Calcium binding protein 39

Overview
NameCalcium binding protein 39
Smed IDSMED30003427
Length (bp)1234
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium binding protein 39 (SMED30003427) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium binding protein 39 (SMED30003427) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium binding protein 39 (SMED30003427) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium binding protein 39 (SMED30003427) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003427

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30003427SMESG000006408.1 Contig3526GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium binding protein 39 vs. Ensembl Human
Match: CAB39L (calcium binding protein 39 like [Source:HGNC Symbol;Acc:HGNC:20290])

HSP 1 Score: 305.064 bits (780), Expect = 6.016e-101
Identity = 172/349 (49.28%), Postives = 221/349 (63.32%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK 1119
            MPLF ++ K P E+ + L + L  L    K +K   K  EE+S+ L  +K++L   ++ K  P E  +                   E+  +  L  L+  L +IDFE  K V ++F  + RR  G RSP   Y+  H  ILF LL GY   +IAL  G M RE  RHE LAK ++ S  F + F +V+ + FDI+SDAF T KDLLTRHK +VA+FLE N+D +F  Y +LLQSENYVTKRQSLKLLGEL+LDR+NF +M +YIS  +NLKLMMNLL+ +   I FEAFH FKVFVA+P+K + I  IL +NQ KLI FLS+FQ +RTD  QF +EK YLIKQIRDLK
Sbjct:    4 MPLFSKSHKNPAEIVKILKDNLAILE---KQDKKTDKASEEVSKSLQAMKEILCG-TNEKEPPTEAVAQL---------------AQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLK 333          
BLAST of Calcium binding protein 39 vs. Ensembl Human
Match: CAB39L (calcium binding protein 39 like [Source:HGNC Symbol;Acc:HGNC:20290])

HSP 1 Score: 305.064 bits (780), Expect = 6.016e-101
Identity = 172/349 (49.28%), Postives = 221/349 (63.32%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK 1119
            MPLF ++ K P E+ + L + L  L    K +K   K  EE+S+ L  +K++L   ++ K  P E  +                   E+  +  L  L+  L +IDFE  K V ++F  + RR  G RSP   Y+  H  ILF LL GY   +IAL  G M RE  RHE LAK ++ S  F + F +V+ + FDI+SDAF T KDLLTRHK +VA+FLE N+D +F  Y +LLQSENYVTKRQSLKLLGEL+LDR+NF +M +YIS  +NLKLMMNLL+ +   I FEAFH FKVFVA+P+K + I  IL +NQ KLI FLS+FQ +RTD  QF +EK YLIKQIRDLK
Sbjct:    4 MPLFSKSHKNPAEIVKILKDNLAILE---KQDKKTDKASEEVSKSLQAMKEILCG-TNEKEPPTEAVAQL---------------AQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLK 333          
BLAST of Calcium binding protein 39 vs. Ensembl Human
Match: CAB39L (calcium binding protein 39 like [Source:HGNC Symbol;Acc:HGNC:20290])

HSP 1 Score: 305.064 bits (780), Expect = 6.016e-101
Identity = 172/349 (49.28%), Postives = 221/349 (63.32%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK 1119
            MPLF ++ K P E+ + L + L  L    K +K   K  EE+S+ L  +K++L   ++ K  P E  +                   E+  +  L  L+  L +IDFE  K V ++F  + RR  G RSP   Y+  H  ILF LL GY   +IAL  G M RE  RHE LAK ++ S  F + F +V+ + FDI+SDAF T KDLLTRHK +VA+FLE N+D +F  Y +LLQSENYVTKRQSLKLLGEL+LDR+NF +M +YIS  +NLKLMMNLL+ +   I FEAFH FKVFVA+P+K + I  IL +NQ KLI FLS+FQ +RTD  QF +EK YLIKQIRDLK
Sbjct:    4 MPLFSKSHKNPAEIVKILKDNLAILE---KQDKKTDKASEEVSKSLQAMKEILCG-TNEKEPPTEAVAQL---------------AQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLK 333          
BLAST of Calcium binding protein 39 vs. Ensembl Human
Match: CAB39L (calcium binding protein 39 like [Source:HGNC Symbol;Acc:HGNC:20290])

HSP 1 Score: 305.064 bits (780), Expect = 6.016e-101
Identity = 172/349 (49.28%), Postives = 221/349 (63.32%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK 1119
            MPLF ++ K P E+ + L + L  L    K +K   K  EE+S+ L  +K++L   ++ K  P E  +                   E+  +  L  L+  L +IDFE  K V ++F  + RR  G RSP   Y+  H  ILF LL GY   +IAL  G M RE  RHE LAK ++ S  F + F +V+ + FDI+SDAF T KDLLTRHK +VA+FLE N+D +F  Y +LLQSENYVTKRQSLKLLGEL+LDR+NF +M +YIS  +NLKLMMNLL+ +   I FEAFH FKVFVA+P+K + I  IL +NQ KLI FLS+FQ +RTD  QF +EK YLIKQIRDLK
Sbjct:    4 MPLFSKSHKNPAEIVKILKDNLAILE---KQDKKTDKASEEVSKSLQAMKEILCG-TNEKEPPTEAVAQL---------------AQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLK 333          
BLAST of Calcium binding protein 39 vs. Ensembl Human
Match: CAB39L (calcium binding protein 39 like [Source:HGNC Symbol;Acc:HGNC:20290])

HSP 1 Score: 305.064 bits (780), Expect = 6.016e-101
Identity = 172/349 (49.28%), Postives = 221/349 (63.32%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK 1119
            MPLF ++ K P E+ + L + L  L    K +K   K  EE+S+ L  +K++L   ++ K  P E  +                   E+  +  L  L+  L +IDFE  K V ++F  + RR  G RSP   Y+  H  ILF LL GY   +IAL  G M RE  RHE LAK ++ S  F + F +V+ + FDI+SDAF T KDLLTRHK +VA+FLE N+D +F  Y +LLQSENYVTKRQSLKLLGEL+LDR+NF +M +YIS  +NLKLMMNLL+ +   I FEAFH FKVFVA+P+K + I  IL +NQ KLI FLS+FQ +RTD  QF +EK YLIKQIRDLK
Sbjct:    4 MPLFSKSHKNPAEIVKILKDNLAILE---KQDKKTDKASEEVSKSLQAMKEILCG-TNEKEPPTEAVAQL---------------AQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLK 333          
BLAST of Calcium binding protein 39 vs. Ensembl Celegans
Match: mop-25.1 (MO25 (MOuse embryo scaffolding Protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q7Z2A5])

HSP 1 Score: 276.944 bits (707), Expect = 6.098e-90
Identity = 171/360 (47.50%), Postives = 232/360 (64.44%), Query Frame = 1
Query:   76 MPL-FGRT-KTPKELTQTLVECLQALN--APNKAEKDKK--------KLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK 1119
            MPL FG++ K+P ++ +TL E L  L+   P K +KD          K ++E+S+ ++ +K  +     N  A  E  S+ ++         + ++  E+   N L  L++ L   +FE  K V ++F  L RR  G RSP   YL     IL QL+ GY+  +IAL  G M RE+ RH+ LAK ++ S+ FY  F +VQ   FDISSDAF+T K+L TRHK ++AEFL++N+D  F +Y  LL S+NYVT+RQSLKLLGELLLDR+NFN M +YISN DNL+LMM LL+ + + I +EAFH FKVFVANPNKPK I  IL +N+EKL+ FLS F  DRTD  QFN+EK YLIKQI+++K
Sbjct:    1 MPLLFGKSHKSPADVVKTLREVLTILDKLPPPKLDKDGNIQSDKKYDKALDEVSKNVAMIKSFIYG---NDSA--EPSSEHVVQ--------VAQLAQEVYNANILPMLIKMLPKFEFECKKDVGQIFNNLLRRQIGTRSPTVEYLGARPEILIQLVQGYSVPDIALTCGLMLRESIRHDHLAKIILYSDVFYTFFLYVQSEVFDISSDAFSTFKELTTRHKAIIAEFLDSNYDTFFAQYQNLLNSKNYVTRRQSLKLLGELLLDRHNFNTMTKYISNPDNLRLMMELLRDKSRNIQYEAFHVFKVFVANPNKPKPISDILNRNREKLVEFLSEFHNDRTDDEQFNDEKAYLIKQIQEMK 347          
BLAST of Calcium binding protein 39 vs. Ensembl Celegans
Match: mop-25.1 (MO25 (MOuse embryo scaffolding Protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q7Z2A5])

HSP 1 Score: 278.485 bits (711), Expect = 2.239e-87
Identity = 171/363 (47.11%), Postives = 234/363 (64.46%), Query Frame = 1
Query:   67 KNLMPL-FGRT-KTPKELTQTLVECLQALN--APNKAEKDKK--------KLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK 1119
            + +MPL FG++ K+P ++ +TL E L  L+   P K +KD          K ++E+S+ ++ +K  +     N  A  E  S+ ++         + ++  E+   N L  L++ L   +FE  K V ++F  L RR  G RSP   YL     IL QL+ GY+  +IAL  G M RE+ RH+ LAK ++ S+ FY  F +VQ   FDISSDAF+T K+L TRHK ++AEFL++N+D  F +Y  LL S+NYVT+RQSLKLLGELLLDR+NFN M +YISN DNL+LMM LL+ + + I +EAFH FKVFVANPNKPK I  IL +N+EKL+ FLS F  DRTD  QFN+EK YLIKQI+++K
Sbjct:  257 RKVMPLLFGKSHKSPADVVKTLREVLTILDKLPPPKLDKDGNIQSDKKYDKALDEVSKNVAMIKSFIYG---NDSA--EPSSEHVV--------QVAQLAQEVYNANILPMLIKMLPKFEFECKKDVGQIFNNLLRRQIGTRSPTVEYLGARPEILIQLVQGYSVPDIALTCGLMLRESIRHDHLAKIILYSDVFYTFFLYVQSEVFDISSDAFSTFKELTTRHKAIIAEFLDSNYDTFFAQYQNLLNSKNYVTRRQSLKLLGELLLDRHNFNTMTKYISNPDNLRLMMELLRDKSRNIQYEAFHVFKVFVANPNKPKPISDILNRNREKLVEFLSEFHNDRTDDEQFNDEKAYLIKQIQEMK 606          
BLAST of Calcium binding protein 39 vs. Ensembl Celegans
Match: mop-25.2 (MO25-like protein 2 [Source:UniProtKB/Swiss-Prot;Acc:O18211])

HSP 1 Score: 262.307 bits (669), Expect = 9.286e-85
Identity = 157/352 (44.60%), Postives = 220/352 (62.50%), Query Frame = 1
Query:   73 LMPLFGRT-KTPKELTQTLVECLQALN--APNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK 1119
            L PLFG+  KTP ++ + L + L  ++    N +E+  +K IEE ++ L+  K  +     N+  P  +    +  E              +   N L  L++ L   +FE  K V  +F  L RR  G RSP   YL     IL  LL GY + +IAL  G+M REA RHE LA+ V+ SE+F   F  VQ   FDI++DAF+T KDL+T+HK + AE+L+ N+D  F +Y+ L  SENYVT+RQSLKLLGELLLDR+NF+ MN+YI++ +NLK +M LL+ + + I +EAFH FK+FVANPNKP+ I  IL +N++KL+ FL+ F  DRT+  QFN+EK YLIKQI++L+
Sbjct:    2 LKPLFGKADKTPADVVKNLRDALLVIDRHGTNTSERKVEKAIEETAKMLALAKTFIYGSDANE--PNNEQVTQLAQE--------------VYNANVLPMLIKHLHKFEFECKKDVASVFNNLLRRQIGTRSPTVEYLAARPEILITLLLGYEQPDIALTCGSMLREAVRHEHLARIVLYSEYFQRFFVFVQSDVFDIATDAFSTFKDLMTKHKNMCAEYLDNNYDRFFGQYSALTNSENYVTRRQSLKLLGELLLDRHNFSTMNKYITSPENLKTVMELLRDKRRNIQYEAFHVFKIFVANPNKPRPITDILTRNRDKLVEFLTAFHNDRTNDEQFNDEKAYLIKQIQELR 337          
BLAST of Calcium binding protein 39 vs. Ensembl Celegans
Match: mop-25.2 (MO25-like protein 2 [Source:UniProtKB/Swiss-Prot;Acc:O18211])

HSP 1 Score: 262.307 bits (669), Expect = 9.286e-85
Identity = 157/352 (44.60%), Postives = 220/352 (62.50%), Query Frame = 1
Query:   73 LMPLFGRT-KTPKELTQTLVECLQALN--APNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK 1119
            L PLFG+  KTP ++ + L + L  ++    N +E+  +K IEE ++ L+  K  +     N+  P  +    +  E              +   N L  L++ L   +FE  K V  +F  L RR  G RSP   YL     IL  LL GY + +IAL  G+M REA RHE LA+ V+ SE+F   F  VQ   FDI++DAF+T KDL+T+HK + AE+L+ N+D  F +Y+ L  SENYVT+RQSLKLLGELLLDR+NF+ MN+YI++ +NLK +M LL+ + + I +EAFH FK+FVANPNKP+ I  IL +N++KL+ FL+ F  DRT+  QFN+EK YLIKQI++L+
Sbjct:    2 LKPLFGKADKTPADVVKNLRDALLVIDRHGTNTSERKVEKAIEETAKMLALAKTFIYGSDANE--PNNEQVTQLAQE--------------VYNANVLPMLIKHLHKFEFECKKDVASVFNNLLRRQIGTRSPTVEYLAARPEILITLLLGYEQPDIALTCGSMLREAVRHEHLARIVLYSEYFQRFFVFVQSDVFDIATDAFSTFKDLMTKHKNMCAEYLDNNYDRFFGQYSALTNSENYVTRRQSLKLLGELLLDRHNFSTMNKYITSPENLKTVMELLRDKRRNIQYEAFHVFKIFVANPNKPRPITDILTRNRDKLVEFLTAFHNDRTNDEQFNDEKAYLIKQIQELR 337          
BLAST of Calcium binding protein 39 vs. Ensembl Celegans
Match: mop-25.3 (MO25-like protein 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9TZM2])

HSP 1 Score: 49.2914 bits (116), Expect = 3.737e-6
Identity = 28/131 (21.37%), Postives = 59/131 (45.04%), Query Frame = 1
Query:  649 FDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSN 1041
            FD+    F TL+ +   +      F++ N         +L+   N+  + +S K L EL   + N+   + +++    +KL++  ++S +  +   A    ++F+ NP     +H  + +N+  LI F  N
Sbjct:  223 FDVIQGTFDTLQIIFFTNHESANNFIKNNLPRFMQTLHKLIACSNFFIQAKSFKFLNELFTAQTNYETRSLWMAEPAFIKLVVLAIQSNKHAVRSRAVSILEIFIRNPRNSPEVHEFIGRNRNVLIAFFFN 353          
BLAST of Calcium binding protein 39 vs. Ensembl Fly
Match: Mo25 (gene:FBgn0017572 transcript:FBtr0075358)

HSP 1 Score: 291.582 bits (745), Expect = 5.535e-96
Identity = 172/353 (48.73%), Postives = 235/353 (66.57%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKS--EIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNK-YTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKP 1122
            MPLFG++ K+P EL ++L E + AL A    ++  +K  E++S+ L  +K+ML   SD      E  +D+++++ ++       +   I   +           IDFE  K V  +F  + RR  G RSP   Y+     ILF L++GY  +  EIAL+ G M RE  R+E LAK +++S+ F++ F +V+ + FDI+SDAF+T K+LLTRHK + AEFL+AN+D  F++ Y  LL SENYVT+RQSLKLLGELLLDR+NF VM RYIS  +NLKLMMN+LK + + I FEAFH FKVFVANPNKPK I  IL +NQ KL+ FL+NF TDR++  QFN+EK YLIKQI++LKP
Sbjct:    1 MPLFGKSQKSPVELVKSLKEAINALEA---GDRKVEKAQEDVSKNLVSIKNMLYGSSD-----AEPPADYVVAQLSQELYNSNLLLLLIQNLHR----------IDFEGKKHVALIFNNVLRRQIGTRSPTVEYICTKPEILFTLMAGYEDAHPEIALNSGTMLRECARYEALAKIMLHSDEFFKFFRYVEVSTFDIASDAFSTFKELLTRHKLLCAEFLDANYDKFFSQHYQRLLNSENYVTRRQSLKLLGELLLDRHNFTVMTRYISEPENLKLMMNMLKEKSRNIQFEAFHVFKVFVANPNKPKPILDILLRNQTKLVDFLTNFHTDRSEDEQFNDEKAYLIKQIKELKP 335          
BLAST of Calcium binding protein 39 vs. Ensembl Fly
Match: Mo25 (gene:FBgn0017572 transcript:FBtr0331560)

HSP 1 Score: 291.582 bits (745), Expect = 5.535e-96
Identity = 172/353 (48.73%), Postives = 235/353 (66.57%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKS--EIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNK-YTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKP 1122
            MPLFG++ K+P EL ++L E + AL A    ++  +K  E++S+ L  +K+ML   SD      E  +D+++++ ++       +   I   +           IDFE  K V  +F  + RR  G RSP   Y+     ILF L++GY  +  EIAL+ G M RE  R+E LAK +++S+ F++ F +V+ + FDI+SDAF+T K+LLTRHK + AEFL+AN+D  F++ Y  LL SENYVT+RQSLKLLGELLLDR+NF VM RYIS  +NLKLMMN+LK + + I FEAFH FKVFVANPNKPK I  IL +NQ KL+ FL+NF TDR++  QFN+EK YLIKQI++LKP
Sbjct:    1 MPLFGKSQKSPVELVKSLKEAINALEA---GDRKVEKAQEDVSKNLVSIKNMLYGSSD-----AEPPADYVVAQLSQELYNSNLLLLLIQNLHR----------IDFEGKKHVALIFNNVLRRQIGTRSPTVEYICTKPEILFTLMAGYEDAHPEIALNSGTMLRECARYEALAKIMLHSDEFFKFFRYVEVSTFDIASDAFSTFKELLTRHKLLCAEFLDANYDKFFSQHYQRLLNSENYVTRRQSLKLLGELLLDRHNFTVMTRYISEPENLKLMMNMLKEKSRNIQFEAFHVFKVFVANPNKPKPILDILLRNQTKLVDFLTNFHTDRSEDEQFNDEKAYLIKQIKELKP 335          
BLAST of Calcium binding protein 39 vs. Ensembl Zebrafish
Match: cab39l (calcium binding protein 39-like [Source:ZFIN;Acc:ZDB-GENE-041114-204])

HSP 1 Score: 312.383 bits (799), Expect = 4.284e-104
Identity = 186/353 (52.69%), Postives = 240/353 (67.99%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDL-KPAN 1128
            MPLFG++ K+P E+ +TL + L  L    K +K  +K  EE+S+CL  +K++L   +D     +E  ++ +            ++  E+  ++ L +LVE L +IDFE  K V ++F  + RR  G RSP   Y   H  +LF LL GY   ++AL+ G M RE  RHE LAK V++SEHF + F++V+ + FDI+SDAF T KDLLTRHK +VAEFLE N+D +F+ Y +LL SENYVTKRQSLKLLGELLLDR+NF VM RYIS  +NLKLMMNLL+ +   I FEAFH FKVFVANPNK + I  IL +NQ KLI FLSNFQ DRTD  QFN+EK YL+KQIRDL KPA+
Sbjct:    1 MPLFGKSHKSPTEIVKTLKDNLSILV---KQDKKTEKASEEVSKCLVAMKEILYGTND-----KEPHTETV-----------AQLAQELYNSSLLISLVENLQVIDFEGKKDVCQIFNNILRRQIGTRSPTVEYFCSHQEVLFILLKGYETPQVALNCGIMLRECIRHEPLAKIVLHSEHFKDFFSYVEMSTFDIASDAFATFKDLLTRHKALVAEFLEQNYDAVFDNYEKLLHSENYVTKRQSLKLLGELLLDRHNFTVMTRYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVANPNKTQPIVDILLKNQTKLIDFLSNFQKDRTDDEQFNDEKTYLVKQIRDLKKPAS 334          
BLAST of Calcium binding protein 39 vs. Ensembl Zebrafish
Match: cab39l1 (calcium binding protein 39, like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2897])

HSP 1 Score: 290.041 bits (741), Expect = 3.566e-95
Identity = 178/357 (49.86%), Postives = 236/357 (66.11%), Query Frame = 1
Query:   76 MPL-FGRT-KTPKELTQTLVECLQALNAPNKAEKDK-KKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK-PANAQ 1134
            MP  FG++ K+P E+ ++L E +  L     +E  K +K+ EE+S+ LS LK++L    D     +E  ++ +            ++  E+   N L +L+  L  IDFE  K VV LF  + RR  G R+P   Y+  H+ ILF LL GY  SE+AL+ G M RE  RH+ LA+ V+ SE FY  F +V+ + FDI+SDAF + KDLLTRHK + A+FLE N+D +F +Y +LL SENYVTKRQSLKLLGELLLDR+NF VM +YIS  +NLKLMMN+L+   + I FEAFH FKVFVANPNK + +  IL +NQ KL+ FLS+FQTDR++  QF +EK YLIKQIRDLK PA A+
Sbjct:    1 MPFPFGKSQKSPAEIVKSLKENVAYLEKLESSESKKCEKVAEEVSKNLSSLKEVLCGTGD-----KEPQTEAV-----------AQLAQELYNTNLLISLIANLQRIDFEGKKDVVHLFSNIVRRQIGARTPTVEYISSHSQILFMLLKGYETSEVALNCGMMLRECLRHDPLARIVLFSEDFYCFFRYVEMSTFDIASDAFASFKDLLTRHKIMCADFLETNYDRVFTEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTVMTKYISRAENLKLMMNMLRDNSRNIQFEAFHVFKVFVANPNKTQPVLDILLKNQSKLVEFLSHFQTDRSEDEQFCDEKNYLIKQIRDLKRPAPAE 341          
BLAST of Calcium binding protein 39 vs. Ensembl Zebrafish
Match: cab39l1 (calcium binding protein 39, like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2897])

HSP 1 Score: 290.041 bits (741), Expect = 3.566e-95
Identity = 178/357 (49.86%), Postives = 236/357 (66.11%), Query Frame = 1
Query:   76 MPL-FGRT-KTPKELTQTLVECLQALNAPNKAEKDK-KKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK-PANAQ 1134
            MP  FG++ K+P E+ ++L E +  L     +E  K +K+ EE+S+ LS LK++L    D     +E  ++ +            ++  E+   N L +L+  L  IDFE  K VV LF  + RR  G R+P   Y+  H+ ILF LL GY  SE+AL+ G M RE  RH+ LA+ V+ SE FY  F +V+ + FDI+SDAF + KDLLTRHK + A+FLE N+D +F +Y +LL SENYVTKRQSLKLLGELLLDR+NF VM +YIS  +NLKLMMN+L+   + I FEAFH FKVFVANPNK + +  IL +NQ KL+ FLS+FQTDR++  QF +EK YLIKQIRDLK PA A+
Sbjct:    1 MPFPFGKSQKSPAEIVKSLKENVAYLEKLESSESKKCEKVAEEVSKNLSSLKEVLCGTGD-----KEPQTEAV-----------AQLAQELYNTNLLISLIANLQRIDFEGKKDVVHLFSNIVRRQIGARTPTVEYISSHSQILFMLLKGYETSEVALNCGMMLRECLRHDPLARIVLFSEDFYCFFRYVEMSTFDIASDAFASFKDLLTRHKIMCADFLETNYDRVFTEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTVMTKYISRAENLKLMMNMLRDNSRNIQFEAFHVFKVFVANPNKTQPVLDILLKNQSKLVEFLSHFQTDRSEDEQFCDEKNYLIKQIRDLKRPAPAE 341          
BLAST of Calcium binding protein 39 vs. Ensembl Zebrafish
Match: cab39l1 (calcium binding protein 39, like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2897])

HSP 1 Score: 290.041 bits (741), Expect = 3.566e-95
Identity = 178/357 (49.86%), Postives = 236/357 (66.11%), Query Frame = 1
Query:   76 MPL-FGRT-KTPKELTQTLVECLQALNAPNKAEKDK-KKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK-PANAQ 1134
            MP  FG++ K+P E+ ++L E +  L     +E  K +K+ EE+S+ LS LK++L    D     +E  ++ +            ++  E+   N L +L+  L  IDFE  K VV LF  + RR  G R+P   Y+  H+ ILF LL GY  SE+AL+ G M RE  RH+ LA+ V+ SE FY  F +V+ + FDI+SDAF + KDLLTRHK + A+FLE N+D +F +Y +LL SENYVTKRQSLKLLGELLLDR+NF VM +YIS  +NLKLMMN+L+   + I FEAFH FKVFVANPNK + +  IL +NQ KL+ FLS+FQTDR++  QF +EK YLIKQIRDLK PA A+
Sbjct:    1 MPFPFGKSQKSPAEIVKSLKENVAYLEKLESSESKKCEKVAEEVSKNLSSLKEVLCGTGD-----KEPQTEAV-----------AQLAQELYNTNLLISLIANLQRIDFEGKKDVVHLFSNIVRRQIGARTPTVEYISSHSQILFMLLKGYETSEVALNCGMMLRECLRHDPLARIVLFSEDFYCFFRYVEMSTFDIASDAFASFKDLLTRHKIMCADFLETNYDRVFTEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTVMTKYISRAENLKLMMNMLRDNSRNIQFEAFHVFKVFVANPNKTQPVLDILLKNQSKLVEFLSHFQTDRSEDEQFCDEKNYLIKQIRDLKRPAPAE 341          
BLAST of Calcium binding protein 39 vs. Ensembl Zebrafish
Match: cab39 (calcium binding protein 39 [Source:ZFIN;Acc:ZDB-GENE-040625-158])

HSP 1 Score: 280.411 bits (716), Expect = 1.832e-91
Identity = 168/353 (47.59%), Postives = 220/353 (62.32%), Query Frame = 1
Query:   79 PLFGRTKTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPANAQN 1137
            P     K P ++ + L + +  L   + ++K  +K  EE+S+ L  +K++L     N+  P+ +    +  E              +  +  L  LV  L +IDFE  K V ++F  + RR  G R+P   YL    +ILF LL GY   +IAL+ G M RE  RHE LAK  + SE FY+ F +V+ + FDI+SDAF T KDLLTRHK + AEFLE ++D  F++Y +LL SENYVTKRQSLKLLGELLLDR+NF +M +YIS  +NLKLMMNLL+ + + I FEAFH FKVFVANPNK   I  IL +NQ KLI FLS FQ DR +  QF++EK YLIKQIRDLK    Q+
Sbjct:    4 PFVKSHKCPADIVKNLKDNMTILEKQDISDKKAEKASEEVSKSLLSMKEILY--GTNEKEPQTEAVAQLAQE--------------LYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYLCTQQNILFMLLKGYESPDIALNCGIMLRECIRHEPLAKITLCSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKVLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTPPILDILLKNQTKLIEFLSKFQNDRAEDEQFSDEKTYLIKQIRDLKRPTPQD 340          
BLAST of Calcium binding protein 39 vs. Ensembl Xenopus
Match: smpdl3b (sphingomyelin phosphodiesterase acid-like 3B [Source:Xenbase;Acc:XB-GENE-993034])

HSP 1 Score: 315.849 bits (808), Expect = 3.117e-105
Identity = 175/349 (50.14%), Postives = 225/349 (64.47%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK 1119
            MPLF ++ K P E+ +TL + +  L    + +K  +K  EE+S+ L   K++L    D +  P+ +    +  E              +  +  L  L+  L +IDFE  K V ++F  + RR  G RSP   Y+  H  ILF LL GY   ++ALH G M RE  RHE LAK +I SE F + F +V+ + FDI+SDAF T KDLLTRHK +VAEFLE N+D +FN Y +LL SENYVTKRQSLKLLGEL+LDR+NF++M +YIS  +NLKLMMNLL+ +   I FEAFH FKVFVANPNK + I  IL +NQ KLI FLS+FQ +RTD  QF +EK YLIKQIRDLK
Sbjct:    4 MPLFSKSHKNPAEIVKTLKDNMAVLE---RQDKKTEKASEEVSKSLQATKEILCGTGDKE--PQTETVAQLAQE--------------LYNSGLLVTLIANLHLIDFEGKKDVSQIFNNILRRQIGTRSPTVEYISSHQHILFILLKGYESPQVALHCGIMLRECVRHEPLAKVIIYSEQFGDFFKYVEMSTFDIASDAFATFKDLLTRHKLMVAEFLEQNYDRIFNDYEKLLHSENYVTKRQSLKLLGELILDRHNFSIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVANPNKTQPIVDILLKNQTKLIEFLSSFQKERTDDEQFTDEKNYLIKQIRDLK 333          
BLAST of Calcium binding protein 39 vs. Ensembl Xenopus
Match: crtap (cartilage associated protein [Source:Xenbase;Acc:XB-GENE-1009954])

HSP 1 Score: 289.271 bits (739), Expect = 9.435e-95
Identity = 173/353 (49.01%), Postives = 229/353 (64.87%), Query Frame = 1
Query:   76 MPL-FGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK-PA 1125
            MP  FG++ K+P ++ + L E +  L   + ++K  +K  EE+S+ L  +K++L     N+  P+ +    +  E              +  +  L  LV  L +IDFE  K V ++F  + RR  G R+P   Y+    +ILF LL GY   EIAL+ G M RE  RHE LAK ++ SE FY+ F +V+ + FDI+SDAF T KDLLTRHK + AEFLE ++D  F++Y +LL SENYVTKRQSLKLLGELLLDR+NF +M +YIS  +NLKLMMNLL+ + + I FEAFH FKVFVANPNK + +  IL +NQ KLI FLS FQ DRT+  QFN+EK YL+KQIRDLK PA
Sbjct:    1 MPFPFGKSHKSPADIVKNLKESIAVLEKQDISDKKAEKATEEVSKNLVAMKEILY--GTNEKEPQTEAVAQLAQE--------------LYNSGLLGTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEPFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPVLDILLKNQSKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPA 337          
BLAST of Calcium binding protein 39 vs. Ensembl Xenopus
Match: crtap (cartilage associated protein [Source:Xenbase;Acc:XB-GENE-1009954])

HSP 1 Score: 286.574 bits (732), Expect = 7.898e-94
Identity = 169/344 (49.13%), Postives = 223/344 (64.83%), Query Frame = 1
Query:   97 KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK-PA 1125
            K+P ++ + L E +  L   + ++K  +K  EE+S+ L  +K++L     N+  P+ +    +  E              +  +  L  LV  L +IDFE  K V ++F  + RR  G R+P   Y+    +ILF LL GY   EIAL+ G M RE  RHE LAK ++ SE FY+ F +V+ + FDI+SDAF T KDLLTRHK + AEFLE ++D  F++Y +LL SENYVTKRQSLKLLGELLLDR+NF +M +YIS  +NLKLMMNLL+ + + I FEAFH FKVFVANPNK + +  IL +NQ KLI FLS FQ DRT+  QFN+EK YL+KQIRDLK PA
Sbjct:    7 KSPADIVKNLKESIAVLEKQDISDKKAEKATEEVSKNLVAMKEILY--GTNEKEPQTEAVAQLAQE--------------LYNSGLLGTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEPFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPVLDILLKNQSKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPA 334          
BLAST of Calcium binding protein 39 vs. Ensembl Xenopus
Match: crtap (cartilage associated protein [Source:Xenbase;Acc:XB-GENE-1009954])

HSP 1 Score: 280.411 bits (716), Expect = 2.668e-90
Identity = 151/254 (59.45%), Postives = 185/254 (72.83%), Query Frame = 1
Query:  367 VEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK-PA 1125
            V  L +IDFE  K V ++F  + RR  G R+P   Y+    +ILF LL GY   EIAL+ G M RE  RHE LAK ++ SE FY+ F +V+ + FDI+SDAF T KDLLTRHK + AEFLE ++D  F++Y +LL SENYVTKRQSLKLLGELLLDR+NF +M +YIS  +NLKLMMNLL+ + + I FEAFH FKVFVANPNK + +  IL +NQ KLI FLS FQ DRT+  QFN+EK YL+KQIRDLK PA
Sbjct:  157 VADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEPFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPVLDILLKNQSKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPA 410          
BLAST of Calcium binding protein 39 vs. Ensembl Mouse
Match: Cab39l (calcium binding protein 39-like [Source:MGI Symbol;Acc:MGI:1914081])

HSP 1 Score: 305.064 bits (780), Expect = 4.408e-101
Identity = 173/351 (49.29%), Postives = 221/351 (62.96%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPA 1125
            MPLF ++ K P E+ + L + L  L    K +K   K  EE+S+ L  +K++L   +D K  P E  +                   E+  +  L  L+  L +IDFE  K V ++F  + RR  G R P   Y+  H  ILF LL GY   +IAL  G M RE  RHE LAK ++ S  F + F +V+ + FDI+SDAF T KDLLTRHK +VA+FLE N+D +F  Y +LLQSENYVTKRQSLKLLGEL+LDR+NF +M +YIS  +NLKLMMNLL+ +   I FEAFH FKVFVA+P+K + I  IL +NQ KLI FLS+FQ +RTD  QF +EK YLIKQIRDLK A
Sbjct:    4 MPLFSKSHKNPAEIVKILKDNLAILE---KQDKKTDKASEEVSKSLQAMKEILCGTND-KEPPTEAVAQL---------------AQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRCPTVEYISSHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRHNFTIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKA 335          
BLAST of Calcium binding protein 39 vs. Ensembl Mouse
Match: Cab39 (calcium binding protein 39 [Source:MGI Symbol;Acc:MGI:107438])

HSP 1 Score: 291.967 bits (746), Expect = 5.137e-96
Identity = 174/355 (49.01%), Postives = 229/355 (64.51%), Query Frame = 1
Query:   76 MPL-FGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPANAQ 1134
            MP  FG++ K+P ++ + L E +  L   + ++K  +K  EE+S+ L  +K++L     N+  P+ +    +  E              +  +  L  LV  L +IDFE  K V ++F  + RR  G R+P   Y+    +ILF LL GY   EIAL+ G M RE  RHE LAK ++ SE FY+ F +V+ + FDI+SDAF T KDLLTRHK + AEFLE ++D  F++Y +LL SENYVTKRQSLKLLGELLLDR+NF +M +YIS  +NLKLMMNLL+ + + I FEAFH FKVFVANPNK + I  IL +NQ KLI FLS FQ DRT+  QFN+EK YL+KQIRDLK A  Q
Sbjct:    1 MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILY--GTNEKEPQTEAVAQLAQE--------------LYNSGLLGTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQTKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRAAQQ 339          
BLAST of Calcium binding protein 39 vs. Ensembl Mouse
Match: Cab39 (calcium binding protein 39 [Source:MGI Symbol;Acc:MGI:107438])

HSP 1 Score: 291.967 bits (746), Expect = 5.137e-96
Identity = 174/355 (49.01%), Postives = 229/355 (64.51%), Query Frame = 1
Query:   76 MPL-FGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPANAQ 1134
            MP  FG++ K+P ++ + L E +  L   + ++K  +K  EE+S+ L  +K++L     N+  P+ +    +  E              +  +  L  LV  L +IDFE  K V ++F  + RR  G R+P   Y+    +ILF LL GY   EIAL+ G M RE  RHE LAK ++ SE FY+ F +V+ + FDI+SDAF T KDLLTRHK + AEFLE ++D  F++Y +LL SENYVTKRQSLKLLGELLLDR+NF +M +YIS  +NLKLMMNLL+ + + I FEAFH FKVFVANPNK + I  IL +NQ KLI FLS FQ DRT+  QFN+EK YL+KQIRDLK A  Q
Sbjct:    1 MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILY--GTNEKEPQTEAVAQLAQE--------------LYNSGLLGTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQTKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRAAQQ 339          
BLAST of Calcium binding protein 39 vs. Ensembl Mouse
Match: Cab39l (calcium binding protein 39-like [Source:MGI Symbol;Acc:MGI:1914081])

HSP 1 Score: 240.736 bits (613), Expect = 1.554e-76
Identity = 139/301 (46.18%), Postives = 181/301 (60.13%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFK--VFVAN 969
            MPLF ++ K P E+ + L + L  L    K +K   K  EE+S+ L  +K++L   +D K  P E  +                   E+  +  L  L+  L +IDFE  K V ++F  + RR  G R P   Y+  H  ILF LL GY   +IAL  G M RE  RHE LAK ++ S  F + F +V+ + FDI+SDAF T KDLLTRHK +VA+FLE N+D +F  Y +LLQSENYVTKRQSLKLLGEL+LDR+NF +M +YIS  +NLKLMMNLL+ +   I FEAFH FK  VF+ N
Sbjct:    4 MPLFSKSHKNPAEIVKILKDNLAILE---KQDKKTDKASEEVSKSLQAMKEILCGTND-KEPPTEAVAQL---------------AQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRCPTVEYISSHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRHNFTIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKNSVFITN 285          
BLAST of Calcium binding protein 39 vs. UniProt/SwissProt
Match: sp|Q9H9S4|CB39L_HUMAN (Calcium-binding protein 39-like OS=Homo sapiens OX=9606 GN=CAB39L PE=1 SV=3)

HSP 1 Score: 305.064 bits (780), Expect = 2.889e-100
Identity = 172/349 (49.28%), Postives = 221/349 (63.32%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK 1119
            MPLF ++ K P E+ + L + L  L    K +K   K  EE+S+ L  +K++L   ++ K  P E  +                   E+  +  L  L+  L +IDFE  K V ++F  + RR  G RSP   Y+  H  ILF LL GY   +IAL  G M RE  RHE LAK ++ S  F + F +V+ + FDI+SDAF T KDLLTRHK +VA+FLE N+D +F  Y +LLQSENYVTKRQSLKLLGEL+LDR+NF +M +YIS  +NLKLMMNLL+ +   I FEAFH FKVFVA+P+K + I  IL +NQ KLI FLS+FQ +RTD  QF +EK YLIKQIRDLK
Sbjct:    4 MPLFSKSHKNPAEIVKILKDNLAILE---KQDKKTDKASEEVSKSLQAMKEILCG-TNEKEPPTEAVAQL---------------AQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLK 333          
BLAST of Calcium binding protein 39 vs. UniProt/SwissProt
Match: sp|Q9DB16|CB39L_MOUSE (Calcium-binding protein 39-like OS=Mus musculus OX=10090 GN=Cab39l PE=1 SV=3)

HSP 1 Score: 305.064 bits (780), Expect = 3.083e-100
Identity = 173/351 (49.29%), Postives = 221/351 (62.96%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPA 1125
            MPLF ++ K P E+ + L + L  L    K +K   K  EE+S+ L  +K++L   +D K  P E  +                   E+  +  L  L+  L +IDFE  K V ++F  + RR  G R P   Y+  H  ILF LL GY   +IAL  G M RE  RHE LAK ++ S  F + F +V+ + FDI+SDAF T KDLLTRHK +VA+FLE N+D +F  Y +LLQSENYVTKRQSLKLLGEL+LDR+NF +M +YIS  +NLKLMMNLL+ +   I FEAFH FKVFVA+P+K + I  IL +NQ KLI FLS+FQ +RTD  QF +EK YLIKQIRDLK A
Sbjct:    4 MPLFSKSHKNPAEIVKILKDNLAILE---KQDKKTDKASEEVSKSLQAMKEILCGTND-KEPPTEAVAQL---------------AQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRCPTVEYISSHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRHNFTIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKA 335          
BLAST of Calcium binding protein 39 vs. UniProt/SwissProt
Match: sp|Q06138|CAB39_MOUSE (Calcium-binding protein 39 OS=Mus musculus OX=10090 GN=Cab39 PE=1 SV=2)

HSP 1 Score: 291.967 bits (746), Expect = 3.593e-95
Identity = 174/355 (49.01%), Postives = 229/355 (64.51%), Query Frame = 1
Query:   76 MPL-FGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPANAQ 1134
            MP  FG++ K+P ++ + L E +  L   + ++K  +K  EE+S+ L  +K++L     N+  P+ +    +  E              +  +  L  LV  L +IDFE  K V ++F  + RR  G R+P   Y+    +ILF LL GY   EIAL+ G M RE  RHE LAK ++ SE FY+ F +V+ + FDI+SDAF T KDLLTRHK + AEFLE ++D  F++Y +LL SENYVTKRQSLKLLGELLLDR+NF +M +YIS  +NLKLMMNLL+ + + I FEAFH FKVFVANPNK + I  IL +NQ KLI FLS FQ DRT+  QFN+EK YL+KQIRDLK A  Q
Sbjct:    1 MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILY--GTNEKEPQTEAVAQLAQE--------------LYNSGLLGTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQTKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRAAQQ 339          
BLAST of Calcium binding protein 39 vs. UniProt/SwissProt
Match: sp|P91891|MO25_DROME (Protein Mo25 OS=Drosophila melanogaster OX=7227 GN=Mo25 PE=2 SV=2)

HSP 1 Score: 291.582 bits (745), Expect = 5.548e-95
Identity = 172/353 (48.73%), Postives = 235/353 (66.57%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKS--EIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNK-YTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKP 1122
            MPLFG++ K+P EL ++L E + AL A    ++  +K  E++S+ L  +K+ML   SD      E  +D+++++ ++       +   I   +           IDFE  K V  +F  + RR  G RSP   Y+     ILF L++GY  +  EIAL+ G M RE  R+E LAK +++S+ F++ F +V+ + FDI+SDAF+T K+LLTRHK + AEFL+AN+D  F++ Y  LL SENYVT+RQSLKLLGELLLDR+NF VM RYIS  +NLKLMMN+LK + + I FEAFH FKVFVANPNKPK I  IL +NQ KL+ FL+NF TDR++  QFN+EK YLIKQI++LKP
Sbjct:    1 MPLFGKSQKSPVELVKSLKEAINALEA---GDRKVEKAQEDVSKNLVSIKNMLYGSSD-----AEPPADYVVAQLSQELYNSNLLLLLIQNLHR----------IDFEGKKHVALIFNNVLRRQIGTRSPTVEYICTKPEILFTLMAGYEDAHPEIALNSGTMLRECARYEALAKIMLHSDEFFKFFRYVEVSTFDIASDAFSTFKELLTRHKLLCAEFLDANYDKFFSQHYQRLLNSENYVTRRQSLKLLGELLLDRHNFTVMTRYISEPENLKLMMNMLKEKSRNIQFEAFHVFKVFVANPNKPKPILDILLRNQTKLVDFLTNFHTDRSEDEQFNDEKAYLIKQIKELKP 335          
BLAST of Calcium binding protein 39 vs. UniProt/SwissProt
Match: sp|Q9Y376|CAB39_HUMAN (Calcium-binding protein 39 OS=Homo sapiens OX=9606 GN=CAB39 PE=1 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 1.006e-94
Identity = 174/353 (49.29%), Postives = 229/353 (64.87%), Query Frame = 1
Query:   76 MPL-FGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK-PA 1125
            MP  FG++ K+P ++ + L E +  L   + ++K  +K  EE+S+ L  +K++L     N+  P+ +    +  E              +  +  L  LV  L +IDFE  K V ++F  + RR  G R+P   Y+    +ILF LL GY   EIAL+ G M RE  RHE LAK ++ SE FY+ F +V+ + FDI+SDAF T KDLLTRHK + AEFLE ++D  F++Y +LL SENYVTKRQSLKLLGELLLDR+NF +M +YIS  +NLKLMMNLL+ + + I FEAFH FKVFVANPNK + I  IL +NQ KLI FLS FQ DRT+  QFN+EK YL+KQIRDLK PA
Sbjct:    1 MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILY--GTNEKEPQTEAVAQLAQE--------------LYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPA 337          
BLAST of Calcium binding protein 39 vs. TrEMBL
Match: G4VB16 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_007170 PE=4 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 2.525e-129
Identity = 205/355 (57.75%), Postives = 279/355 (78.59%), Query Frame = 1
Query:   76 MPLFGRTKTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPANAQNN 1140
            MPLFG+ K+P+EL QT+ E +  L+   K +K++KK +E+I+R L+ L+++L D+SD +   +E+DS+   SERARINEI+ ++T+EI+  N L  LV  LD+I+FES K +V+LFG + RR  G+ +P + YL  ++ IL  +L GY+K + A+HYGAM R+A RHE LAK V+ S  FY+LF HVQGTAFD+SSDAF TLKDLLTRHK +VA+FL AN+D  F+ Y  ++ S+NYVTKRQ+LKLLGELLLDR+N ++M +YI++ +NLK++MN+LKS+EKQI+FEAFHCFKVFVANPNKP  +H IL++NQEKL+ FL++FQT+RTD  QFN+EKQYLIKQIR+LKP    +N
Sbjct:    1 MPLFGKPKSPRELIQTVNENIIILSNCAKTDKERKKAVEDIARALTALRELLTDKSDTRLTGKERDSELSNSERARINEIITDVTHEIINLNLLPLLVNNLDVIEFESSKHIVDLFGHIMRRQVGSYNPAAQYLLANSQILISILQGYSKPDTAIHYGAMLRDACRHESLAKVVLRSPEFYQLFEHVQGTAFDVSSDAFATLKDLLTRHKALVADFLTANYDVFFDHYMHMILSDNYVTKRQALKLLGELLLDRHNISIMTKYIADPENLKVIMNMLKSKEKQIAFEAFHCFKVFVANPNKPPAVHMILFRNQEKLLSFLTDFQTERTDDGQFNDEKQYLIKQIRELKPVPISSN 355          
BLAST of Calcium binding protein 39 vs. TrEMBL
Match: A0A4Z2DXA1 (Calcium-binding protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_002943 PE=4 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 5.420e-129
Identity = 203/355 (57.18%), Postives = 279/355 (78.59%), Query Frame = 1
Query:   76 MPLFGRTKTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPANAQNN 1140
            MPLFG+ K+P+EL QT+ E +  L++ +K +K++KK +E+++R L+ L+++L D+SD +   +E+DS+   SERARINEI+ ++T+EI+  N L  LV  LD I+FES K +V+LFG + RR  G+ +P + YL  ++ IL  LL GY+K + A+HYGAM R+A RHE LAK V+ S  FY+LF HVQGTAFD+SSDAF TLKDLLTRHK +VA+FL AN+D  F+ Y  ++ S+NYVTKRQ+LKLLGELLLDR+N ++M +YI++ +NLK++MN+LKS+EKQI+FEAFHCFKVFVANPNKP  +H IL++N+EKL+ FL++FQT+RTD  QFN+EKQYLIKQIR+LK     +N
Sbjct:    1 MPLFGKPKSPRELIQTVSENIIILSSSSKTDKERKKAVEDVARSLTALRELLTDKSDTRLTGKERDSELSNSERARINEIITDVTHEIINLNLLPLLVNNLDAIEFESSKHIVDLFGHIMRRQVGSYNPAAQYLLANSQILISLLQGYSKPDTAMHYGAMLRDACRHEALAKVVLRSSEFYQLFDHVQGTAFDVSSDAFATLKDLLTRHKALVADFLTANYDVFFDHYMHMILSDNYVTKRQALKLLGELLLDRHNISIMTKYIADPENLKVIMNMLKSKEKQIAFEAFHCFKVFVANPNKPPTVHMILFRNKEKLLSFLTDFQTERTDDGQFNDEKQYLIKQIRELKSLPVSSN 355          
BLAST of Calcium binding protein 39 vs. TrEMBL
Match: A0A430QDJ3 (Calcium binding protein 39 OS=Schistosoma bovis OX=6184 GN=DC041_0002900 PE=4 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 9.338e-129
Identity = 205/355 (57.75%), Postives = 278/355 (78.31%), Query Frame = 1
Query:   76 MPLFGRTKTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPANAQNN 1140
            MPLFG+ K+P+EL QT+ E +  L+   K +K++KK +E+I+R L+ L+++L D+SD +   +E+DS+   SERARINEI+ ++T+EI+  N L  LV  LD I+FES K +V+LFG + RR  G+ +P + YL  ++ IL  +L GY+K + A+HYGAM R+A RHE LAK V+ S  FY+LF HVQGTAFD+SSDAF TLKDLLTRHK +VA+FL AN+D  F+ Y  ++ S+NYVTKRQ+LKLLGELLLDR+N ++M +YI++ +NLK++MN+LKS+EKQI+FEAFHCFKVFVANPNKP  +H IL++NQEKL+ FL++FQT+RTD  QFN+EKQYLIKQIR+LKP    +N
Sbjct:    1 MPLFGKPKSPRELIQTVNENIIILSNCAKTDKERKKAVEDIARALTALRELLTDKSDTRLTGKERDSELSNSERARINEIITDVTHEIINLNLLPLLVNNLDAIEFESSKHIVDLFGHIMRRQVGSYNPAAQYLLANSQILISILQGYSKPDTAIHYGAMLRDACRHESLAKVVLRSPEFYQLFEHVQGTAFDVSSDAFATLKDLLTRHKALVADFLSANYDVFFDHYMHMILSDNYVTKRQALKLLGELLLDRHNISIMTKYIADPENLKVIMNMLKSKEKQIAFEAFHCFKVFVANPNKPPAVHMILFRNQEKLLSFLTDFQTERTDDGQFNDEKQYLIKQIRELKPVPISSN 355          
BLAST of Calcium binding protein 39 vs. TrEMBL
Match: A0A183LNA3 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS5278 PE=4 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 9.338e-129
Identity = 205/355 (57.75%), Postives = 278/355 (78.31%), Query Frame = 1
Query:   76 MPLFGRTKTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPANAQNN 1140
            MPLFG+ K+P+EL QT+ E +  L+   K +K++KK +E+I+R L+ L+++L D+SD +   +E+DS+   SERARINEI+ ++T+EI+  N L  LV  LD I+FES K +V+LFG + RR  G+ +P + YL  ++ IL  +L GY+K + A+HYGAM R+A RHE LAK V+ S  FY+LF HVQGTAFD+SSDAF TLKDLLTRHK +VA+FL AN+D  F+ Y  ++ S+NYVTKRQ+LKLLGELLLDR+N ++M +YI++ +NLK++MN+LKS+EKQI+FEAFHCFKVFVANPNKP  +H IL++NQEKL+ FL++FQT+RTD  QFN+EKQYLIKQIR+LKP    +N
Sbjct:    1 MPLFGKPKSPRELIQTVNENIIILSNCAKTDKERKKAVEDIARALTALRELLTDKSDTRLTGKERDSELSNSERARINEIITDVTHEIINLNLLPLLVNNLDAIEFESSKHIVDLFGHIMRRQVGSYNPAAQYLLANSQILISILQGYSKPDTAIHYGAMLRDACRHESLAKVVLRSPEFYQLFEHVQGTAFDVSSDAFATLKDLLTRHKALVADFLSANYDVFFDHYMHMILSDNYVTKRQALKLLGELLLDRHNISIMTKYIADPENLKVIMNMLKSKEKQIAFEAFHCFKVFVANPNKPPAVHMILFRNQEKLLSFLTDFQTERTDDGQFNDEKQYLIKQIRELKPVPISSN 355          
BLAST of Calcium binding protein 39 vs. TrEMBL
Match: C1L4C9 (Calcium binding protein 39 OS=Schistosoma japonicum OX=6182 GN=Mo25 PE=2 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 2.412e-128
Identity = 202/355 (56.90%), Postives = 278/355 (78.31%), Query Frame = 1
Query:   76 MPLFGRTKTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPANAQNN 1140
            MPLFG+ K+P+EL QT+ E +  L++ +K +K++KK +E+++R L+ L+++L D+SD +   +E+DS+   SERARINEI+ ++T+EI+  N L  LV  LD I+FES K +V+LFG + RR  G+ +P + YL  ++ IL  LL GY+K +  +HYGAM R+A RHE LAK V+ S  FY+LF HVQGTAFD+SSDAF TLKDLLTRHK +VA+FL AN+D  F+ Y  ++ S+NYVTKRQ+LKLLGELLLDR+N ++M +YI++ +NLK++MN+LKS+EKQI+FEAFHCFKVFVANPNKP  +H IL++N+EKL+ FL++FQT+RTD  QFN+EKQYLIKQIR+LK     +N
Sbjct:    1 MPLFGKPKSPRELIQTVSENIIILSSSSKTDKERKKAVEDVARSLTALRELLTDKSDTRLTGKERDSELSNSERARINEIITDVTHEIINLNLLPLLVNNLDAIEFESSKHIVDLFGHIMRRQVGSYNPAAQYLLANSQILISLLQGYSKPDTVMHYGAMLRDACRHEALAKVVLRSSEFYQLFDHVQGTAFDVSSDAFATLKDLLTRHKALVADFLTANYDVFFDHYMHMILSDNYVTKRQALKLLGELLLDRHNISIMTKYIADPENLKVIMNMLKSKEKQIAFEAFHCFKVFVANPNKPPTVHMILFRNKEKLLSFLTDFQTERTDDGQFNDEKQYLIKQIRELKSLPVSSN 355          
BLAST of Calcium binding protein 39 vs. Ensembl Cavefish
Match: cab39l (calcium binding protein 39 like [Source:NCBI gene;Acc:103044326])

HSP 1 Score: 307.375 bits (786), Expect = 3.285e-102
Identity = 183/353 (51.84%), Postives = 235/353 (66.57%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDL-KPAN 1128
            MPLFG++ K+P ++ + L + L  L    K +K  +K  EE+S+CL  +K++L   +D +  P  +    +  E              +  +  L +LVE L +IDFE  K V ++F  + RR  G RSP   Y   H  +LF LL GY  +++AL+ G M RE  RHE LAK +++SEHF + F++V+ + FDI+SDAF T KDLLTRHK +VAE+LE N+D +F  Y +LL SENYVTKRQSLKLLGELLLDR+NF VM RYIS  +NLKLMMNLL+ +   I FEAFH FKVFVANPNK + I  IL +NQ KLI FLSNFQ DRTD  QFN+EK YLIKQIRDL KPA+
Sbjct:    1 MPLFGKSHKSPTDIVKALKDNLSILV---KQDKKTEKASEEVSKCLVAMKEILYGTNDKE--PHTETVAQLAQE--------------LYNSGLLISLVENLQVIDFEGKKDVCQIFNNILRRQIGTRSPTVEYFCSHQEVLFILLKGYETAQVALNCGIMLRECIRHEPLAKIILHSEHFNDFFSYVEMSTFDIASDAFATFKDLLTRHKVLVAEYLEQNYDAVFENYEKLLHSENYVTKRQSLKLLGELLLDRHNFTVMTRYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVANPNKTQPIVDILLKNQTKLIDFLSNFQKDRTDDEQFNDEKTYLIKQIRDLKKPAS 334          
BLAST of Calcium binding protein 39 vs. Ensembl Cavefish
Match: cab39l (calcium binding protein 39 like [Source:NCBI gene;Acc:103044326])

HSP 1 Score: 307.375 bits (786), Expect = 3.285e-102
Identity = 183/353 (51.84%), Postives = 235/353 (66.57%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDL-KPAN 1128
            MPLFG++ K+P ++ + L + L  L    K +K  +K  EE+S+CL  +K++L   +D +  P  +    +  E              +  +  L +LVE L +IDFE  K V ++F  + RR  G RSP   Y   H  +LF LL GY  +++AL+ G M RE  RHE LAK +++SEHF + F++V+ + FDI+SDAF T KDLLTRHK +VAE+LE N+D +F  Y +LL SENYVTKRQSLKLLGELLLDR+NF VM RYIS  +NLKLMMNLL+ +   I FEAFH FKVFVANPNK + I  IL +NQ KLI FLSNFQ DRTD  QFN+EK YLIKQIRDL KPA+
Sbjct:    1 MPLFGKSHKSPTDIVKALKDNLSILV---KQDKKTEKASEEVSKCLVAMKEILYGTNDKE--PHTETVAQLAQE--------------LYNSGLLISLVENLQVIDFEGKKDVCQIFNNILRRQIGTRSPTVEYFCSHQEVLFILLKGYETAQVALNCGIMLRECIRHEPLAKIILHSEHFNDFFSYVEMSTFDIASDAFATFKDLLTRHKVLVAEYLEQNYDAVFENYEKLLHSENYVTKRQSLKLLGELLLDRHNFTVMTRYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVANPNKTQPIVDILLKNQTKLIDFLSNFQKDRTDDEQFNDEKTYLIKQIRDLKKPAS 334          
BLAST of Calcium binding protein 39 vs. Ensembl Cavefish
Match: cab39l1 (calcium-binding protein 39-like [Source:NCBI gene;Acc:103025953])

HSP 1 Score: 284.263 bits (726), Expect = 5.180e-93
Identity = 174/359 (48.47%), Postives = 234/359 (65.18%), Query Frame = 1
Query:   76 MPL-FGRT-KTPKELTQTL---VECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK-PANAQ 1134
            MP  FG++ K P E+ + L   V CL+ L A +   K  +K+ EE+S+ L+ LK++L    D     +E  ++ +            ++  E+   N   +L+  L  +DFE  K VV LF  + RR  G+R+P   Y+  H+ ILF LL GY   E+AL+ G M RE  RHE LA+ V+ SE F+  F +V+ + FDI+SDAF + KDLLTRHK + A+FLE N+D +F +Y +LL S+NYVTKRQSLKLLGELLLDR+NF VM +YIS  +NLKLMMN+L+   + I FEAFH FKVFVANPNK + +  IL +NQ KL+ FLS+FQTDR++  QF +EK YLIKQIRDLK PA  +
Sbjct:    1 MPFPFGKSQKNPAEIVKNLKENVACLEKLEASDN--KKCEKVAEEVSKNLASLKEVLCGTGD-----KEPQTEAV-----------AQLAQELYNTNLFISLIANLQRVDFEGKKDVVHLFSNIVRRQIGSRTPTVEYISSHSQILFMLLKGYETPEVALNCGMMLRECLRHEPLARTVLFSEDFFCFFRYVELSTFDIASDAFASFKDLLTRHKIMCADFLETNYDRVFTEYEKLLHSDNYVTKRQSLKLLGELLLDRHNFTVMTKYISRAENLKLMMNMLRDNSRNIQFEAFHVFKVFVANPNKTQPVLDILLKNQSKLVDFLSHFQTDRSEDEQFCDEKNYLIKQIRDLKRPAPPE 341          
BLAST of Calcium binding protein 39 vs. Ensembl Sea Lamprey
Match: cab39l (calcium binding protein 39-like [Source:ZFIN;Acc:ZDB-GENE-041114-204])

HSP 1 Score: 296.59 bits (758), Expect = 1.085e-98
Identity = 179/355 (50.42%), Postives = 228/355 (64.23%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSG---YNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDL-KPA 1125
            MPLFG++ KTP E+ + L E L  L    K +K  +K  EE+S+ L+ +K++L    D +  P                  + ++  E+  +  +  L+ +L  IDFE  K V ++F  + RR  G RSP   Y+  + S+LF LL G   Y   EIAL+ G M RE  RHE L K V+ S   Y+ F +V+ + FDI+SDAF T KDLLTRHK + AEFLE N+D +F +Y +LL SENYVTKRQSLKLLGELLLDR+NF +M RYIS  +NLKLMMNLL+ + + I FEAFH FKVFVANPNKP+ I  IL +NQ KL+ FLS FQ DRTD  QF EEK YLIKQIR+L KPA
Sbjct:    1 MPLFGKSHKTPAEVVRHLKESLAQLE---KQDKKAEKASEEVSKSLAAMKEILYGTGDKEPQPE----------------AVAQLAQELYNSGLIPVLITQLQRIDFEGKKDVAQIFNNILRRQIGTRSPTVEYICANPSLLFMLLKGERSYETPEIALNCGIMLRECIRHEPLGKIVLCSPQLYDFFRYVEVSTFDIASDAFATFKDLLTRHKIICAEFLEENYDKVFGEYEKLLNSENYVTKRQSLKLLGELLLDRHNFTIMTRYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKPQPILDILLKNQSKLVEFLSKFQQDRTDDEQFTEEKNYLIKQIRELKKPA 336          
BLAST of Calcium binding protein 39 vs. Ensembl Yeast
Match: HYM1 (Component of the RAM signaling network; is involved in regulation of Ace2p activity and cellular morphogenesis, interacts with Kic1p and Sog2p, localizes to sites of polarized growth during budding and during the mating response [Source:SGD;Acc:S000001672])

HSP 1 Score: 125.946 bits (315), Expect = 7.515e-33
Identity = 99/352 (28.12%), Postives = 169/352 (48.01%), Query Frame = 1
Query:   97 KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIID--FESCKCVVELFGQLCRRNQGNRSPISLYL-QQHTSILFQL------LSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVA-EFL--EANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDL 1116
            KTP +  + ++E L   ++P+  + +K+K+ EE ++ L   K  +V  +D    P   D  +    RA +   L                   L  +D  FE+ +  + +F      ++ N+     YL  Q  +I   L      L      +I L  G M  E  ++E L + ++     ++ F   +   F+IS+++   L    T H  +V+ EF   E N         +L+   +YVTKRQS KLL  L++ R+N  +MN YI++ +NLKL+M L+  + K +  EAF+ FKV VANP K K +  IL +N++KL+ +   F  D  D   F +E+++++++I  L
Sbjct:   21 KTPSDYARLIIEQLNKFSSPSLTQDNKRKVQEECTKYLIGTKHFIVGDTDPHPTPEAIDELYTAMHRADVFYELL------------------LHFVDLEFEARRECMLIFSICLGYSKDNKFVTVDYLVSQPKTISLMLRTAEVALQQKGCQDIFLTVGNMIIECIKYEQLCRIILKDPQLWKFFEFAKLGNFEISTESLQILSAAFTAHPKLVSKEFFSNEINIIRFIKCINKLMAHGSYVTKRQSTKLLASLIVIRSNNALMNIYINSPENLKLIMTLMTDKSKNLQLEAFNVFKVMVANPRKSKPVFDILVKNRDKLLTYFKTFGLDSQDS-TFLDEREFIVQEIDSL 353          
BLAST of Calcium binding protein 39 vs. Ensembl Nematostella
Match: EDO40951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5R7])

HSP 1 Score: 291.967 bits (746), Expect = 1.445e-96
Identity = 168/351 (47.86%), Postives = 227/351 (64.67%), Query Frame = 1
Query:   76 MPLFGRTK-TPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPA 1125
            MPLFG +K +P E+ +   + L ALN   +  K  +K +E++ + LS +K +L      +G+  ++    ++++ A+                     +  L  +DFES K  V++F  + RR  G RSP   YL     ILFQL+ GY+  EIAL+ G M RE  R+E+LAK ++  + FY  F +V+ + FDI+SDAF T K+ LTRHK + AEFLE N+D  FN Y +LL SENYVT+RQSLKLLGELLLDR+NF+VM RYISN +NLKLMMNLL+ + + I FEAFH FKVFVANPNK   I  IL +N++KL+ FL+NF  DRT+  QFN+EK YLIKQI++L PA
Sbjct:    1 MPLFGSSKKSPAEVVKNTTDALNALNKEPQGSKKAEKALEDVGKQLSAMKVIL------QGSGDQEPQTELIAQLAQEFYNSHLFEPL----------LNNLHRLDFESKKDYVQIFNNILRRQIGTRSPTVEYLCSQEKILFQLVKGYDTPEIALNCGMMLRECLRYELLAKIILLDDRFYNFFNYVEMSTFDIASDAFATFKENLTRHKIMCAEFLEKNYDKFFNSYGKLLHSENYVTRRQSLKLLGELLLDRHNFSVMTRYISNPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTPPILDILLKNKDKLVEFLTNFHNDRTEDEQFNDEKTYLIKQIKELGPA 335          
BLAST of Calcium binding protein 39 vs. Ensembl Medaka
Match: cab39l (calcium-binding protein 39-like [Source:NCBI gene;Acc:101156310])

HSP 1 Score: 308.531 bits (789), Expect = 1.370e-102
Identity = 185/353 (52.41%), Postives = 234/353 (66.29%), Query Frame = 1
Query:   76 MPLFGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDL-KPAN 1128
            MPLFG++ K+P ++ +TL E L  +    K +K  +K  +E+S+CL  +K++L   SD +  P  +    +  E              +  +  L +LV+ L +IDFE  K V ++F  + RR  G RSP   Y   H  +LF LL GY   +IAL+ G M RE  RHE LAK V++SEHF+  F +V+ + FDI+SDAF T KDLLTRHK +VAEFLE N+D +F  Y +LL SENYVTKRQSLKLLGELLLDR+NF VM RYIS  +NLKLMMNLL+ +   I FEAFH FKVFVANPNK + I  IL +NQ KLI FLSNFQ DR+D  QFN+EK YLIKQIRDL KPA+
Sbjct:    1 MPLFGKSHKSPTDIVRTLKENLAIVV---KHDKKTEKASDEVSKCLVSMKEILYGSSDKE--PHTETVAQLAQE--------------LYNSGLLISLVQNLQVIDFEGKKDVCQIFNNILRRQIGTRSPTVEYFCSHQEVLFILLKGYETPQIALNCGIMLRECIRHEPLAKIVLHSEHFHSFFNYVEMSTFDIASDAFATFKDLLTRHKVLVAEFLEQNYDTVFADYEKLLHSENYVTKRQSLKLLGELLLDRHNFTVMTRYISKPENLKLMMNLLRDKSANIQFEAFHVFKVFVANPNKTQPIVDILLKNQTKLIDFLSNFQKDRSDDDQFNDEKTYLIKQIRDLKKPAS 334          
BLAST of Calcium binding protein 39 vs. Ensembl Medaka
Match: cab39 (calcium-binding protein 39 [Source:NCBI gene;Acc:101165166])

HSP 1 Score: 288.886 bits (738), Expect = 6.704e-95
Identity = 173/353 (49.01%), Postives = 228/353 (64.59%), Query Frame = 1
Query:   76 MPL-FGRT-KTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLK-PA 1125
            MP  FG++ K+P ++ + L + +  L   + ++K  +K  EE+S+ L  +K++L     N+  P+ +    +  E              +  +  L  L+  L +IDFE  K V ++F  + RR  G R+P   YL    +ILF LL GY   +IAL+ G M RE  RHE LAK  + SE FY+ F +V+ + FDI+SDAF T KDLLTRHK + AEFLE ++D  F++Y +LL SENYVTKRQSLKLLGELLLDR+NF +M +YIS  +NLKLMMNLL+ + + I FEAFH FKVFVANPNK + I  IL +NQ KLI FLS FQ DRT+  QFN+EK YLIKQIRDLK PA
Sbjct:    1 MPFPFGKSHKSPADIVKNLKDSMTVLEKHDISDKKAEKATEEVSKSLVAMKEILY--GTNEKEPQTEAVAQLAQE--------------LYNSGLLSTLIADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYLCTQQNILFMLLKGYESPDIALNCGIMLRECIRHEPLAKITLGSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDKFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLIKQIRDLKRPA 337          
BLAST of Calcium binding protein 39 vs. Ensembl Medaka
Match: cab39l1 (calcium-binding protein 39 [Source:NCBI gene;Acc:101163094])

HSP 1 Score: 285.804 bits (730), Expect = 1.048e-93
Identity = 174/355 (49.01%), Postives = 231/355 (65.07%), Query Frame = 1
Query:   76 MPL-FGRT-KTPKELTQTLVECLQALNAPNKAE-KDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPANA 1131
            MP  FG++ K+P E+ +TL E + AL   +  + K  +K+ EE S+ L+ LK++L    D     +E  ++ +            ++  E+   N L  L+  L  IDFE  K VV+LF  + RR  G R+P   Y+  H  ILF LL GY  +E+AL+ G M RE  RHE LA+ V+ SE F+  F +V+ + FDI+SDAF + KDLLTRHK + A+FLE N+D +F  Y +LL S+NYVTKRQSLKLLGELLLDR+NF VM +YIS  +NLKLMMN+L+   + I FEAFH FKVFVANPNK + +  IL +NQ KL+ FLS+FQTDR++  QF +EK YLIKQIRDLK   A
Sbjct:    1 MPFPFGKSQKSPAEIVRTLKENVAALEKLDAGDGKKSEKIAEEASKNLASLKEVLCGTGD-----KEPQTEAV-----------AQLAQELYNTNLLIALIANLQKIDFEGKKDVVQLFSNIVRRQIGTRTPTVEYISTHPEILFMLLKGYENAEVALNCGMMLRECLRHEPLARTVLYSEDFFCFFRYVELSTFDIASDAFASFKDLLTRHKIMCADFLEKNYDRVFTDYEKLLHSDNYVTKRQSLKLLGELLLDRHNFTVMTKYISRSENLKLMMNMLRDNSRNIQFEAFHVFKVFVANPNKTQPVLDILLKNQTKLVDFLSHFQTDRSEDEQFCDEKNYLIKQIRDLKRPTA 339          
BLAST of Calcium binding protein 39 vs. Planmine SMEST
Match: SMESG000006408.1 (SMESG000006408.1)

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 356/356 (100.00%), Postives = 356/356 (100.00%), Query Frame = 1
Query:   76 MPLFGRTKTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARXXXXXXXXXXXXXXXXXXXXXVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPANAQNNA 1143
            MPLFGRTKTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARINEILGEITNEILINNGLENLVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPANAQNNA
Sbjct:    1 MPLFGRTKTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKDMLVDRSDNKGAPREKDSDFILSERARINEILGEITNEILINNGLENLVEKLDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNKSEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFTTLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGELLLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPNKPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPANAQNNA 356          
The following BLAST results are available for this feature:
BLAST of Calcium binding protein 39 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAB39L6.016e-10149.28calcium binding protein 39 like [Source:HGNC Symbo... [more]
CAB39L6.016e-10149.28calcium binding protein 39 like [Source:HGNC Symbo... [more]
CAB39L6.016e-10149.28calcium binding protein 39 like [Source:HGNC Symbo... [more]
CAB39L6.016e-10149.28calcium binding protein 39 like [Source:HGNC Symbo... [more]
CAB39L6.016e-10149.28calcium binding protein 39 like [Source:HGNC Symbo... [more]
back to top
BLAST of Calcium binding protein 39 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mop-25.16.098e-9047.50MO25 (MOuse embryo scaffolding Protein) homolog [... [more]
mop-25.12.239e-8747.11MO25 (MOuse embryo scaffolding Protein) homolog [... [more]
mop-25.29.286e-8544.60MO25-like protein 2 [Source:UniProtKB/Swiss-Prot;... [more]
mop-25.29.286e-8544.60MO25-like protein 2 [Source:UniProtKB/Swiss-Prot;... [more]
mop-25.33.737e-621.37MO25-like protein 3 [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of Calcium binding protein 39 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mo255.535e-9648.73gene:FBgn0017572 transcript:FBtr0075358[more]
Mo255.535e-9648.73gene:FBgn0017572 transcript:FBtr0331560[more]
back to top
BLAST of Calcium binding protein 39 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cab39l4.284e-10452.69calcium binding protein 39-like [Source:ZFIN;Acc:Z... [more]
cab39l13.566e-9549.86calcium binding protein 39, like 1 [Source:ZFIN;Ac... [more]
cab39l13.566e-9549.86calcium binding protein 39, like 1 [Source:ZFIN;Ac... [more]
cab39l13.566e-9549.86calcium binding protein 39, like 1 [Source:ZFIN;Ac... [more]
cab391.832e-9147.59calcium binding protein 39 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Calcium binding protein 39 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
smpdl3b3.117e-10550.14sphingomyelin phosphodiesterase acid-like 3B [Sour... [more]
crtap9.435e-9549.01cartilage associated protein [Source:Xenbase;Acc:X... [more]
crtap7.898e-9449.13cartilage associated protein [Source:Xenbase;Acc:X... [more]
crtap2.668e-9059.45cartilage associated protein [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Calcium binding protein 39 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Cab39l4.408e-10149.29calcium binding protein 39-like [Source:MGI Symbol... [more]
Cab395.137e-9649.01calcium binding protein 39 [Source:MGI Symbol;Acc:... [more]
Cab395.137e-9649.01calcium binding protein 39 [Source:MGI Symbol;Acc:... [more]
Cab39l1.554e-7646.18calcium binding protein 39-like [Source:MGI Symbol... [more]
back to top
BLAST of Calcium binding protein 39 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H9S4|CB39L_HUMAN2.889e-10049.28Calcium-binding protein 39-like OS=Homo sapiens OX... [more]
sp|Q9DB16|CB39L_MOUSE3.083e-10049.29Calcium-binding protein 39-like OS=Mus musculus OX... [more]
sp|Q06138|CAB39_MOUSE3.593e-9549.01Calcium-binding protein 39 OS=Mus musculus OX=1009... [more]
sp|P91891|MO25_DROME5.548e-9548.73Protein Mo25 OS=Drosophila melanogaster OX=7227 GN... [more]
sp|Q9Y376|CAB39_HUMAN1.006e-9449.29Calcium-binding protein 39 OS=Homo sapiens OX=9606... [more]
back to top
BLAST of Calcium binding protein 39 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VB162.525e-12957.75Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4Z2DXA15.420e-12957.18Calcium-binding protein isoform 2 OS=Schistosoma j... [more]
A0A430QDJ39.338e-12957.75Calcium binding protein 39 OS=Schistosoma bovis OX... [more]
A0A183LNA39.338e-12957.75Uncharacterized protein OS=Schistosoma margrebowie... [more]
C1L4C92.412e-12856.90Calcium binding protein 39 OS=Schistosoma japonicu... [more]
back to top
BLAST of Calcium binding protein 39 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cab39l3.285e-10251.84calcium binding protein 39 like [Source:NCBI gene;... [more]
cab39l3.285e-10251.84calcium binding protein 39 like [Source:NCBI gene;... [more]
cab39l15.180e-9348.47calcium-binding protein 39-like [Source:NCBI gene;... [more]
back to top
BLAST of Calcium binding protein 39 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cab39l1.085e-9850.42calcium binding protein 39-like [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Calcium binding protein 39 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HYM17.515e-3328.13Component of the RAM signaling network; is involve... [more]
back to top
BLAST of Calcium binding protein 39 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO409511.445e-9647.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium binding protein 39 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cab39l1.370e-10252.41calcium-binding protein 39-like [Source:NCBI gene;... [more]
cab396.704e-9549.01calcium-binding protein 39 [Source:NCBI gene;Acc:1... [more]
cab39l11.048e-9349.01calcium-binding protein 39 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Calcium binding protein 39 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000006408.10.000e+0100.00SMESG000006408.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003427 ID=SMED30003427|Name=Calcium binding protein 39|organism=Schmidtea mediterranea sexual|type=transcript|length=1234bp
TCAATATTTCGATTAATTGCCTAATTTTTGTTAAACTACTTTTTATTAAA
TTTTAGAATTTTTTCAAAAAACCTCATGCCTTTATTTGGTAGAACTAAAA
CACCTAAAGAACTTACTCAAACTTTAGTAGAATGTTTGCAAGCCTTAAAT
GCTCCTAATAAAGCAGAGAAAGATAAGAAAAAGTTAATTGAAGAAATTTC
AAGATGTCTGTCACAACTTAAAGATATGCTTGTTGATAGATCGGATAATA
AAGGTGCTCCACGTGAAAAAGATTCCGACTTCATTCTTTCTGAACGTGCA
AGAATAAATGAAATACTTGGAGAAATTACAAATGAAATTTTGATTAACAA
TGGACTTGAAAATTTAGTTGAAAAGCTTGATATAATTGATTTTGAAAGTT
GTAAATGTGTTGTTGAATTGTTTGGGCAGCTATGTAGAAGAAATCAAGGA
AATCGCTCTCCTATTTCTTTGTATTTACAGCAACATACTTCAATTTTATT
TCAACTGCTGAGTGGATATAATAAATCAGAAATAGCACTTCACTACGGAG
CTATGTTTAGAGAAGCAACTAGACACGAGATTCTTGCTAAAGAAGTCATA
AATTCTGAACATTTTTATGAGTTATTTACACATGTTCAAGGCACTGCCTT
TGATATCAGTTCAGATGCTTTCACTACATTAAAAGACTTATTAACTCGGC
ATAAAACAGTTGTAGCTGAATTTCTAGAAGCTAATTTTGATCATTTGTTT
AATAAGTATACTGAATTGCTTCAGTCAGAGAACTATGTCACAAAACGACA
GTCCTTAAAACTTCTCGGTGAATTACTTTTAGATAGAAATAACTTCAATG
TTATGAACCGATACATTTCCAATGAAGATAATTTAAAGTTAATGATGAAT
TTATTGAAAAGTCGTGAAAAACAAATTAGCTTTGAGGCGTTTCACTGTTT
TAAAGTATTTGTTGCAAATCCTAATAAGCCAAAATGTATTCATGCTATTC
TCTATCAAAATCAAGAAAAGTTAATACATTTCTTATCGAACTTTCAGACG
GATAGAACTGATGGGATACAATTTAATGAAGAAAAACAATATTTAATTAA
ACAAATACGTGATCTCAAGCCTGCTAATGCACAAAATAACGCTTAATTGT
AAATGCCTCAAATAAAAGTGTAGAATTGATTTTATTAACATTGGGTCCAT
AATTATCAAGATAATAAAATATAATTGATTTCAG
back to top

protein sequence of SMED30003427-orf-1

>SMED30003427-orf-1 ID=SMED30003427-orf-1|Name=SMED30003427-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=357bp
MPLFGRTKTPKELTQTLVECLQALNAPNKAEKDKKKLIEEISRCLSQLKD
MLVDRSDNKGAPREKDSDFILSERARINEILGEITNEILINNGLENLVEK
LDIIDFESCKCVVELFGQLCRRNQGNRSPISLYLQQHTSILFQLLSGYNK
SEIALHYGAMFREATRHEILAKEVINSEHFYELFTHVQGTAFDISSDAFT
TLKDLLTRHKTVVAEFLEANFDHLFNKYTELLQSENYVTKRQSLKLLGEL
LLDRNNFNVMNRYISNEDNLKLMMNLLKSREKQISFEAFHCFKVFVANPN
KPKCIHAILYQNQEKLIHFLSNFQTDRTDGIQFNEEKQYLIKQIRDLKPA
NAQNNA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR013878Mo25
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013878Mo25-likePFAMPF08569Mo25coord: 3..348
e-value: 4.9E-115
score: 384.4
IPR013878Mo25-likePANTHERPTHR10182CALCIUM-BINDING PROTEIN 39-RELATEDcoord: 6..348
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 2..347
e-value: 7.2E-125
score: 418.5
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 8..349