan6 (tetraspanin 6 [Source:MGI Symbol;Acc:MGI:1926264])

HSP 1 Score: 51.2174 bits (121), Expect = 1.650e-7
Identity = 35/85 (41.18%), Postives = 51/85 (60.00%), Query Frame = 3
Query:  339 IFVIGLTIVLAFNGVVFGTLYSLKANATIGNYLMDSINDYDSS---RSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESC 584
            IF++ L  V A  G VF   + +K N+   NY  +++ +Y+S+   RS+ +D IQ TL CCG  +Y DW  T YYS  T +P+SC
Sbjct:   51 IFLVEL--VAAIVGFVF--RHEIK-NSFKSNY-ENALKEYNSTGDYRSEAVDKIQSTLHCCGVTNYGDWKGTNYYS-ETGFPKSC 128          
BLAST of SMED30003430 vs. Ensembl Mouse
Match: Tspan6 (tetraspanin 6 [Source:MGI Symbol;Acc:MGI:1926264])

HSP 1 Score: 51.9878 bits (123), Expect = 2.639e-7
Identity = 23/51 (45.10%), Postives = 34/51 (66.67%), Query Frame = 3
Query:  441 DSINDYDSS---RSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESC 584
            +++ +Y+S+   RS+ +D IQ TL CCG  +Y DW  T YYS  T +P+SC
Sbjct:  128 NALKEYNSTGDYRSEAVDKIQSTLHCCGVTNYGDWKGTNYYS-ETGFPKSC 177          
BLAST of SMED30003430 vs. Ensembl Mouse
Match: Tspan7 (tetraspanin 7 [Source:MGI Symbol;Acc:MGI:1298407])

HSP 1 Score: 47.7506 bits (112), Expect = 6.110e-6
Identity = 21/67 (31.34%), Postives = 40/67 (59.70%), Query Frame = 3
Query:  441 DSINDYDSS--RSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESCYSQGMLCEVGCHDLLYH 635
            D++ +Y+ +  RS+ +D +Q++L CCG Q+Y++W+ + Y+ +H   P  C +     E  C+ L  H
Sbjct:  126 DAMQNYNGNDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLDHGIPPSCCMN-----ETDCNPLDLH 187          
BLAST of SMED30003430 vs. Ensembl Mouse
Match: Tspan7 (tetraspanin 7 [Source:MGI Symbol;Acc:MGI:1298407])

HSP 1 Score: 47.7506 bits (112), Expect = 6.404e-6
Identity = 21/67 (31.34%), Postives = 40/67 (59.70%), Query Frame = 3
Query:  441 DSINDYDSS--RSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESCYSQGMLCEVGCHDLLYH 635
            D++ +Y+ +  RS+ +D +Q++L CCG Q+Y++W+ + Y+ +H   P  C +     E  C+ L  H
Sbjct:  126 DAMQNYNGNDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLDHGIPPSCCMN-----ETDCNPLDLH 187          
BLAST of SMED30003430 vs. UniProt/SwissProt
Match: sp|O70401|TSN6_MOUSE (Tetraspanin-6 OS=Mus musculus OX=10090 GN=Tspan6 PE=1 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 1.952e-6
Identity = 23/51 (45.10%), Postives = 34/51 (66.67%), Query Frame = 3
Query:  441 DSINDYDSS---RSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESC 584
            +++ +Y+S+   RS+ +D IQ TL CCG  +Y DW  T YYS  T +P+SC
Sbjct:  128 NALKEYNSTGDYRSEAVDKIQSTLHCCGVTNYGDWKGTNYYS-ETGFPKSC 177          
BLAST of SMED30003430 vs. TrEMBL
Match: A0A0B8RY74 (Tetraspanin OS=Boiga irregularis OX=92519 PE=3 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 3.457e-8
Identity = 44/145 (30.34%), Postives = 71/145 (48.97%), Query Frame = 3
Query:  312 KKNYIIASSIFVIGLTIV--LAFNGVVFGTLYSLKANATIGNYLMDSINDYDSSRSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESCYSQGMLC----------EVGCHDLLYHWSRKIFIEVISISGAISFV-LLGEI 707
            K+NY + ++ F + LTI+  +     + G ++  K    I N + + +N Y+SS    LD +Q+   CCG  SY+DW + T    + + P SC   GM C          E GC   +  W R+  + V +++  I+F  LLG I
Sbjct:   78 KENYCMVTT-FAVLLTIIFLVEIAAAITGYIFKDKVKTVIKNEIQEEMNSYNSSGPNILDDLQRKYNCCGINSYTDWFNVTQLKPN-KVPSSCCKNGMDCTKNPTRENTFEEGCVKEIEDWLRRHIVIVAAVALGIAFFELLGII 220          
BLAST of SMED30003430 vs. TrEMBL
Match: A0A3Q1AZU1 (Tetraspanin OS=Amphiprion ocellaris OX=80972 PE=3 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 3.946e-8
Identity = 34/109 (31.19%), Postives = 54/109 (49.54%), Query Frame = 3
Query:  405 LKANATIGNYLMDSINDYDSSRSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESCYSQGMLCEVGCHDLLYHWSRKIFIEVISISGAISFVLLGEICYLLSVTE 731
            L+AN+ I N     IN+Y   +   ++ IQ+   CCG+ SY+DW+ +  + NH   P+SC    M+   GC     +   K  I  I +    + + +G +C  L VTE
Sbjct:  111 LQANSAINNKARGVINEYKVEKRHAINRIQEKFSCCGADSYTDWSKSVGWENHDAVPDSCC---MVKTEGCGQDKANVHTKGCISAIKLFLVKNLLWVGAVCIALGVTE 216          
BLAST of SMED30003430 vs. TrEMBL
Match: B5XGI5 (Tetraspanin OS=Salmo salar OX=8030 GN=TSN7 PE=2 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 7.796e-8
Identity = 31/88 (35.23%), Postives = 49/88 (55.68%), Query Frame = 3
Query:  354 LTIVLAFNGVVFGTLYSLKANATIGNYLMDSINDYDSS--RSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESCYSQGMLCEV 611
            L  V  F   + G L+  +  A +G    D++ +Y+++  +S  +D IQ+TL CCG +SY DWN T Y+ +    PESC  +  +C V
Sbjct:   99 LVFVAEFVAGISGFLFRHEIKAVLGGAYKDAVTNYNTTDPKSSAVDTIQKTLHCCGVESYKDWNTTKYFKDQG-IPESCCKEDAVCTV 185          
BLAST of SMED30003430 vs. TrEMBL
Match: A0A060X046 (Tetraspanin OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00024589001 PE=3 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.078e-7
Identity = 33/103 (32.04%), Postives = 56/103 (54.37%), Query Frame = 3
Query:  354 LTIVLAFNGVVFGTLYSLKANATIGNYLMDSINDYDSS--RSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESCYSQGMLCEV-------GCHDLLYH 635
            L  +  F   + G L+  +  A +G+   D++ +Y+++  +S  +D IQ+TL CCG +SY+DWN T Y+ +    P+SC  +  +C V          DL+YH
Sbjct:   99 LVFIAEFVAGISGFLFRHEIKAVLGDAYKDAVTNYNTTDPKSSAVDNIQKTLHCCGVESYTDWNTTKYFKDQ-GIPDSCCKENTVCPVEDLKNLDRALDLVYH 200          
BLAST of SMED30003430 vs. TrEMBL
Match: I3KH36 (Tetraspanin OS=Oreochromis niloticus OX=8128 PE=3 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.731e-7
Identity = 36/119 (30.25%), Postives = 54/119 (45.38%), Query Frame = 3
Query:  375 NGVVFGTLYSLKANATIGNYLMDSINDYDSSRSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESCYSQGMLCEVGCHDLLYHWSRKIFIEVISISGAISFVLLGEICYLLSVTE 731
             G  F    S  AN  +     + INDY   R   +D IQ+   CCG+ SY+DW+ +T +  H   P+SC    ++   GC        +K  +  I +    + V +G +C  L VTE
Sbjct:   91 TGAAFYIFRSRMANG-VNAKAQEVINDYSPERRHAIDKIQEKFKCCGADSYADWSQSTGWGKHDAVPDSCC---VVKSEGCGQDKEKAHKKGCLWAIGVFLLKNLVWVGAVCIALGVTE 205          
BLAST of SMED30003430 vs. Ensembl Cavefish
Match: tspan7 (tetraspanin 6 [Source:NCBI gene;Acc:103041655])

HSP 1 Score: 50.8322 bits (120), Expect = 5.367e-7
Identity = 24/67 (35.82%), Postives = 41/67 (61.19%), Query Frame = 3
Query:  390 GTLYSLKANATIGNYLMDSINDYDSSRSQD--LDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESC 584
            G ++  +  A + +  + + N Y+S+ S+   LD IQ+TL CCG  +Y+ W HT+Y+ N +  P+SC
Sbjct:  111 GFVFRHEIKAVLRDAYVKAENSYNSTESKRVALDTIQRTLKCCGEYNYTSWTHTSYF-NQSGIPDSC 176          
BLAST of SMED30003430 vs. Ensembl Cavefish
Match: tspan36 (tetraspanin 36 [Source:NCBI gene;Acc:437021])

HSP 1 Score: 46.9802 bits (110), Expect = 7.154e-6
Identity = 38/159 (23.90%), Postives = 70/159 (44.03%), Query Frame = 3
Query:  327 IASSIFVIGLTIVLA--FNGVVFGTLYSLKANATIGNYLMDSINDYDSSRSQD--LDIIQQTLFCCGSQSYSDWNHTTYYSNH-TEYPESCYSQGMLCE-----------VGCHDLLYHWSRKIFIEVISISGAISFVLLGEICYLLSVTEKKSPYKPL 755
            +  S F++ L +V A      VFG +Y  K    +   + D    YD   ++   +D +Q  L CCG  +Y+DW+   ++++H +  P SC      C             GC   L     K+  +V+S   A+  +L+  +  +++    ++ Y+PL
Sbjct:   80 VGLSFFMVILLLVFAAEVAAFVFGFIYRGKIKGDLEKSMSDVFQKYDGKNAETAAVDYLQSQLQCCGVNNYTDWSSRPWFTSHNSTVPVSCCKANSTCTGQFDKPELLNVQGCEAKL----EKLLQDVLSY--AMLVILVTPLICVITCRSGRNEYQPL 232          
BLAST of SMED30003430 vs. Ensembl Cavefish
Match: cd63 (CD63 molecule [Source:NCBI gene;Acc:103032697])

HSP 1 Score: 46.9802 bits (110), Expect = 9.047e-6
Identity = 26/95 (27.37%), Postives = 47/95 (49.47%), Query Frame = 3
Query:  312 KKNYIIASSIFVI-GLTIVLAFNGVVFGTLYSLKANATIGNYLMDSINDYDSSRSQ---DLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESC 584
            K+NY + +   ++  L I++     +   ++  K    + + L D I  Y++   +    LD IQ+ L CCG+ + SDW    +  +HT  P+SC
Sbjct:   77 KENYCMVTMFAILLSLIIIVEIGTAIAAYVFRDKLTGLVDDGLRDMIKQYNNGSKEYQEGLDRIQKDLKCCGAANSSDW--VNFKPDHTSVPDSC 169          
BLAST of SMED30003430 vs. Ensembl Cavefish
Match: tspan36 (tetraspanin 36 [Source:NCBI gene;Acc:437021])

HSP 1 Score: 46.9802 bits (110), Expect = 9.201e-6
Identity = 40/159 (25.16%), Postives = 70/159 (44.03%), Query Frame = 3
Query:  327 IASSIFVIGLTIVLA--FNGVVFGTLYSLKANATIGNYLMDSINDYDSSRSQD--LDIIQQTLFCCGSQSYSDWNHTTYYSNH-TEYPESCYSQGMLCE-----------VGCHDLLYHWSRKIFIEVISISGAISFVLLGEICYLLSVTEKKSPYKPL 755
            +  S F++ L +V A      VFG +Y  K    +   + D    YD   ++   +D +Q  L CCG  +Y+DW+   ++++H +  P SC      C             GC   L     K+  +V+S   A+ F  +  IC +++    ++ Y+PL
Sbjct:   80 VGLSFFMVILLLVFAAEVAAFVFGFIYRGKIKGDLEKSMSDVFQKYDGKNAETAAVDYLQSQLQCCGVNNYTDWSSRPWFTSHNSTVPVSCCKANSTCTGQFDKPELLNVQGCEAKL----EKLLQDVLSY--AMLFFGMLSIC-VITCRSGRNEYQPL 231          
BLAST of SMED30003430 vs. Ensembl Nematostella
Match: EDO34309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPQ7])

HSP 1 Score: 51.6026 bits (122), Expect = 8.763e-8
Identity = 29/88 (32.95%), Postives = 45/88 (51.14%), Query Frame = 3
Query:  336 SIFVIGLTIV--LAFNGVVFGTLYSLKANATIGNYLMDSINDYDSSRS---QDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESC 584
            SIF I L +V  L     V G +Y  +A   + N L D+I+ Y        + +D +Q+ L CCGS   +DW ++T++      P+SC
Sbjct:   79 SIFFILLLVVFSLEITAGVLGAIYKNQAKDEVKNGLTDAIDHYSKEEQGFQKAVDKLQENLDCCGSTGPNDWVNSTFWKEKHHLPKSC 166          
BLAST of SMED30003430 vs. Ensembl Nematostella
Match: EDO41432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S486])

HSP 1 Score: 46.9802 bits (110), Expect = 2.378e-6
Identity = 20/52 (38.46%), Postives = 28/52 (53.85%), Query Frame = 3
Query:  435 LMDSINDY--DSSRSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESC 584
            L D +  Y  DSS+ + +D IQ    CCG +SY DW    Y+S  +  P +C
Sbjct:   66 LEDGLKSYQQDSSKQEFIDFIQTRFKCCGIESYKDWQANRYFSCSSPVPTAC 117          
BLAST of SMED30003430 vs. Ensembl Medaka
Match: ENSORLT00000039017.1 (CD63 antigen-like [Source:NCBI gene;Acc:101169982])

HSP 1 Score: 51.2174 bits (121), Expect = 2.680e-7
Identity = 28/108 (25.93%), Postives = 51/108 (47.22%), Query Frame = 3
Query:  405 LKANATIGNYLMDSINDYDSSRSQDLDIIQQTLFCCGSQSYSDWNHTTYYSNHTEYPESCYSQGMLCEVGCHDLLYHWSRKIFIEVISISGAISFVLLGEICYLLSVT 728
            LK N+ I     ++I  YD      ++ IQ+ L CCG+ +Y+DW  +  ++     P+SC    ++ + GC       ++K     I +    + V +G +C  L +T
Sbjct:   86 LKMNSDINTKTREAIYKYDPENRDPVNRIQEKLSCCGADTYTDWYRSGGWAKQDAVPDSCC---VVKKPGCGQQKEEINKKGCSMAIKLFLLKNIVWVGAVCIGLGIT 190          
BLAST of SMED30003430 vs. Planmine SMEST
Match: SMESG000001778.1 (SMESG000001778.1)

HSP 1 Score: 207.223 bits (526), Expect = 4.657e-67
Identity = 140/142 (98.59%), Postives = 140/142 (98.59%), Query Frame = 3
Query:   75 MSIESFYLKKARINLXXXXXXXXXXXXXXSTSGSLFYLKSRKFHEISHLLYLTELMIILFVCGIXXXXXXXXXXXXXXXKKNYIIASSIFVIGLTIVLAFNGVVFGTLYSLKANATIGNYLMDSINDYDSSRSQDLDIIQQT 500
            MS ESFYLKKARINLFIFTAVFVIFAIAFSTSGSLFYLKSRKFHEISHLLYLTELMIILFVCGILCSCGSLLCLFSALLKKNYIIASSIFVIGLTIVLAFNGVVFGTLYSLKANATIGNYLMDSINDYDSSRS DLDIIQQT
Sbjct:    1 MSFESFYLKKARINLFIFTAVFVIFAIAFSTSGSLFYLKSRKFHEISHLLYLTELMIILFVCGILCSCGSLLCLFSALLKKNYIIASSIFVIGLTIVLAFNGVVFGTLYSLKANATIGNYLMDSINDYDSSRSPDLDIIQQT 142          
BLAST of SMED30003430 vs. Planmine SMEST
Match: SMESG000001778.1 (SMESG000001778.1)

HSP 1 Score: 207.223 bits (526), Expect = 4.972e-67
Identity = 140/143 (97.90%), Postives = 141/143 (98.60%), Query Frame = 3
Query:   75 MSIESFYLKKARINLXXXXXXXXXXXXXXSTSGSLFYLKSRKFHEISHLLYLTELMIILFVCGIXXXXXXXXXXXXXXXKKNYIIASSIFVIGLTIVLAFNGVVFGTLYSLKANATIGNYLMDSINDYDSSRSQDLDIIQQTL 503
            MS ESFYLKKARINLFIFTAVFVIFAIAFSTSGSLFYLKSRKFHEISHLLYLTELMIILFVCGILCSCGSLLCLFSALLKKNYIIASSIFVIGLTIVLAFNGVVFGTLYSLKANATIGNYLMDSINDYDSSRS DLDIIQQT+
Sbjct:    1 MSFESFYLKKARINLFIFTAVFVIFAIAFSTSGSLFYLKSRKFHEISHLLYLTELMIILFVCGILCSCGSLLCLFSALLKKNYIIASSIFVIGLTIVLAFNGVVFGTLYSLKANATIGNYLMDSINDYDSSRSPDLDIIQQTV 143          
The following BLAST results are available for this feature:
BLAST of SMED30003430 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TSPAN63.489e-631.25tetraspanin 6 [Source:HGNC Symbol;Acc:HGNC:11858][more]
TSPAN64.070e-630.49tetraspanin 6 [Source:HGNC Symbol;Acc:HGNC:11858][more]
TSPAN67.358e-631.25tetraspanin 6 [Source:HGNC Symbol;Acc:HGNC:11858][more]
back to top
BLAST of SMED30003430 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003430 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003430 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tspan73.359e-630.53tetraspanin 7 [Source:ZFIN;Acc:ZDB-GENE-030131-543... [more]
tspan76.585e-632.31tetraspanin 7 [Source:ZFIN;Acc:ZDB-GENE-030131-543... [more]
tspan366.867e-624.20tetraspanin 36 [Source:NCBI gene;Acc:437021][more]
tspan366.867e-624.20tetraspanin 36 [Source:NCBI gene;Acc:437021][more]
back to top
BLAST of SMED30003430 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sertad43.344e-748.89SERTA domain containing 4 [Source:Xenbase;Acc:XB-G... [more]
lrrk22.807e-629.41leucine-rich repeat kinase 2 [Source:Xenbase;Acc:X... [more]
lrrk24.894e-629.41leucine-rich repeat kinase 2 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of SMED30003430 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Tspan61.650e-741.18tetraspanin 6 [Source:MGI Symbol;Acc:MGI:1926264][more]
Tspan62.639e-745.10tetraspanin 6 [Source:MGI Symbol;Acc:MGI:1926264][more]
Tspan76.110e-631.34tetraspanin 7 [Source:MGI Symbol;Acc:MGI:1298407][more]
Tspan76.404e-631.34tetraspanin 7 [Source:MGI Symbol;Acc:MGI:1298407][more]
back to top
BLAST of SMED30003430 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|O70401|TSN6_MOUSE1.952e-645.10Tetraspanin-6 OS=Mus musculus OX=10090 GN=Tspan6 P... [more]
back to top
BLAST of SMED30003430 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B8RY743.457e-830.34Tetraspanin OS=Boiga irregularis OX=92519 PE=3 SV=... [more]
A0A3Q1AZU13.946e-831.19Tetraspanin OS=Amphiprion ocellaris OX=80972 PE=3 ... [more]
B5XGI57.796e-835.23Tetraspanin OS=Salmo salar OX=8030 GN=TSN7 PE=2 SV... [more]
A0A060X0461.078e-732.04Tetraspanin OS=Oncorhynchus mykiss OX=8022 GN=GSON... [more]
I3KH361.731e-730.25Tetraspanin OS=Oreochromis niloticus OX=8128 PE=3 ... [more]
back to top
BLAST of SMED30003430 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tspan75.367e-735.82tetraspanin 6 [Source:NCBI gene;Acc:103041655][more]
tspan367.154e-623.90tetraspanin 36 [Source:NCBI gene;Acc:437021][more]
cd639.047e-627.37CD63 molecule [Source:NCBI gene;Acc:103032697][more]
tspan369.201e-625.16tetraspanin 36 [Source:NCBI gene;Acc:437021][more]
back to top
BLAST of SMED30003430 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003430 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003430 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO343098.763e-832.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414322.378e-638.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30003430 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000039017.12.680e-725.93CD63 antigen-like [Source:NCBI gene;Acc:101169982][more]
back to top
BLAST of SMED30003430 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000001778.14.657e-6798.59SMESG000001778.1[more]
SMESG000001778.14.972e-6797.90SMESG000001778.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003430 ID=SMED30003430|Name=SMED30003430|organism=Schmidtea mediterranea sexual|type=transcript|length=922bp
ATTTTTGACGAGCTTTATTTAAATCAAGCATTTTGTTAAATTTTTTATTT
CTCATAATTAATAATTGTCCTTCGATGTCAATTGAATCGTTTTATTTGAA
AAAGGCAAGAATTAATTTATTCATCTTTACTGCAGTGTTTGTAATATTTG
CCATTGCGTTCAGCACATCTGGCTCATTGTTCTATTTGAAATCTCGTAAA
TTCCATGAAATTTCACACCTGCTTTACCTTACTGAACTTATGATAATATT
ATTTGTTTGTGGGATTTTATGTTCATGCGGAAGCCTTTTGTGTTTATTCA
GTGCTTTATTAAAGAAGAATTATATCATTGCCTCGAGTATATTTGTTATT
GGTCTAACGATTGTGCTGGCATTCAACGGTGTGGTATTTGGGACTTTATA
TTCATTGAAGGCAAATGCGACTATCGGGAATTATTTAATGGACTCTATAA
ATGATTATGATTCAAGTCGTTCACAAGATCTCGATATCATTCAGCAAACG
CTATTTTGCTGTGGCTCACAATCATATTCAGATTGGAACCACACGACATA
TTACTCGAATCACACAGAATATCCAGAGTCATGTTACTCACAAGGGATGC
TGTGTGAGGTGGGCTGTCATGACCTGCTTTATCATTGGTCCCGTAAAATA
TTCATTGAAGTTATATCGATTTCGGGGGCAATTTCATTTGTTTTGCTTGG
CGAGATTTGTTATCTTCTGTCTGTAACGGAAAAGAAATCACCTTACAAGC
CGCTTATCAATTCAGATATTTGAGATAGATTGATTATTGAATTTATCATA
TTTTAGTACTACATTTTCTTTTAACTACGTCATTTTATATTTATTGATTT
TTTAAATACGTTAAACGATTTTTAAATATTTATTTTTTGTCTTCTATTAA
TTGAATAAATTTATTGAGGGCT
back to top

protein sequence of SMED30003430-orf-1

>SMED30003430-orf-1 ID=SMED30003430-orf-1|Name=SMED30003430-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=233bp
MSIESFYLKKARINLFIFTAVFVIFAIAFSTSGSLFYLKSRKFHEISHLL
YLTELMIILFVCGILCSCGSLLCLFSALLKKNYIIASSIFVIGLTIVLAF
NGVVFGTLYSLKANATIGNYLMDSINDYDSSRSQDLDIIQQTLFCCGSQS
YSDWNHTTYYSNHTEYPESCYSQGMLCEVGCHDLLYHWSRKIFIEVISIS
GAISFVLLGEICYLLSVTEKKSPYKPLINSDI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008952Tetraspanin, EC2 domain superfamilyGENE3DG3DSA:1.10.1450.10coord: 111..190
e-value: 6.9E-10
score: 40.6
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 119..188
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 14..215
e-value: 1.8E-14
score: 54.0
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 8..215
NoneNo IPR availablePANTHERPTHR19282:SF39LEUKOCYTE SURFACE ANTIGEN CD53coord: 8..215
NoneNo IPR availableTMHMMTMhelixcoord: 83..105
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 196..218
NoneNo IPR availableTMHMMTMhelixcoord: 15..37