SMED30003415

Overview
NameSMED30003415
Smed IDSMED30003415
Length (bp)1476
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30003415 (SMED30003415) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30003415 (SMED30003415) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30003415 (SMED30003415) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30003415 (SMED30003415) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003415

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30003415h1SMcG0013262 SmedASXL_010807SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30003415h1SMcG0013262 Contig49235newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003415h1SMcG0013262 Contig49235uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003415h1SMcG0016857 Contig49235newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003415h1SMcG0016857 Contig49235uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30003415 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000143:88045..89535 +7054
Homology
BLAST of SMED30003415 vs. Ensembl Human
Match: NARS2 (asparaginyl-tRNA synthetase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:26274])

HSP 1 Score: 258.84 bits (660), Expect = 4.222e-80
Identity = 167/461 (36.23%), Postives = 248/461 (53.80%), Query Frame = -1
Query:   37 KNISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYK----AIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESK---IISP----GLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGG--ETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM 1380
            + I I GW+ S+   K   FL ++DG S E +QVV  + L  +    G  ++V G+++ SP + Q  E++A   + +           N  ++      K     E  R +  HFR R +   +I RIR+    +I ++   + ++ +  PI+TS D EGAGE ++      ++ P E+    P  LTVS QLHLE +   + +V+T GP FRA  S++R HL+EF M+E E   ++S+ DL   IE L K  +    +   +++EL  K          G +   E +  NNF+ IS+ +AVEILK++      +P     LR E        E+ LV   GN PVFV ++P++ KPFY R NE G   TV AVDLL+P VGE+ GG +R+  Y  L+ R+  + L E    WYLDLR  GS PH GFG+GF+R LQ   GV NI+DV+ FPR  ++C++
Sbjct:   42 ERIKIQGWIRSVRSQKEVLFLHVNDGSSLESLQVVADSGLDSRELNFGSSVEVQGQLIKSPSKRQNVELKAEKIKVIG----------NCDAKDFPIKYKERHPLEYLR-QYPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHTPIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGPTFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHK------FIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTE-------HEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLARSGLTEV-YQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLL 477          
BLAST of SMED30003415 vs. Ensembl Human
Match: NARS2 (asparaginyl-tRNA synthetase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:26274])

HSP 1 Score: 179.104 bits (453), Expect = 2.232e-52
Identity = 108/261 (41.38%), Postives = 151/261 (57.85%), Query Frame = -1
Query:   37 GYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESK---IISP----GLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGG--ETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM 792
             + +V+T GP FRA  S++R HL+EF M+E E   ++S+ DL   IE L K  +    +   +++EL  K          G +   E +  NNF+ IS+ +AVEILK++      +P     LR E        E+ LV   GN PVFV ++P++ KPFY R NE G   TV AVDLL+P VGE+ GG +R+  Y  L+ R+  + L E    WYLDLR  GS PH GFG+GF+R LQ   GV NI+DV+ FPR  ++C++
Sbjct:    4 AFTQVFTFGPTFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHK------FIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTEH-------EKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLARSGLTEV-YQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLL 250          
BLAST of SMED30003415 vs. Ensembl Human
Match: NARS1 (asparaginyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:7643])

HSP 1 Score: 155.606 bits (392), Expect = 8.013e-41
Identity = 130/458 (28.38%), Postives = 202/458 (44.10%), Query Frame = -1
Query:   43 KNISIVGWVHSISRL-KNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGC------CIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRH---RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISP-GLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYC-RPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1380
            + + + GWVH + R  KN  FL L DG     +Q VL + L     Y G        + V G +  +P   Q      LSC+        F +   LA     +++   I  E+     L+ RH   R +  S I + R+   +  R++     Y EV PP L     EG    +K  ++   E        LT S+QL+LE  +   G V+ +   +RA +SRTR HL+E+  +E E   + +  DL N +E L+  +      + A ++      N                     F R+++  A+  LKE  +    G   E  E      +RL++   N P+ +  FP+  K FY  R  E      +VD+L+P VGE+VGGS+R  D + + +  K   ++ T   WY D R  G+CPH G+G+G +R L +    Y+I+DV  +PR    C
Sbjct:  126 QRVKVFGWVHRLRRQGKNLMFLVLRDGTG--YLQCVLADELCQ--CYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCD--------FWELIGLAPAGGADNL---INEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFK--LDYFGEEAF-----LTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFL-TFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNF--------------QPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRC 546          
BLAST of SMED30003415 vs. Ensembl Human
Match: NARS2 (asparaginyl-tRNA synthetase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:26274])

HSP 1 Score: 85.1149 bits (209), Expect = 8.823e-20
Identity = 43/90 (47.78%), Postives = 57/90 (63.33%), Query Frame = -1
Query:   37 VMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM 306
            V AVDLL+P VGE+ GG +R+  Y  L+ R+            YLDLR  GS PH GFG+GF+R LQ   GV NI+DV+ FPR  ++C++
Sbjct:    2 VAAVDLLVPGVGELFGGGLREERYHFLEERLAR----------YLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLL 81          
BLAST of SMED30003415 vs. Ensembl Human
Match: DARS1 (aspartyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:2678])

HSP 1 Score: 81.6481 bits (200), Expect = 6.321e-16
Identity = 76/337 (22.55%), Postives = 154/337 (45.70%), Query Frame = -1
Query:   58 RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLG-YGKVYTLGPIFRANKSRTRHHLSEFLMLEVE---SININSVID-LCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRI-EEIEFSKSEEQRLVSLLGNRPVFVTDF------PMSQKPFYCRPN-EGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 1029
            R     A+ R+++      R  +I   ++E+  P + S   EG    +         S       L  S QL+ +  +   + KV+++GP+FRA  S T  HL+EF+ L++E   + + + V++ + +++  + K L   F       ++ + K    +  +F               +R+ + +A+ +L+E+     G+ + +E + S   E+ L  L+  +  + TDF      P++ +PFY  P+    +   + D+ +    E++ G+ R  D   L  R  H  ++   +  Y+D    G+ PH+G G+G +R+   + G++N++    FPR
Sbjct:  188 RTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTV-------SYFKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYHEVMEEIADTMVQIFKGLQERF----QTEIQTVNKQFPCEPFKFLEPT-----------LRLEYCEALAMLREA-----GVEMGDEDDLSTPNEKLLGHLVKEK--YDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFMR-GEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPR 494          
BLAST of SMED30003415 vs. Ensembl Celegans
Match: nars-2 (Asparaginyl(N) Amino-acyl tRNA Synthetase [Source:UniProtKB/TrEMBL;Acc:Q95PZ8])

HSP 1 Score: 221.09 bits (562), Expect = 8.751e-67
Identity = 142/449 (31.63%), Postives = 227/449 (50.56%), Query Frame = -1
Query:   43 SIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNES----IIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEI--LKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1371
            ++ GW  S+ +     F+K+  GR+ E IQ+V  N  + +    G  I+ +G +  S G  Q  E  A   + +       ND+         N     +  +  RK+  H R R   ++A+ R R+   +    + ++ +++ +D P LT  DCEG GE +  +  T  E+    +  +P  L+VS+QLHLEA+V    +VY LGP FRA + ++  HLSEF MLE E   + ++ ++C  +E  I+               +I   N  + E  + +      IS+  F RI + +AV +  LK SK+ +      +  FSK  E  LV L  + P+FVT +P+ QKPFY   +  G+  ++ DLL+P +GE+ GGS+R+   + L+ R          ++WYL++R  G  P  GFG+GF+R+LQ+  GV NI+D V FPR    C
Sbjct:   14 TLDGWAKSVQKSGKNVFVKIDKGRAGEPIQLV-ANKEIGQEIRVGSAIRATGSLEHSRGAQQEMEFVAEQLKVVG------NDE---------NPRYDDLSPDNLRKKT-HLRARNSKFAALLRARSAIFRETHEFFMSRDFIHIDTPKLTRNDCEGGGEVFDVVTTTSTEAGDGGLKEEPMFLSVSSQLHLEAMVSRLQRVYILGPSFRAERQQSHAHLSEFHMLEAEVAFVETIDEMCTLVESYIQ--------------HMISYLNSSKLEPETAIIGSKIPISNIKFPRIRYDEAVHLLALKGSKVTA------KSGFSKKNELDLVKLHDDHPIFVTHYPVGQKPFYMARD--GQLTLSFDLLVPGIGELAGGSLREQSAEELQRR-------GCGIDWYLEMRRRGQPPTGGFGIGFERMLQYLLGVQNIKDTVAFPRWHRHC 416          
BLAST of SMED30003415 vs. Ensembl Celegans
Match: nars-2 (Asparaginyl(N) Amino-acyl tRNA Synthetase [Source:UniProtKB/TrEMBL;Acc:Q95PZ8])

HSP 1 Score: 221.09 bits (562), Expect = 8.751e-67
Identity = 142/449 (31.63%), Postives = 227/449 (50.56%), Query Frame = -1
Query:   43 SIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNES----IIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEI--LKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1371
            ++ GW  S+ +     F+K+  GR+ E IQ+V  N  + +    G  I+ +G +  S G  Q  E  A   + +       ND+         N     +  +  RK+  H R R   ++A+ R R+   +    + ++ +++ +D P LT  DCEG GE +  +  T  E+    +  +P  L+VS+QLHLEA+V    +VY LGP FRA + ++  HLSEF MLE E   + ++ ++C  +E  I+               +I   N  + E  + +      IS+  F RI + +AV +  LK SK+ +      +  FSK  E  LV L  + P+FVT +P+ QKPFY   +  G+  ++ DLL+P +GE+ GGS+R+   + L+ R          ++WYL++R  G  P  GFG+GF+R+LQ+  GV NI+D V FPR    C
Sbjct:   14 TLDGWAKSVQKSGKNVFVKIDKGRAGEPIQLV-ANKEIGQEIRVGSAIRATGSLEHSRGAQQEMEFVAEQLKVVG------NDE---------NPRYDDLSPDNLRKKT-HLRARNSKFAALLRARSAIFRETHEFFMSRDFIHIDTPKLTRNDCEGGGEVFDVVTTTSTEAGDGGLKEEPMFLSVSSQLHLEAMVSRLQRVYILGPSFRAERQQSHAHLSEFHMLEAEVAFVETIDEMCTLVESYIQ--------------HMISYLNSSKLEPETAIIGSKIPISNIKFPRIRYDEAVHLLALKGSKVTA------KSGFSKKNELDLVKLHDDHPIFVTHYPVGQKPFYMARD--GQLTLSFDLLVPGIGELAGGSLREQSAEELQRR-------GCGIDWYLEMRRRGQPPTGGFGIGFERMLQYLLGVQNIKDTVAFPRWHRHC 416          
BLAST of SMED30003415 vs. Ensembl Celegans
Match: nars-1 (Asparagine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19722])

HSP 1 Score: 154.451 bits (389), Expect = 6.246e-41
Identity = 126/460 (27.39%), Postives = 211/460 (45.87%), Query Frame = -1
Query:   43 KNISIVGWVHSISRL-KNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRH---RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVES--ININSVID-----LCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISP-GLR-IEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYC-RPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1380
            + +SI  WVH + R  K+  FL L DG     +Q VL + L           + S +V      G IK +     +S  + H +  D + +  +     +   +        +L  RH   R +  S I RIRA   +++R++     Y EV PP L     EG    +             +P  LT S+QL+LE      G VY +   +RA KSRTR HLSE+  +E E   I  + ++D     +C++++ L+           AD +      +L++                  F R+ +++A+E L+++ + +  G + +   + +++ E+R+   +G  P+ +  FP   K FY  R  +  E   +VDLL+P VGE+VGGS+R    D+L +  +   L+  +  WY+D R  GS PH G+G+G +R + + T   +I+DV  +PR    C
Sbjct:  122 QRVSIKAWVHRLRRQGKSLMFLVLRDGYG--FLQCVLNDKLCQSYDAVTLSTETSVQVY-----GIIKALP--DGKSAPDGHELTVDYWEVIGKAPAGGIDNVLNESAGVDVMLDNRHLVIRGENASRILRIRAAATRAMRDHFFAAGYTEVAPPTLVQTQVEGGSTLF-------GLDYYGEPAYLTQSSQLYLETCNAALGDVYCISQSYRAEKSRTRRHLSEYQHVEAECAFITFDQLMDRIEALVCDTVDRLL-----------ADPV----TKSLIEFVNPGYKAPA------RPFKRMPYKEAIEWLQKNDVRNEMGEKFVYGEDIAEAAERRMTDTIGV-PILLNRFPHGIKAFYMPRCADDNELTESVDLLMPGVGEIVGGSMRIWKEDQLLAAFEKGGLDSKNYYWYMDQRKYGSVPHGGYGLGLERFICWLTDTNHIRDVCLYPRFVGRC 543          
BLAST of SMED30003415 vs. Ensembl Celegans
Match: dars-1 (Aspartate--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q03577])

HSP 1 Score: 98.2117 bits (243), Expect = 1.355e-21
Identity = 82/324 (25.31%), Postives = 146/324 (45.06%), Query Frame = -1
Query:   58 AIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLG-YGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRI-EEIEFSKSEEQRLVSLLGNR---PVFVTD-FPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 1011
            AI RI+A      RN +    ++E+  P + S   EG    ++        S       L  S QL+ +  + G + KVYT+GP+FRA  S T  H++EF+ L++E        ++  +I  ++  + +    N  D +  +      +  +F               + + +  A+ +L+E+     G+ I +E + S   E+ L  L+  +     +V D FP+S +PFY  P+   E       +     E++ G+ R  D D L  R KH +++   +  Y+D    G  PH+G G+G +R+   + G++NI+    FPR
Sbjct:  224 AIFRIQAGICNQFRNILDVRGFVEIMAPKIISAPSEGGANVFEV-------SYFKGSAYLAQSPQLYKQMAIAGDFEKVYTIGPVFRAEDSNTHRHMTEFVGLDLEMAFNFHYHEVMETIAEVLTQMFKGLQQNYQDEIAAVGNQYPAEPFQFCEPP-----------LILKYPDAITLLREN-----GIEIGDEDDLSTPVEKFLGKLVKEKYSTDFYVLDKFPLSVRPFYTMPDAHDERYSNSYDMFMRGEEILSGAQRIHDADMLVERAKHHQVDLAKIQSYIDSFKYGCPPHAGGGIGLERVTMLFLGLHNIRLASLFPR 524          
BLAST of SMED30003415 vs. Ensembl Celegans
Match: dars-1 (Aspartate--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q03577])

HSP 1 Score: 98.2117 bits (243), Expect = 1.355e-21
Identity = 82/324 (25.31%), Postives = 146/324 (45.06%), Query Frame = -1
Query:   58 AIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLG-YGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRI-EEIEFSKSEEQRLVSLLGNR---PVFVTD-FPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 1011
            AI RI+A      RN +    ++E+  P + S   EG    ++        S       L  S QL+ +  + G + KVYT+GP+FRA  S T  H++EF+ L++E        ++  +I  ++  + +    N  D +  +      +  +F               + + +  A+ +L+E+     G+ I +E + S   E+ L  L+  +     +V D FP+S +PFY  P+   E       +     E++ G+ R  D D L  R KH +++   +  Y+D    G  PH+G G+G +R+   + G++NI+    FPR
Sbjct:  224 AIFRIQAGICNQFRNILDVRGFVEIMAPKIISAPSEGGANVFEV-------SYFKGSAYLAQSPQLYKQMAIAGDFEKVYTIGPVFRAEDSNTHRHMTEFVGLDLEMAFNFHYHEVMETIAEVLTQMFKGLQQNYQDEIAAVGNQYPAEPFQFCEPP-----------LILKYPDAITLLREN-----GIEIGDEDDLSTPVEKFLGKLVKEKYSTDFYVLDKFPLSVRPFYTMPDAHDERYSNSYDMFMRGEEILSGAQRIHDADMLVERAKHHQVDLAKIQSYIDSFKYGCPPHAGGGIGLERVTMLFLGLHNIRLASLFPR 524          
BLAST of SMED30003415 vs. Ensembl Fly
Match: AsnRS-m (gene:FBgn0034177 transcript:FBtr0087057)

HSP 1 Score: 247.669 bits (631), Expect = 2.319e-76
Identity = 159/470 (33.83%), Postives = 253/470 (53.83%), Query Frame = -1
Query:   37 NISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQN----------------LTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRI-----SFQQAVEILKESK-IISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGET-VMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM 1377
            +++I GW+ ++ RLKN +FL ++DG ++   QVV+     +++   G  I   G++  +P  G   E+ A   E L+E             E    S K     E  R E LH R R D  +A  R+R   +++I +YM   ++++++ P+LT+ DCEGAGE ++     P+   ++K  N                L+VS QLHLEA+  G GK YTL P FRA  S++  HL+EF M E E  ++  +  L   IE ++K+++      + ++L   ++++               + SD  ++++     S+ +A+++L+E+K  +   + + E  FSK +E  LV+  G  PVFV D+P  QKPFY + +      V A+DLL+P VGE+ GGS+R++D   LKS   H  L + D+ WY+DLR  G  P  GFG+GF+R LQ  TGV NI+DV+ FPR  ++C M
Sbjct:   26 SLAIQGWIKNVRRLKNNTFLDINDGSTSSRFQVVVPRTPENQHLAPGSVIAAVGKIQVAPN-GSF-ELHANQVEMLAEGR---------LQEGYPFSPKQKHPPEYVR-EHLHLRSRVDFVAAQMRVRHKAQKAIHDYMDDQDFVQINTPLLTTNDCEGAGEVFRV---QPDSQDLLKQMNRPNIPMEQSYFDSKVFLSVSGQLHLEAMTYGLGKTYTLSPAFRAENSKSPLHLAEFYMFEAELAHLEEMEKLAQFIEQMLKSVTNRLLETSGEDLSFCQRNS--------------NSNSDLPWLQVPWKIMSYDEALQVLQENKDSLKTPISLNE-GFSKDQELFLVAHCG-APVFVVDWPAQQKPFYMKVSRSNPNRVHALDLLMPAVGELCGGSLRESDPAILKS---HPHLPK-DLEWYVDLRKYGGVPTGGFGMGFERYLQLVTGVKNIRDVIPFPRYPHSCKM 460          
BLAST of SMED30003415 vs. Ensembl Fly
Match: AsnRS (gene:FBgn0086443 transcript:FBtr0332578)

HSP 1 Score: 139.043 bits (349), Expect = 3.023e-35
Identity = 121/466 (25.97%), Postives = 194/466 (41.63%), Query Frame = -1
Query:   43 ISIVGWVHSISRL-KNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRH---RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVE-------------SININSVID--LCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEI--EFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYC-RPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1374
            + + GWVH + R  K+  F+ L DG     +Q VL + L     Y    +     VV     G +K V     ++    H +  D + L            +  E      L  RH   R +  S + ++R+   Q+ R +     Y EV PP L     EG    +K            +   LT S+QL+LE  +   G V+T+   +RA +SRTR HL+E+  +E E                +  V+D  L +   +L+K L+ DF                                    F R++++ A++ LKE+ +        E   +  ++ E+++   + N P+ +  FP   K FY  R  E      +VD+LLP VGE+VGGS+R  D + L    K   ++     WY D R  G+ PH G+G+G +R L +    Y+I++V  +PR  + C
Sbjct:  138 VKVYGWVHRLRRQGKSLIFITLRDGTG--FLQCVLNDQLCQT--YDALTLSTESSVVLF---GTLKLVP--EGKTAPGGHELNVDYWELIGLAPPGGADAILNEEAQPDVQLDNRHIMIRGENTSKVLKMRSVVTQAFRGHYEARGYNEVTPPTLVQTQVEGGSTLFKL-------KYFGEEAYLTQSSQLYLETCLPALGDVFTISQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLDRLEDLVCDVVDRVLKSPWGYLVKELNPDF------------------------------KPPQKPFRRMNYEDAIKWLKENNVTKDDGTFYEFGEDIPEAPERKMTDTI-NEPIMLCRFPAEIKSFYMQRCKEDQRLTESVDVLLPNVGEIVGGSMRIYDSEELLKGYKREGIDPQPYYWYTDQRVYGTMPHGGYGLGLERFLCWLLNRYHIREVCLYPRFLDRC 556          
BLAST of SMED30003415 vs. Ensembl Fly
Match: AsnRS (gene:FBgn0086443 transcript:FBtr0081162)

HSP 1 Score: 139.043 bits (349), Expect = 3.023e-35
Identity = 121/466 (25.97%), Postives = 194/466 (41.63%), Query Frame = -1
Query:   43 ISIVGWVHSISRL-KNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRH---RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVE-------------SININSVID--LCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEI--EFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYC-RPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1374
            + + GWVH + R  K+  F+ L DG     +Q VL + L     Y    +     VV     G +K V     ++    H +  D + L            +  E      L  RH   R +  S + ++R+   Q+ R +     Y EV PP L     EG    +K            +   LT S+QL+LE  +   G V+T+   +RA +SRTR HL+E+  +E E                +  V+D  L +   +L+K L+ DF                                    F R++++ A++ LKE+ +        E   +  ++ E+++   + N P+ +  FP   K FY  R  E      +VD+LLP VGE+VGGS+R  D + L    K   ++     WY D R  G+ PH G+G+G +R L +    Y+I++V  +PR  + C
Sbjct:  138 VKVYGWVHRLRRQGKSLIFITLRDGTG--FLQCVLNDQLCQT--YDALTLSTESSVVLF---GTLKLVP--EGKTAPGGHELNVDYWELIGLAPPGGADAILNEEAQPDVQLDNRHIMIRGENTSKVLKMRSVVTQAFRGHYEARGYNEVTPPTLVQTQVEGGSTLFKL-------KYFGEEAYLTQSSQLYLETCLPALGDVFTISQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLDRLEDLVCDVVDRVLKSPWGYLVKELNPDF------------------------------KPPQKPFRRMNYEDAIKWLKENNVTKDDGTFYEFGEDIPEAPERKMTDTI-NEPIMLCRFPAEIKSFYMQRCKEDQRLTESVDVLLPNVGEIVGGSMRIYDSEELLKGYKREGIDPQPYYWYTDQRVYGTMPHGGYGLGLERFLCWLLNRYHIREVCLYPRFLDRC 556          
BLAST of SMED30003415 vs. Ensembl Fly
Match: AspRS (gene:FBgn0002069 transcript:FBtr0332882)

HSP 1 Score: 88.5817 bits (218), Expect = 1.997e-18
Identity = 77/329 (23.40%), Postives = 145/329 (44.07%), Query Frame = -1
Query:   58 RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLE-ALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQ---RLVSLLGNRPVFVTD-FPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 1029
            R     AI R+ A   +  R+ +    + E+  P + S   EG    +         S       L  S QL+ + A+   + KVYT+G +FRA  S T  HL+EF+ L++E        ++ ++I +   ++ +   +  A  +E + +   V + +F               + + F   V +L+E+ + +     +E + S   E+   RLV    +   ++ D FP++ +PFY  P+           +     E++ G+ R  D + L  R KH  ++ + +  Y++    G  PH+G G+G +R++  + G+ NI+    FPR
Sbjct:  218 RTPANQAIFRLEAGVCRLFRDILTEQGFTEIHTPKIISAASEGGANVFTV-------SYFKDSAYLAQSPQLYKQMAIAADFDKVYTVGAVFRAEDSNTHRHLTEFVGLDLEMAFKYHYHEVLHTIGNTFTSIFKGLRDKYAKEIESVGQQYKVDAFKFLEPP-----------LILQFADGVAMLREAGVETG----DEEDLSTPNEKLLGRLVKAKYDTDFYILDKFPLAIRPFYTMPDPNNPVYSNSYDMFMRGEEILSGAQRIHDPEYLIERAKHHGIDTSKIAAYIESFRYGCPPHAGGGIGMERVVMLYLGLDNIRKTSMFPR 524          
BLAST of SMED30003415 vs. Ensembl Fly
Match: AspRS (gene:FBgn0002069 transcript:FBtr0087784)

HSP 1 Score: 88.5817 bits (218), Expect = 1.997e-18
Identity = 77/329 (23.40%), Postives = 145/329 (44.07%), Query Frame = -1
Query:   58 RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLE-ALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQ---RLVSLLGNRPVFVTD-FPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 1029
            R     AI R+ A   +  R+ +    + E+  P + S   EG    +         S       L  S QL+ + A+   + KVYT+G +FRA  S T  HL+EF+ L++E        ++ ++I +   ++ +   +  A  +E + +   V + +F               + + F   V +L+E+ + +     +E + S   E+   RLV    +   ++ D FP++ +PFY  P+           +     E++ G+ R  D + L  R KH  ++ + +  Y++    G  PH+G G+G +R++  + G+ NI+    FPR
Sbjct:  218 RTPANQAIFRLEAGVCRLFRDILTEQGFTEIHTPKIISAASEGGANVFTV-------SYFKDSAYLAQSPQLYKQMAIAADFDKVYTVGAVFRAEDSNTHRHLTEFVGLDLEMAFKYHYHEVLHTIGNTFTSIFKGLRDKYAKEIESVGQQYKVDAFKFLEPP-----------LILQFADGVAMLREAGVETG----DEEDLSTPNEKLLGRLVKAKYDTDFYILDKFPLAIRPFYTMPDPNNPVYSNSYDMFMRGEEILSGAQRIHDPEYLIERAKHHGIDTSKIAAYIESFRYGCPPHAGGGIGMERVVMLYLGLDNIRKTSMFPR 524          
BLAST of SMED30003415 vs. Ensembl Zebrafish
Match: nars2 (asparaginyl-tRNA synthetase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-060929-596])

HSP 1 Score: 248.054 bits (632), Expect = 3.636e-76
Identity = 156/460 (33.91%), Postives = 237/460 (51.52%), Query Frame = -1
Query:   43 NISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETAR-----KELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKA-----IIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESK---IISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGG--ETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1377
            ++ I GWV S+   K+  FL L+DG S + +QVV ++ L  ++   GC + ++G +  SP + Q  E++A S + + E                 N M    K +        ++  H R R + +S++ RIR+    +I+++   + Y+++  P++TS DCEGAGE ++        ++ +      P  LTVS QLHLE +   +  VYT GP FRA  S++R HL+EF M+E E     S+ DL   +E L K  +   F+N  +++EL  K          G     + + +  F  IS+ +A++ILK S      SP       +     E+ LV   GN PVFV ++P   KPFY R N+     T  AVDLL+P VGE+ GGS+R+     L  R+  A L +T   WYL LR  GS PH GFG+GF+R LQ   G+ NI+D + F R  ++C
Sbjct:   50 DVRIQGWVRSVRPQKDNLFLHLNDGSSLQPLQVVASSQLNTRDLTFGCAVDITGTLEKSPNKRQNVELQAQSIKVVGE----------------CNPMDFPFKIKERHPLEYIRQFPHLRCRTNAFSSMLRIRSEATAAIQSFFRDHGYVQIHTPVITSNDCEGAGELFQVEPTGDKKDSDDPHFFSVPAYLTVSGQLHLEVMAGAFSAVYTFGPTFRAENSQSRRHLAEFYMVEAEIAFTESLDDLMKVMEDLFKAATEHVFSNCTEDVELFHKH------VAPGHREQVDPMLNRKFNVISYTEAIDILKSSSQNFTFSPEW---GCDLQTEHEKFLVKHCGNTPVFVVNYPYELKPFYARDNQDHPRHTAAAVDLLVPGVGELCGGSLREERLHLLTQRLSQAGLEDT-YAWYLQLREFGSVPHGGFGMGFERYLQCILGLNNIKDAIPFARFSHSC 483          
BLAST of SMED30003415 vs. Ensembl Zebrafish
Match: nars1 (asparaginyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1016])

HSP 1 Score: 153.68 bits (387), Expect = 2.835e-40
Identity = 128/452 (28.32%), Postives = 194/452 (42.92%), Query Frame = -1
Query:   43 KNISIVGWVHSISRL-KNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRH---RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKII-SPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYC-RPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1380
            + + + GWVH + R  KN  F+ L DG     +Q VLT+ L     Y G  +     V      G +K V     +     H +  D + L            +  E+     L+ RH   R +  S I ++R+   Q  R++  +  Y E+ PP L     EG    +       N         LT S+QL+LE  +   G  + +   +RA +SRTR HLSE+  +E E     S  DL N +E L+            D ++ + KS           +          F R+++ +A++ LKE  I    G   E  E      +RL++   N  + +  FP   K FY  R  E      +VD+L+P VGE+VGGS+R  D D L    K   ++ T   WY D R  G+CPH G+G+G +R L +    ++I+DV  +PR    C
Sbjct:  134 QRVKVFGWVHRLRRQGKNLLFIVLRDGTG--FLQCVLTDKLCQ--CYNGLVLSTESSVALY---GTVKPVP--EGKQAPGGHELHCDFWELVGLAPAGGADNLLNEESDVDVQLNNRHMMIRGENVSKILKVRSAVTQCFRDHFFSRGYCEITPPTLVQTQVEGGSTLFGLNYFGEN-------AYLTQSSQLYLETCIPALGDTFCIAQSYRAEQSRTRRHLSEYTHIEAE-CPFMSYEDLLNRLEDLV-----------CDVVDRVLKSPAAPLLYDINPDFKP---PKRPFKRMNYTEAIDWLKEHNIKKDDGTFYEFGEDIPEAPERLMTDSINETILLCRFPAEIKSFYMQRCPEDRRLTESVDVLMPNVGEIVGGSMRIWDSDELLEGYKREGIDPTPYYWYTDQRKFGTCPHGGYGLGLERFLTWLLNRHHIRDVCLYPRFIQRC 554          
BLAST of SMED30003415 vs. Ensembl Zebrafish
Match: dars1 (aspartyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-061110-135])

HSP 1 Score: 91.2781 bits (225), Expect = 4.215e-19
Identity = 81/335 (24.18%), Postives = 154/335 (45.97%), Query Frame = -1
Query:   58 RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLG-YGKVYTLGPIFRANKSRTRHHLSEFLMLEVE---SININSVID-LCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRI-EEIEFSKSEEQ---RLVSLLGNRPVFVTD-FPMSQKPFYCRPNEGG-ETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 1029
            R     AI R+++   Q  R+ +I   ++E+  P + S   EG    +         S       L  S QL+ +  +   + KV+ +GP+FRA  S T  HL+EF+ L++E   S + + VID + +++  + K L RD F      +     S   +  E +              +R+ +++ + +L+     + G+ + +E + S   E+   RLV    +   +V D +P++ +PFY  P+    +   + D+ +    E++ G+ R  D   L  R  H  ++   +  Y+D    G+ PH+G G+G +R+   + G++N++    FPR
Sbjct:  218 RTTTSQAIFRLQSGVCQLFRDTLINKGFVEIQTPKIISAASEGGANVFTV-------SYFKTSAYLAQSPQLYKQMCICADFDKVFCVGPVFRAEDSNTHRHLTEFVGLDIEMAFSYHYHEVIDSITDTMVQIFKGL-RDRFQTEIQTVNKQYPSEPFKFLEPT--------------LRLEYKEGLAMLR-----AAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPSNLKYSNSYDMFMRG-EEILSGAQRIHDAQLLTERAMHHNIDLEKIKAYIDSFRYGAPPHAGGGIGLERVTMLYLGLHNVRQTSMFPR 524          
BLAST of SMED30003415 vs. Ensembl Zebrafish
Match: nars2 (asparaginyl-tRNA synthetase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-060929-596])

HSP 1 Score: 58.9214 bits (141), Expect = 4.692e-10
Identity = 28/70 (40.00%), Postives = 40/70 (57.14%), Query Frame = -1
Query:  583 GYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRK 792
             +  VYT GP FRA  S++R HL+EF M+E E     S+ DL   +E L K  +   F+N  +++EL  K
Sbjct:   32 AFSAVYTFGPTFRAENSQSRRHLAEFYMVEAEIAFTESLDDLMKVMEDLFKAATEHVFSNCTEDVELFHK 101          
BLAST of SMED30003415 vs. Ensembl Zebrafish
Match: si:ch211-256m1.8 (si:ch211-256m1.8 [Source:ZFIN;Acc:ZDB-GENE-131127-417])

HSP 1 Score: 55.4546 bits (132), Expect = 1.380e-7
Identity = 61/259 (23.55%), Postives = 110/259 (42.47%), Query Frame = -1
Query:   58 GYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESI-NINSVIDLCNS-IEHLIKTLSR---DFFNNNADNL----ELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKES---KIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCR--PNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 792
            G    Y + P FR       H L++F  +E E + +++  + +    + HL K + +   D   N A  L    EL++  NL                 +    R++  QA+ I+  S   + +  G      + ++  E+ L+   G   V++T+      PFY     + G     A DLLL  +GE VG   R +  D ++  ++H  + E    WY+++R       SG+G+G +R L +     +++D+   PR
Sbjct: 1330 GLPGAYYVSPSFRGEDPDATH-LNQFYHVECELLGDMDVAMSIAEGYVAHLTKAMLKQHSDIILNTAGKLSHAQELLK--NL-----------------EGPLPRVALDQAIHIMPSSDCLEWVQEGQPQFGRKLTRKGEKVLIEKYGGA-VWLTEMDHLGVPFYQAYIEDSGQSKAKAADLLL-GLGETVGLGERHSTPDMVREALQHHAVPEDSYKWYINMRQVMPLLTSGWGMGTERYLCWLLQHNDVRDMQIIPR 1566          
BLAST of SMED30003415 vs. Ensembl Xenopus
Match: NARS2 (asparaginyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:100145238])

HSP 1 Score: 244.588 bits (623), Expect = 2.204e-73
Identity = 157/456 (34.43%), Postives = 236/456 (51.75%), Query Frame = -1
Query:   37 ISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIK--------PQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGG--ETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM 1374
            + + GWV S+   K   FL ++DG S E +Q+V   +L +   + G  ++V G +V S  + Q  E++A     +     + +  F L              S    ++  H R R   +S++ RIR+    +I+ +  TN Y  +  PI+TS DCEGAGE +K  +E  N+S            P  LTVS QLHLE +   + +V+T GP FRA  S++R HL+EF M+E E     S+ D+   +E L KT +        D++      N        G + + + +  N FI +S+ +A+ ILK++K           +     E+ LV   G  PVFV ++P+  KPFY R NE G  +T  AVDLL+P +GE+ GGS+R+     L+ R+    L +T   WYLDLR  GS PH GFG+GF+R LQ   GV NI+DV+ FPR  ++C++
Sbjct:  174 VKLQGWVRSVRAQKEVLFLHINDGSSMENLQIVAEPDLKNSVSF-GSSVEVQGMLVKSLHKKQNVELKAEGIRIIGPCDSV-DFPFKLKER----------HSPEYVRQFPHLRCRTPTFSSLLRIRSEATAAIQEFFKTNGYTHIHTPIITSNDCEGAGELFK--VEAANKSPAAGEESSFFGVPAFLTVSGQLHLEVMSGAFSRVFTFGPTFRAENSQSRRHLAEFYMVEAEISFTESLEDIMQVMESLFKTTTATLLARCPDDI------NFFSKYVSPGQKEVLDKLLKNTFIVMSYTEAINILKKAKCPFQYKPEWGCDLQTEHEKYLVKHCGEVPVFVINYPLELKPFYARDNEDGPQQTAAAVDLLVPGIGELFGGSLREERPQLLQQRLDRLGLKDT-YQWYLDLRQFGSVPHGGFGMGFERYLQCILGVENIKDVIPFPRFSHSCLL 608          
BLAST of SMED30003415 vs. Ensembl Xenopus
Match: NARS2 (asparaginyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:100145238])

HSP 1 Score: 244.588 bits (623), Expect = 2.204e-73
Identity = 157/456 (34.43%), Postives = 236/456 (51.75%), Query Frame = -1
Query:   37 ISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIK--------PQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGG--ETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM 1374
            + + GWV S+   K   FL ++DG S E +Q+V   +L +   + G  ++V G +V S  + Q  E++A     +     + +  F L              S    ++  H R R   +S++ RIR+    +I+ +  TN Y  +  PI+TS DCEGAGE +K  +E  N+S            P  LTVS QLHLE +   + +V+T GP FRA  S++R HL+EF M+E E     S+ D+   +E L KT +        D++      N        G + + + +  N FI +S+ +A+ ILK++K           +     E+ LV   G  PVFV ++P+  KPFY R NE G  +T  AVDLL+P +GE+ GGS+R+     L+ R+    L +T   WYLDLR  GS PH GFG+GF+R LQ   GV NI+DV+ FPR  ++C++
Sbjct:  174 VKLQGWVRSVRAQKEVLFLHINDGSSMENLQIVAEPDLKNSVSF-GSSVEVQGMLVKSLHKKQNVELKAEGIRIIGPCDSV-DFPFKLKER----------HSPEYVRQFPHLRCRTPTFSSLLRIRSEATAAIQEFFKTNGYTHIHTPIITSNDCEGAGELFK--VEAANKSPAAGEESSFFGVPAFLTVSGQLHLEVMSGAFSRVFTFGPTFRAENSQSRRHLAEFYMVEAEISFTESLEDIMQVMESLFKTTTATLLARCPDDI------NFFSKYVSPGQKEVLDKLLKNTFIVMSYTEAINILKKAKCPFQYKPEWGCDLQTEHEKYLVKHCGEVPVFVINYPLELKPFYARDNEDGPQQTAAAVDLLVPGIGELFGGSLREERPQLLQQRLDRLGLKDT-YQWYLDLRQFGSVPHGGFGMGFERYLQCILGVENIKDVIPFPRFSHSCLL 608          
BLAST of SMED30003415 vs. Ensembl Xenopus
Match: NARS2 (asparaginyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:100145238])

HSP 1 Score: 239.58 bits (610), Expect = 3.133e-73
Identity = 153/453 (33.77%), Postives = 228/453 (50.33%), Query Frame = -1
Query:   37 VGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIK--------PQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGG--ETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM 1365
             GWV S+   K   FL ++DG S E +Q+V   +L + +   G  ++V G +V S  + Q  E++A     +     + +  F L              S    ++  H R R   +S++ RIR+    +I+ +  TN Y  +  PI+TS DCEGAGE +K  +E  N+S            P  LTVS QLHLE +   + +V+T GP FRA  S++R HL+EF M+E E     S+ D+   +E L KT +        D++    K                 +      + +S+ +A+ ILK++K           +     E+ LV   G  PVFV ++P+  KPFY R NE G  +T  AVDLL+P +GE+ GGS+R+     L+ R+    L +T   WYLDLR  GS PH GFG+GF+R LQ   GV NI+DV+ FPR  ++C++
Sbjct:   14 TGWVRSVRAQKEVLFLHINDGSSMENLQIVAEPDLKNSSVSFGSSVEVQGMLVKSLHKKQNVELKAEGIRIIGPCDSV-DFPFKLKER----------HSPEYVRQFPHLRCRTPTFSSLLRIRSEATAAIQEFFKTNGYTHIHTPIITSNDCEGAGELFK--VEAANKSPAAGEESSFFGVPAFLTVSGQLHLEVMSGAFSRVFTFGPTFRAENSQSRRHLAEFYMVEAEISFTESLEDIMQVMESLFKTTTATLLARCPDDINFFSK---------------YVSPGQKVSLVMSYTEAINILKKAKCPFQYKPEWGCDLQTEHEKYLVKHCGEVPVFVINYPLELKPFYARDNEDGPQQTAAAVDLLVPGIGELFGGSLREERPQLLQQRLDRLGLKDT-YQWYLDLRQFGSVPHGGFGMGFERYLQCILGVENIKDVIPFPRFSHSCLL 437          
BLAST of SMED30003415 vs. Ensembl Xenopus
Match: NARS1 (asparaginyl-tRNA synthetase 1 [Source:NCBI gene;Acc:100379908])

HSP 1 Score: 147.517 bits (371), Expect = 2.408e-38
Identity = 124/458 (27.07%), Postives = 193/458 (42.14%), Query Frame = -1
Query:   43 KNISIVGWVHSISRL-KNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRG------CCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRH---RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKII-SPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYC-RPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1380
            + + + GWVH + R  K   F+ L DG     +Q VL++ L     Y G        + V G +   P   Q      L+C           D + +            +  E+     L+ RH   R +  S I ++R+      RN+     Y E+ PP L     EG    +K            +   LT S+QL+LE  +   G  + +   +RA +SRTR HL+E+  +E E     +  DL N +E L+            D ++ + KS +         E          F R+++ +A+  LKE  +    G   E  E      +RL++   N P+ +  FP   K FY  R  E      +VD+L+P VGE+VGGS+R  D + L    K   ++ T   WY D R  G+CPH G+G+G +R L +    ++I+DV  +PR    C
Sbjct:   74 QRVKVFGWVHRLRRQGKTLMFIVLRDGTG--YLQCVLSDQLCQ--CYNGLVLSTESTVAVYGTLNLVPDGKQAPGGHELAC-----------DYWEIVGLAPAGGADNLLNEESDVDVQLNNRHMMIRGENMSKIFKVRSTVIHCFRNHFFDRGYYEITPPTLVQTQVEGGSTLFKL-------DYFGEEAYLTQSSQLYLETCIPAMGDTFCIAQSYRAEQSRTRRHLAEYTHIEAEC-PFMTFEDLLNRLEDLV-----------CDVVDRVLKSPVASLLYDLHPEFKP---PKRPFRRMNYTEAITWLKEHDVKKDDGTYYEFGEDIPEAPERLMTDSINEPILLCRFPAEIKSFYMQRCAEDKRLTESVDVLMPNVGEIVGGSMRIWDSEELLEGYKREGIDATPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRHHIRDVCLYPRFVQRC 494          
BLAST of SMED30003415 vs. Ensembl Xenopus
Match: NARS1 (asparaginyl-tRNA synthetase 1 [Source:NCBI gene;Acc:100379908])

HSP 1 Score: 147.902 bits (372), Expect = 3.953e-38
Identity = 124/458 (27.07%), Postives = 194/458 (42.36%), Query Frame = -1
Query:   43 KNISIVGWVHSISRL-KNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRG------CCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRH---RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKII-SPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYC-RPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1380
            + + + GWVH + R  K   F+ L DG     +Q VL++ L     Y G        + V G +   P   Q      L+C           D + +            +  E+     L+ RH   R +  S I ++R+      RN+     Y E+ PP L     EG    +K            +   LT S+QL+LE  +   G  + +   +RA +SRTR HL+E+  +E E   + +  DL N +E L+            D ++ + KS +         E          F R+++ +A+  LKE  +    G   E  E      +RL++   N P+ +  FP   K FY  R  E      +VD+L+P VGE+VGGS+R  D + L    K   ++ T   WY D R  G+CPH G+G+G +R L +    ++I+DV  +PR    C
Sbjct:  125 QRVKVFGWVHRLRRQGKTLMFIVLRDGTG--YLQCVLSDQLCQ--CYNGLVLSTESTVAVYGTLNLVPDGKQAPGGHELAC-----------DYWEIVGLAPAGGADNLLNEESDVDVQLNNRHMMIRGENMSKIFKVRSTVIHCFRNHFFDRGYYEITPPTLVQTQVEGGSTLFKL-------DYFGEEAYLTQSSQLYLETCIPAMGDTFCIAQSYRAEQSRTRRHLAEYTHIEAECPFM-TFEDLLNRLEDLV-----------CDVVDRVLKSPVASLLYDLHPEFKP---PKRPFRRMNYTEAITWLKEHDVKKDDGTYYEFGEDIPEAPERLMTDSINEPILLCRFPAEIKSFYMQRCAEDKRLTESVDVLMPNVGEIVGGSMRIWDSEELLEGYKREGIDATPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRHHIRDVCLYPRFVQRC 545          
BLAST of SMED30003415 vs. Ensembl Mouse
Match: Nars2 (asparaginyl-tRNA synthetase 2 (mitochondrial)(putative) [Source:MGI Symbol;Acc:MGI:2142075])

HSP 1 Score: 259.996 bits (663), Expect = 9.273e-81
Identity = 159/452 (35.18%), Postives = 245/452 (54.20%), Query Frame = -1
Query:   37 ISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYK----AIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGE--TVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM 1374
            +++ GW+ S+   K   FL ++DG S E +Q+V  ++   +    G  ++V G++V S  + Q  E++A   E +           +  ++      K     E  R +  H R R +   +I R+R+    +I +Y   N ++ +  P+LTS DCEGAGE ++    + I+ P ES    P  LTVS QLHLE +   + +V+T GP FRA  S++R HL+EF M+E E   + S+ DL   +E L K  +    ++  +++EL  +         +G +   E +  NNF+ IS+ +A+EILK++           ++     E+ LV   GN PVFV ++P   KPFY R NE G   TV AVDLL+P VGE+ GGS+R+  Y  L+ R+  + L +    WYLDLR  GS PH GFG+GF+R LQ   GV NI+DV+ FPR  ++C++
Sbjct:   44 VTVQGWIRSVRSQKEVLFLHVNDGSSLESLQIVADSSFDSRELTFGSSVQVQGQLVKSQSKRQNVELKAEKIEVIG----------DCEAKAFPIKYKERHPLEYLR-QYPHLRCRTNALGSILRVRSEATAAIHSYFKDNGFVHIHTPVLTSNDCEGAGELFQVEPSSKIKGPKESFFDVPAFLTVSGQLHLEVMSGAFTQVFTFGPTFRAENSQSRRHLAEFYMVEAEISFVESLQDLMQVMEELFKATTEMVLSHCPEDVELCHQ------FIAAGQKGRLEHMLKNNFLIISYTEAIEILKQASQNFAFTPKWGVDLQTEHEKYLVRHCGNIPVFVINYPSELKPFYMRENEDGPQNTVAAVDLLVPGVGELFGGSLREERYHVLEQRLARSGLTKA-YQWYLDLRKFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFTHSCLL 477          
BLAST of SMED30003415 vs. Ensembl Mouse
Match: Nars2 (asparaginyl-tRNA synthetase 2 (mitochondrial)(putative) [Source:MGI Symbol;Acc:MGI:2142075])

HSP 1 Score: 169.088 bits (427), Expect = 3.338e-47
Identity = 112/358 (31.28%), Postives = 182/358 (50.84%), Query Frame = -1
Query:  313 ISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYK----AIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGG 1374
            +++ GW+ S+   K   FL ++DG S E +Q+V  ++   +    G  ++V G++V S  + Q  E++A   E +           +  ++      K     E  R +  H R R +   +I R+R+    +I +Y   N ++ +  P+LTS DCEGAGE ++    + I+ P ES    P  LTVS QLHLE +   + +V+T GP FRA  S++R HL+EF M+E E   + S+ DL   +E L K  +    ++  +++EL  +         +G +   E +  NNF+ IS+ +A+EILK++           ++     E+ LV   GN PVFV ++P   KPFY R NE G
Sbjct:   44 VTVQGWIRSVRSQKEVLFLHVNDGSSLESLQIVADSSFDSRELTFGSSVQVQGQLVKSQSKRQNVELKAEKIEVIG----------DCEAKAFPIKYKERHPLEYLR-QYPHLRCRTNALGSILRVRSEATAAIHSYFKDNGFVHIHTPVLTSNDCEGAGELFQVEPSSKIKGPKESFFDVPAFLTVSGQLHLEVMSGAFTQVFTFGPTFRAENSQSRRHLAEFYMVEAEISFVESLQDLMQVMEELFKATTEMVLSHCPEDVELCHQ------FIAAGQKGRLEHMLKNNFLIISYTEAIEILKQASQNFAFTPKWGVDLQTEHEKYLVRHCGNIPVFVINYPSELKPFYMRENEDG 384          
BLAST of SMED30003415 vs. Ensembl Mouse
Match: Nars (asparaginyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:1917473])

HSP 1 Score: 154.451 bits (389), Expect = 5.805e-41
Identity = 130/458 (28.38%), Postives = 202/458 (44.10%), Query Frame = -1
Query:   43 KNISIVGWVHSISRL-KNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCC------IKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRH---RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEE-QRLVSLLGNRPVFVTDFPMSQKPFYC-RPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1380
            + + + GWVH + R  KN  FL L DG     +Q VL+++L     Y G        + V G +  +P   Q      LSC+        F +   LA     +++   I  E+     L+ RH   R +  S I + R+   +  R++     Y EV  P L     EG    +K  ++   E        LT S+QL+LE  +   G V+ +   +RA +SRTR HL+EF  +E E   + +  DL N +E L+            D ++ + KS +                    F R+++  A+E LKE  +        E      E  +RL++   N P+ +  FP+  K FY  R  E      +VD+L+P VGE+VGGS+R  D + +    K   ++     WY D R  G+CPH G+G+G +R L +    Y+I+DV  +PR    C
Sbjct:   75 QRVKVFGWVHRLRRQGKNLMFLVLRDGTG--YLQCVLSDDLCQ--CYNGVVLSTESSVAVYGTLNLTPKGKQAPGGHELSCD--------FWELVGLAPAGGADNL---INEESDVDVQLNNRHMMIRGENMSKILKARSMITRCFRDHFFDRGYCEVTTPTLVQTQVEGGATLFK--LDYFGEEAF-----LTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEFTHVEAECPFL-TFEDLLNRLEDLV-----------CDVVDRVLKSPVASIVYELNPNFKP---PKRPFRRMNYSDAIEWLKEHDVKKEDGTFYEFGDDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSMRSWDSEEILEGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLSWILNRYHIRDVCLYPRFLQRC 495          
BLAST of SMED30003415 vs. Ensembl Mouse
Match: Nars (asparaginyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:1917473])

HSP 1 Score: 154.836 bits (390), Expect = 1.202e-40
Identity = 130/458 (28.38%), Postives = 202/458 (44.10%), Query Frame = -1
Query:   43 KNISIVGWVHSISRL-KNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCC------IKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRH---RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSE-EQRLVSLLGNRPVFVTDFPMSQKPFYC-RPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1380
            + + + GWVH + R  KN  FL L DG     +Q VL+++L     Y G        + V G +  +P   Q      LSC+        F +   LA     +++   I  E+     L+ RH   R +  S I + R+   +  R++     Y EV  P L     EG    +K  ++   E        LT S+QL+LE  +   G V+ +   +RA +SRTR HL+EF  +E E   + +  DL N +E L+            D ++ + KS +                    F R+++  A+E LKE  +        E      E  +RL++   N P+ +  FP+  K FY  R  E      +VD+L+P VGE+VGGS+R  D + +    K   ++     WY D R  G+CPH G+G+G +R L +    Y+I+DV  +PR    C
Sbjct:  136 QRVKVFGWVHRLRRQGKNLMFLVLRDGTG--YLQCVLSDDLCQ--CYNGVVLSTESSVAVYGTLNLTPKGKQAPGGHELSCD--------FWELVGLAPAGGADNL---INEESDVDVQLNNRHMMIRGENMSKILKARSMITRCFRDHFFDRGYCEVTTPTLVQTQVEGGATLFK--LDYFGEEAF-----LTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEFTHVEAECPFL-TFEDLLNRLEDLV-----------CDVVDRVLKSPVASIVYELNPNFKP---PKRPFRRMNYSDAIEWLKEHDVKKEDGTFYEFGDDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSMRSWDSEEILEGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLSWILNRYHIRDVCLYPRFLQRC 556          
BLAST of SMED30003415 vs. Ensembl Mouse
Match: Nars (asparaginyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:1917473])

HSP 1 Score: 154.451 bits (389), Expect = 1.384e-40
Identity = 130/458 (28.38%), Postives = 202/458 (44.10%), Query Frame = -1
Query:   43 KNISIVGWVHSISRL-KNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCC------IKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRH---RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSE-EQRLVSLLGNRPVFVTDFPMSQKPFYC-RPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1380
            + + + GWVH + R  KN  FL L DG     +Q VL+++L     Y G        + V G +  +P   Q      LSC+        F +   LA     +++   I  E+     L+ RH   R +  S I + R+   +  R++     Y EV  P L     EG    +K  ++   E        LT S+QL+LE  +   G V+ +   +RA +SRTR HL+EF  +E E   + +  DL N +E L+            D ++ + KS +                    F R+++  A+E LKE  +        E      E  +RL++   N P+ +  FP+  K FY  R  E      +VD+L+P VGE+VGGS+R  D + +    K   ++     WY D R  G+CPH G+G+G +R L +    Y+I+DV  +PR    C
Sbjct:  137 QRVKVFGWVHRLRRQGKNLMFLVLRDGTG--YLQCVLSDDLCQ--CYNGVVLSTESSVAVYGTLNLTPKGKQAPGGHELSCD--------FWELVGLAPAGGADNL---INEESDVDVQLNNRHMMIRGENMSKILKARSMITRCFRDHFFDRGYCEVTTPTLVQTQVEGGATLFK--LDYFGEEAF-----LTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEFTHVEAECPFL-TFEDLLNRLEDLV-----------CDVVDRVLKSPVASIVYELNPNFKP---PKRPFRRMNYSDAIEWLKEHDVKKEDGTFYEFGDDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSMRSWDSEEILEGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLSWILNRYHIRDVCLYPRFLQRC 557          
BLAST of SMED30003415 vs. UniProt/SwissProt
Match: sp|Q8BGV0|SYNM_MOUSE (Probable asparagine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Nars2 PE=1 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 6.486e-80
Identity = 159/452 (35.18%), Postives = 245/452 (54.20%), Query Frame = -1
Query:   37 ISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYK----AIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGE--TVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM 1374
            +++ GW+ S+   K   FL ++DG S E +Q+V  ++   +    G  ++V G++V S  + Q  E++A   E +           +  ++      K     E  R +  H R R +   +I R+R+    +I +Y   N ++ +  P+LTS DCEGAGE ++    + I+ P ES    P  LTVS QLHLE +   + +V+T GP FRA  S++R HL+EF M+E E   + S+ DL   +E L K  +    ++  +++EL  +         +G +   E +  NNF+ IS+ +A+EILK++           ++     E+ LV   GN PVFV ++P   KPFY R NE G   TV AVDLL+P VGE+ GGS+R+  Y  L+ R+  + L +    WYLDLR  GS PH GFG+GF+R LQ   GV NI+DV+ FPR  ++C++
Sbjct:   44 VTVQGWIRSVRSQKEVLFLHVNDGSSLESLQIVADSSFDSRELTFGSSVQVQGQLVKSQSKRQNVELKAEKIEVIG----------DCEAKAFPIKYKERHPLEYLR-QYPHLRCRTNALGSILRVRSEATAAIHSYFKDNGFVHIHTPVLTSNDCEGAGELFQVEPSSKIKGPKESFFDVPAFLTVSGQLHLEVMSGAFTQVFTFGPTFRAENSQSRRHLAEFYMVEAEISFVESLQDLMQVMEELFKATTEMVLSHCPEDVELCHQ------FIAAGQKGRLEHMLKNNFLIISYTEAIEILKQASQNFAFTPKWGVDLQTEHEKYLVRHCGNIPVFVINYPSELKPFYMRENEDGPQNTVAAVDLLVPGVGELFGGSLREERYHVLEQRLARSGLTKA-YQWYLDLRKFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFTHSCLL 477          
BLAST of SMED30003415 vs. UniProt/SwissProt
Match: sp|Q96I59|SYNM_HUMAN (Probable asparagine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=NARS2 PE=1 SV=3)

HSP 1 Score: 258.84 bits (660), Expect = 2.028e-79
Identity = 167/461 (36.23%), Postives = 248/461 (53.80%), Query Frame = -1
Query:   37 KNISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYK----AIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESK---IISP----GLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGG--ETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM 1380
            + I I GW+ S+   K   FL ++DG S E +QVV  + L  +    G  ++V G+++ SP + Q  E++A   + +           N  ++      K     E  R +  HFR R +   +I RIR+    +I ++   + ++ +  PI+TS D EGAGE ++      ++ P E+    P  LTVS QLHLE +   + +V+T GP FRA  S++R HL+EF M+E E   ++S+ DL   IE L K  +    +   +++EL  K          G +   E +  NNF+ IS+ +AVEILK++      +P     LR E        E+ LV   GN PVFV ++P++ KPFY R NE G   TV AVDLL+P VGE+ GG +R+  Y  L+ R+  + L E    WYLDLR  GS PH GFG+GF+R LQ   GV NI+DV+ FPR  ++C++
Sbjct:   42 ERIKIQGWIRSVRSQKEVLFLHVNDGSSLESLQVVADSGLDSRELNFGSSVEVQGQLIKSPSKRQNVELKAEKIKVIG----------NCDAKDFPIKYKERHPLEYLR-QYPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHTPIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGPTFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHK------FIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTE-------HEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLARSGLTEV-YQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLL 477          
BLAST of SMED30003415 vs. UniProt/SwissProt
Match: sp|Q6ANL4|SYN_DESPS (Asparagine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=asnS PE=3 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 3.129e-77
Identity = 149/456 (32.68%), Postives = 241/456 (52.85%), Query Frame = -1
Query:   43 ISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVH-----KNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIE-----EIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRT--FNTC 1374
            +++ GW+ +     + SFL+++DG +   +QV+   +L +     K    GC + V G + +SP +GQ  EV A S   +      + D      +   +S++         +E+ H R R +  SA+ R+R+    ++ N+     + +V  PI+T+ DCEGAGE ++      +      P  LTVS QL  E      G VYT GP FRA  S T  HL+EF M+E E    +   D+    E ++K +  D   +   ++      NL       G+    +++  ++F R+++ +AV+     ++++ G + +      I+     E+ L   +  RP+ VTD+P + KPFY R NE G+TV A+D+L+P +GE+VGGS R+  YD L  RM+ A L+  +  WYLDLR  G+ PH+GFG+GF+RL+QF TG+ NI++V+ FPRT  F  C
Sbjct:   18 VTVAGWIRTRRDTGDFSFLEVNDGSTLINMQVIADKSLGNYEEEVKKLSTGCSVMVEGVLKESPAKGQSVEVHASSVTVVG-----WADPETYPLQKKRHSLEF-------LREISHLRPRTNAISAVARVRSRLSYAVHNFFQEKGFTQVHTPIITTSDCEGAGEMFQVAATGKDGHFFGAPAGLTVSGQLQAEVYATALGDVYTFGPTFRAENSNTSRHLAEFWMIEPEMAFCDLQGDM-EVAEEMLKYVLADVLEHCVTDM------NLFDKFISKGIIERLQSVLAHDFARVTYTEAVD-----QLLASGQKFDFAVKWGIDLQSEHERYLTEQVYKRPLIVTDYPAAIKPFYMRMNEDGKTVAAMDILVPGIGELVGGSQREERYDLLAERMEAAGLDLEEYGWYLDLRKYGTVPHAGFGLGFERLVQFVTGMANIREVIPFPRTPGFAPC 449          
BLAST of SMED30003415 vs. UniProt/SwissProt
Match: sp|A6L0U5|SYN_BACV8 (Asparagine--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154) OX=435590 GN=asnS PE=3 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 5.927e-76
Identity = 156/465 (33.55%), Postives = 240/465 (51.61%), Query Frame = -1
Query:   55 ISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLT----NNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIET-------PNESIII------KPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRK---SNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIE-----EIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRT 1374
            +++ GWV +    K  +F+ L+DG +   +Q+V+     +  + K    G CI V+GE+ +S G GQ  EV+A   E L    + +  Q            K G   E  R E+ H R R + + A+ RIR     +I  +     +     PI+T+ DCEGAG+ ++   +         N +II       K  +LTVS QL  E      G +YT GP FRA  S T  HL+EF M+E E +  N + D  +  E  IK   +   +N  D+++ +       L++  +          +    F+R+ + + ++IL+E+  +  G + E      ++ +   E+ LV     RPV +TD+P   K FY + NE G+TV A+D+L P +GE++GGS R+ DYD+L +R++   +   DM WYLD R  GSCPHSGFG+GF+RLL F TG+ NI+DV+ FPRT
Sbjct:   22 VNVKGWVRTRRGSKQVNFIALNDGSTINNVQIVVDLANFDEEMLKQITTGACISVNGELTESIGSGQAAEVQARGIEVLGTCDNTYPLQ------------KKGHTMEFLR-EIAHLRPRTNTFGAVFRIRHNMAIAIHKFFHERGFFYFHTPIITASDCEGAGQMFQVTTKNLYDLKKDENGAIIYDDDFFGKQASLTVSGQLEGELAATALGAIYTFGPTFRAENSNTPRHLAEFWMIEPE-VAFNDITDNMDLAEDFIKYCVQWALDNCYDDVKFLNDMFDKGLIERLQ---------GVLKEEFVRLPYTEGIKILEEA--VVKGHKFEFPVYWGVDLASEHERYLVEEHFKRPVILTDYPKEIKAFYMKQNEDGKTVRAMDVLFPKIGEIIGGSEREADYDKLMTRIQELGIPMKDMWWYLDTRKFGSCPHSGFGLGFERLLLFVTGMTNIRDVIPFPRT 461          
BLAST of SMED30003415 vs. UniProt/SwissProt
Match: sp|Q5L8W2|SYN_BACFN (Asparagine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) OX=272559 GN=asnS PE=3 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 4.465e-75
Identity = 155/465 (33.33%), Postives = 244/465 (52.47%), Query Frame = -1
Query:   55 ISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLT----NNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKA-------IIETPNESIII------KPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRK---SNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIE-----EIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRT 1374
            +++ GWV +    K  +F+ L+DG +   +QVV+     +  + K    G C+ V+G + +S G GQ  EV+A   E L    + +  Q            K G   E  R E+ H R R + + A+ RIR     +I  +     +     PI+T+ DCEGAG+ ++        + +  N SI+       K  +LTVS QL  E      G +YT GP FRA  S T  HL+EF M+E E +  N + +  +  E  IK   R   +N AD+++ +       L++  E          +   +F+R+ + + ++IL+E+  ++ G + E      ++ +   E+ LV     RPV +TD+P   K FY + NE G+TV A+D+L P +GE++GGS R++DY++L +R++   +   DM WYLD R  G+CPHSGFG+GF+RLL F TG+ NI+DV+ FPRT
Sbjct:   22 VNVKGWVRTRRGSKQVNFIALNDGSTINNVQVVVDLANFDEEMLKQITTGACLSVNGVLTESVGAGQKAEVQAREIEVLGTCDNTYPLQ------------KKGHSMEFLR-EIAHLRPRTNTFGAVFRIRHNMAIAIHKFFHEKGFFYFHTPIITASDCEGAGQMFQVTTMNLYDLKKDANGSIVYDDDFFGKQASLTVSGQLEGELAATALGAIYTFGPTFRAENSNTPRHLAEFWMIEPE-VAFNEIQENMDLAEEFIKYCVRWALDNCADDVKFLNDMFDKGLIERLE---------GVLKEDFVRLPYTEGIKILEEA--VAKGHKFEFPVYWGVDLASEHERYLVEDHFKRPVILTDYPKEIKAFYMKQNEDGKTVRAMDVLFPKIGEIIGGSERESDYNKLMTRIEEMHIPMKDMWWYLDTRKFGTCPHSGFGLGFERLLLFVTGMSNIRDVIPFPRT 461          
BLAST of SMED30003415 vs. TrEMBL
Match: A0A068WFT4 (Asparaginyl tRNA synthetase OS=Echinococcus granulosus OX=6210 GN=EgrG_000889700 PE=4 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 3.147e-88
Identity = 181/457 (39.61%), Postives = 252/457 (55.14%), Query Frame = -1
Query:   58 VGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTG------IKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNES-IIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDN----------NFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGE----TVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 1365
            + WV SI R K K+FL ++DG S   +QVV +   V +    GC + V G++V   G     EVRA S   LS   +    +    +  +V +M         ++SE      L +RHR    +++ R+RA  K  +R  + T  YLEVD PILT+ DCEGAGE +     +  E   +  P +LTVSAQLHLEAL LG  KVYTL P FRA  S +R HL+EFLMLE ES+ + +V  LC+ IE ++    RD  +   D L  I +++L     +      + + S++           F R++F +A++ L+     +     E   F+K EEQ L   +G   VFVTDFP +QKPFYC  +   +    +V AVDLL+P VGE+VGGSVR++  + L +RM   +     + WY +LRG G  PH GFG+GFDRLL +  GVYNI+D VTFPR
Sbjct:   61 IAWVQSIRRHKTKTFLNVNDGTSPNDLQVVCSTPNVPEGLSVGCAVYVEGQMVLH-GHSHAPEVRAESVRLLSPPVNAITAE----ASHIVGAMSHSRPRLGLLRSEHG----LFWRHRLPEMASMLRLRAACKSIVRRVLQTRGYLEVDTPILTTTDCEGAGETFLVKSSSTTEKDQVAAPLHLTVSAQLHLEALALGMSKVYTLSPTFRAEPSHSRLHLAEFLMLEAESVTMTTVDALCDEIESIV----RDIASPYLDLLSTISQNDLHHILSYLSETPGAVSPSEHLKTLQSVLSRPFTRMTFHEALDYLERHGKRNSTTNTEVSGFNKEEEQALCVTVGGG-VFVTDFPAAQKPFYCAQSLTSKNTEPSVAAVDLLIPGVGELVGGSVRESQKEVLLTRMPGGETGA--LGWYANLRGHGGAPHGGFGLGFDRLLLWLLGVYNIRDTVTFPR 501          
BLAST of SMED30003415 vs. TrEMBL
Match: A0A0R3W681 (AA_TRNA_LIGASE_II domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5684 PE=4 SV=2)

HSP 1 Score: 284.648 bits (727), Expect = 8.813e-87
Identity = 183/456 (40.13%), Postives = 252/456 (55.26%), Query Frame = -1
Query:   58 DCKNISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSM-KTGI-KSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKA-IIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSR---DFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISD---NNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGETV----MAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 1386
            +   ++ + WV SI R K K+FL ++DG S   +QVV +   V +    G  I V G+VV   G+    EVRA     LS        + +     + +S  + G+ +SE      L +RHR    +A+ R+RA  K  +R  + T  YLEVD PILT+ DCEGAGE +       P E  +  P +LTVSAQLHLEALVLG  KVYTL P FRA  S +R HL+EFLMLE ES+ + +V  LC+ IE +++ ++    D  +  ++N      S L ++          ET+       F R++F +A++ L+     S     E   FSK EEQ L   +G   VF+TDFP +QKPFYC  +    +V     AVDLL+P VGE+VGGSVR++  + L ++M   +     + WY  LRG GS PH GFG+GFDRLL +  GV NI+D VTFPR
Sbjct:   36 EVPRVTTIAWVQSIRRHKTKTFLNVNDGTSPNNLQVVCSTPNVPEGLSVGSAICVEGQVVLR-GQSNESEVRAERVRLLSPPTTTTTAEASHIVGAMSHSRPRLGLLRSEHG----LFWRHRLPEIAAMLRLRATCKSIVRRALQTRGYLEVDTPILTTTDCEGAGETFLVKSTSKPEEDQVSAPLHLTVSAQLHLEALVLGMSKVYTLSPTFRAEPSHSRLHLAEFLMLEAESVTMTTVDALCDEIEGIVRDIASPYLDLLSTTSENDLHYVLSYLSETPGTVSPPKHLETLHSVLGRPFARMTFSEALDYLERYGKRSSTTNTEVSGFSKEEEQALCVSVGGG-VFITDFPAAQKPFYCAQSLISRSVTPLAAAVDLLIPGVGELVGGSVRESRREVLLTQMPGGETGA--LGWYASLRGHGSAPHGGFGLGFDRLLLWMLGVNNIRDTVTFPR 483          
BLAST of SMED30003415 vs. TrEMBL
Match: A0A1X2HS13 (Asparaginyl-tRNA synthetase OS=Syncephalastrum racemosum OX=13706 GN=BCR43DRAFT_554826 PE=3 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 1.164e-86
Identity = 153/447 (34.23%), Postives = 242/447 (54.14%), Query Frame = -1
Query:   43 ISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRK---SNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1374
            I++ GWV S+ + K  +F  ++DG + + +Q  L   L  +    G C+++ G+++ SPG+ Q +E++  S   L E+   +  Q    +   + ++              H R R +  +++ RIR+   +  R++  ++E+ +VD PILTS DCEGAGE ++        +   KP  LTVS QLH E +     +VYT GP+FRA  S T  HL+EF MLE E   I+ +  L +  E  I+  +R      AD L+   +    +L++  E S          +  F+R+++ +A++IL+ +K                 E+ L S    RPVFVTD+P+  KPFY R NE G+TV   DLLLP +GE+VGGS+R+  Y  L+++++ A +N  D  WYLDLR  G+ PH G+G+GF+R L + TG+ N+++VV  PR  N C
Sbjct:   32 ITVHGWVRSVRKQKQIAFADINDGTTFKGLQATLDPTLAER-LTTGACVELQGQLISSPGKEQTQELQVSSVRVLGESDESYPLQKKRHTLEFLRTIN-------------HLRPRGNTGASVLRIRSAAAEGFRHFFASHEFTQVDTPILTSSDCEGAGEVFQIAGGKEQAAFFGKPAYLTVSGQLHAEMMATALSRVYTFGPVFRAEASLTSRHLAEFWMLEAELAFIDKLAPLLDVTEASIQETTRHVMQKCADELQFFNRFVDKSLLERLERSI---------EKPFVRMTYTEAIDILQRAKTRFEFPTTWGSSLQSEHERYLASDYCGRPVFVTDYPIEHKPFYMRANEDGKTVACFDLLLPKIGELVGGSMREERYAPLEAKIRAAGMNMEDYQWYLDLRKYGTAPHGGYGIGFERFLLWLTGLENVREVVPVPRWVNHC 455          
BLAST of SMED30003415 vs. TrEMBL
Match: A0A068Y9N4 (Asparaginyl tRNA synthetase OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000889700 PE=4 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 2.105e-86
Identity = 180/457 (39.39%), Postives = 249/457 (54.49%), Query Frame = -1
Query:   58 VGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTG------IKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKA-IIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDN----------NFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGE----TVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 1365
            + WV SI R K K+FL ++DG S   +QVV +   V +    G  + V G++V   G     EVRA S   LS   +    +    +  +V +M         ++SE      L +RHR     A+ R+RA  K  +R  + T  YLEVD PILT+ DCEGAGE +      T  +  +  P +LTVSAQLHLEAL LG  KVYTL P FRA  S +R HL+EFLMLE ES+ + +V  LC+ IE ++    RD  +   D L    +++L     +      + + S++           F R++F +A++ L+     +     E   F+K EEQ L   +G   VFVTDFP +QKPFYC  +   +    +V AVDLL+P VGE+VGGSVR++  + L +RM   +     + WY +LRG G  PH GFG+GFDRLL +  GVYNI+D VTFPR
Sbjct:   61 IAWVQSIRRHKTKTFLNVNDGTSPNDLQVVCSTPNVPEGLSVGSAVYVEGQMVLH-GHSHAPEVRAGSVRLLSPPVNAITAE----ASHIVGAMSHSRPRLGLLRSEHG----LFWRHRLPEMGAMLRLRAACKSIVRRVLQTRGYLEVDTPILTTADCEGAGETFLVKSASTTEKDQVAAPLHLTVSAQLHLEALALGMSKVYTLSPTFRAEPSHSRLHLAEFLMLEAESVTMTTVDALCDEIESIV----RDIASPYLDLLSTTSQNDLHHILSYLSETPGAVSPSEHLKTLQSVLSCPFTRMTFHEALDYLERHGKRNSTTNTEVSGFNKEEEQALCVTVGGG-VFVTDFPAAQKPFYCAQSLTSKNTKPSVAAVDLLIPGVGELVGGSVRESQKEVLLTRMPGGETGA--LGWYANLRGHGGAPHGGFGLGFDRLLLWLLGVYNIRDTVTFPR 501          
BLAST of SMED30003415 vs. TrEMBL
Match: I1BH11 (Asparaginyl-tRNA synthetase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=RO3G_00195 PE=3 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 9.043e-86
Identity = 165/461 (35.79%), Postives = 247/461 (53.58%), Query Frame = -1
Query:   43 NISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSR----------DFFNNNADN--LELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEIL--KESKIISPGLRIEEIEFSKSEEQR-LVSLLGNRPVFVTDFPMSQKPFYCRPNEG-GETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1377
            N+SI GW+ S+ + K  SF  ++DG S + IQ +L NN   ++   G C+K++G ++DSPG+ Q KE++  S + L E    +  Q    S   + S+              H R R +  SA+ R+R    +    +    E++  + PILT+ DCEG GE +K      +E    KP  LTVS QLH E       +VYT GP FRA +S T  HL+EF MLE E+  I+ +  L +  E  ++  +R           FFN   D   LE ++KS                   D  F+R+S+ +A+E+L  ++ K   P +    ++   SE +R L S    +PVFVTD+P  QKPFY R NE  G+TV   DLL+P +GE++GGS+R+  Y+ L+ +MK AK++  +  WYLDLR  GS PH G+G+GF+R + + TG+ N+++V+  PR F  C
Sbjct:   32 NVSITGWIRSVRKQKQLSFATVNDGSSLKGIQAIL-NNEDAQSLTTGACVKITGSLMDSPGKEQTKELQVESVKVLGECDSTYPLQKKRHSTEFLRSIS-------------HLRMRGNTGSAVLRVRNAAGEGFHQFFKEQEFILTNTPILTANDCEGGGEVFKV---HTSEEFFKKPVYLTVSGQLHAETTASAMARVYTFGPTFRAEESLTSRHLAEFWMLEAEAAFIDRLDPLLDLAEASVQDTTRYVMKRCEEDLQFFNQWVDKSLLEKLQKS------------------VDQPFVRMSYTEAIEVLQKRQHKFQFPTVWGSSLQ---SEHERYLASEYCQQPVFVTDYPAEQKPFYMRANEDDGKTVGCFDLLVPGIGELIGGSLREERYELLEQKMKDAKMDLNEYQWYLDLRKYGSAPHGGYGIGFERFMLWLTGLDNVREVIPMPRWFGHC 454          
BLAST of SMED30003415 vs. Ensembl Cavefish
Match: nars2 (asparaginyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:103025541])

HSP 1 Score: 256.914 bits (655), Expect = 1.496e-79
Identity = 162/459 (35.29%), Postives = 242/459 (52.72%), Query Frame = -1
Query:   37 NISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKA-------IIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESK---IISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEG--GETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM 1377
            +I I GWV S+   KN  FL + DG S + +QVV +++L  +    GC + + G +  SP + Q  E++A   + + E + + +  F +     +  ++          +  H R R + +S++ RIR+    +I +Y   N ++++  PI+TS DCEGAGE ++          +  N      P  LTVS QLHLE +   +  VYT GP FRA  S++R HL+EF M+E E     S+ DL   +E L+KT +    ++ A+++EL  K          G     + I    F  IS+ +A++ILK S    I  P       +     E+ LV   G+ PVFVTD+P   KPFY R N+     T  AVDLL+P VGE+ GGS+R+   + LK+R+  A L ET   WYL LR  GS PH GFG+GF+R LQ   GV NI+D + F R+  +C++
Sbjct:   50 SIRIQGWVRSVRSQKNNLFLHVSDGSSLQPLQVVASSDLNTRELTFGCAVDIIGSLEKSPSKKQSVELQASHVKVIGECNPV-DFPFKIKERHSLEYIR----------QYPHLRCRTNAFSSLLRIRSEATSAIHSYFRDNGFVQIHTPIITSNDCEGAGELFQVEPAGNEHSSDKENPHFFSVPSYLTVSGQLHLEVMAGAFPAVYTFGPTFRAENSQSRRHLAEFYMVEAEISFTESLEDLLKLMEDLLKTSTEHLLSHCAEDVELFHK------YVSPGHREKVDLILKRKFNVISYTEAIDILKRSSQQFIYKPEW---GCDLQTEHEKFLVKHCGDVPVFVTDYPYDLKPFYARDNQDQPQHTAAAVDLLVPIVGELCGGSLREERPELLKTRLAGAGLEET-YAWYLQLREFGSVPHGGFGMGFERYLQCVLGVDNIKDTIPFARSSRSCLL 487          
BLAST of SMED30003415 vs. Ensembl Cavefish
Match: nars2 (asparaginyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:103025541])

HSP 1 Score: 252.292 bits (643), Expect = 3.212e-78
Identity = 155/449 (34.52%), Postives = 231/449 (51.45%), Query Frame = -1
Query:   37 NISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEG--GETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM 1377
            +I I GWV S+   KN  FL + DG S + +QVV +++L  +    GC + + G +  SP + Q  E++A   + + E + + +  F +     +  ++          +  H R R + +S++ RIR+    +I +Y   N ++++  PI+TS DCEGAGE ++  +E  N      P  LTVS QLHLE +   +  VYT GP FRA  S++R HL+EF M+E E     S+ DL   +E L+KT +    ++ A+++EL                                          K +SPG R    +     E+ LV   G+ PVFVTD+P   KPFY R N+     T  AVDLL+P VGE+ GGS+R+   + LK+R+  A L ET   WYL LR  GS PH GFG+GF+R LQ   GV NI+D + F R+  +C++
Sbjct:   50 SIRIQGWVRSVRSQKNNLFLHVSDGSSLQPLQVVASSDLNTRELTFGCAVDIIGSLEKSPSKKQSVELQASHVKVIGECNPV-DFPFKIKERHSLEYIR----------QYPHLRCRTNAFSSLLRIRSEATSAIHSYFRDNGFVQIHTPIITSNDCEGAGELFQ--VEVKNPHFFSVPSYLTVSGQLHLEVMAGAFPAVYTFGPTFRAENSQSRRHLAEFYMVEAEISFTESLEDLLKLMEDLLKTSTEHLLSHCAEDVELFH----------------------------------------KYVSPGHRW-GCDLQTEHEKFLVKHCGDVPVFVTDYPYDLKPFYARDNQDQPQHTAAAVDLLVPIVGELCGGSLREERPELLKTRLAGAGLEET-YAWYLQLREFGSVPHGGFGMGFERYLQCVLGVDNIKDTIPFARSSRSCLL 443          
BLAST of SMED30003415 vs. Ensembl Cavefish
Match: nars1 (asparaginyl-tRNA synthetase 1 [Source:NCBI gene;Acc:103029189])

HSP 1 Score: 159.458 bits (402), Expect = 1.916e-42
Identity = 133/453 (29.36%), Postives = 198/453 (43.71%), Query Frame = -1
Query:   43 KNISIVGWVHSISRL-KNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEV-RALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRH---RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKII-SPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYC-RPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1380
            + + + GWVH + R  KN  F+ L DG     +Q VLT+ L     Y G  +     V      G +K V          E H  F +   LA     +++   +  E+     L+ RH   R +  S I R+R+   Q  R++  +  Y E+ PP L     EG    +K            +   LT S+QL+LE  +   G  + +   +RA +SRTR HLSE+  +E E     S  DL N +E L+            D ++ + KS           +          F R+++ +A+E LKE  I    G   E  E      +RL++   N  + +  FP   K FY  R  E      +VD+L+P VGE+VGGS+R  D D L    K   ++ T   WY D R  GSCPH G+G+G +R L +    ++I+DV  +PR    C
Sbjct:  137 QRVKVFGWVHRLRRQGKNLLFIVLRDGTG--FLQCVLTDKLCQ--CYNGLVLSTESTVALY---GTVKPVPEGKQAPGGHELHCDFWEMIGLAPAGGADNL---LNEESDVDVQLNNRHMMIRGENVSKILRVRSTVTQCFRDHFFSRGYYEITPPTLVQTQVEGGSTLFKL-------DYFGEQAYLTQSSQLYLETCLPALGDTFCIAQSYRAEQSRTRRHLSEYTHIEAEC-PFMSYEDLLNRLEDLV-----------CDVVDRVLKSPAAALLYDINPDFKP---PKRPFKRMNYTEAIEWLKEHDIKKDDGTYYEFGEDIPEAPERLMTDSINETILLCRFPAEIKSFYMQRCQEDRRLTESVDVLMPNVGEIVGGSMRIWDADELLEGYKREGIDPTPYYWYTDQRKFGSCPHGGYGLGLERFLTWLLNRHHIRDVCLYPRFIQRC 557          
BLAST of SMED30003415 vs. Ensembl Cavefish
Match: nars1 (asparaginyl-tRNA synthetase 1 [Source:NCBI gene;Acc:103029189])

HSP 1 Score: 135.961 bits (341), Expect = 1.756e-34
Identity = 124/451 (27.49%), Postives = 191/451 (42.35%), Query Frame = -1
Query:   43 KNISIVGWVHSISRL-KNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEV-RALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRH---RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1380
            + + + GWVH + R  KN  F+ L DG     +Q VLT+ L     Y G  +     V      G +K V          E H  F +   LA     +++   +  E+     L+ RH   R +  S I R+R+   Q  R++  +  Y E+ PP L     EG    +K            +   LT S+QL+LE  +   G  + +   +RA +SRTR HLSE+  +E E     S  DL N +E L+            D ++ + KS           +          F R+++ +A+E LKE  I     + ++  + +  E      L    + +  F +S                 VD+L+P VGE+VGGS+R  D D L    K   ++ T   WY D R  GSCPH G+G+G +R L +    ++I+DV  +PR    C
Sbjct:   75 QRVKVFGWVHRLRRQGKNLLFIVLRDGTG--FLQCVLTDKLCQ--CYNGLVLSTESTVALY---GTVKPVPEGKQAPGGHELHCDFWEMIGLAPAGGADNL---LNEESDVDVQLNNRHMMIRGENVSKILRVRSTVTQCFRDHFFSRGYYEITPPTLVQTQVEGGSTLFKL-------DYFGEQAYLTQSSQLYLETCLPALGDTFCIAQSYRAEQSRTRRHLSEYTHIEAEC-PFMSYEDLLNRLEDLV-----------CDVVDRVLKSPAAALLYDINPDFKP---PKRPFKRMNYTEAIEWLKEHDI-----KKDDGTYYEFGEVCAPLHLNINIMNIVCFCVS-------------LWGQVDVLMPNVGEIVGGSMRIWDADELLEGYKREGIDPTPYYWYTDQRKFGSCPHGGYGLGLERFLTWLLNRHHIRDVCLYPRFIQRC 475          
BLAST of SMED30003415 vs. Ensembl Cavefish
Match: dars1 (aspartyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-061110-135])

HSP 1 Score: 56.225 bits (134), Expect = 4.005e-8
Identity = 28/106 (26.42%), Postives = 52/106 (49.06%), Query Frame = -1
Query:   58 FVTD-FPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 372
            +V D +P++ +PFY  P+           +     E++ G+ R  D   L  R  H  ++   +  Y+D    G+ PH+G G+G +R+   + G++N++    FPR
Sbjct:  278 YVLDKYPLAVRPFYTMPDPSNPKYSNSYDMFMRGEEILSGAQRVHDAQLLTERATHHGIDLEKIKAYIDSFRYGAPPHAGGGIGLERVTMLYLGLHNVRQTSMFPR 383          

HSP 2 Score: 51.2174 bits (121), Expect = 1.354e-6
Identity = 31/106 (29.25%), Postives = 52/106 (49.06%), Query Frame = -1
Query:  697 AIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLG-YGKVYTLGPIFRANKSRTRHHLSEFLMLEVE 1011
            AI R+++   Q  R+ +I   ++E+  P + S   EG    +         S       L  S QL+ +  +   + KV+ +GP+FRA  S T  HL+EF+ L++E
Sbjct:  156 AIFRLQSGVCQLFRDTLINKGFVEIQTPKIISAASEGGANVFTV-------SYFKTSAYLAQSPQLYKQMCICADFDKVFCVGPVFRAEDSNTHRHLTEFVGLDIE 254          
BLAST of SMED30003415 vs. Ensembl Sea Lamprey
Match: dars1 (aspartyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-061110-135])

HSP 1 Score: 93.2041 bits (230), Expect = 1.384e-20
Identity = 80/335 (23.88%), Postives = 156/335 (46.57%), Query Frame = -1
Query:   58 RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLG-YGKVYTLGPIFRANKSRTRHHLSEFLMLEVE---SININSVID-LCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRI-EEIEFSKSEEQ---RLVSLLGNRPVFVTD-FPMSQKPFYCRPN-EGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 1029
            R     AI R++A      R  +I   ++E+  P + S   EG    +       N         L  S QL+ +  + G + KV+ +GP+FRA  S T  HL+EF+ L++E   + + + V++ + +++  + K L               R    +Q+          + +  +  +R+ F +A+ +L+E+     G+ + +E + S   E+   RLV    +   F+ D +P++ +PFY  P+    +T  + D+ +    E++ G+ R  D + L  R +H  ++   +  Y+D    G+ PH+G G+G +R+   + G++N++    FPR
Sbjct:  218 RTTTSQAIFRLQAGVCHLFRETLINKGFVEIQTPKIISAASEGGANVFTVTYFKTNAY-------LAQSPQLYKQMCISGDFEKVFCIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYHEVVESIGDTLVQIFKGLQ-------------TRYQTEIQTVGRQYPAEPFKFLEPS--LRLEFPEALAMLREA-----GVEMGDEEDLSTPNEKLLGRLVKQKYDTDFFILDKYPLAVRPFYTMPDHRDPKTSNSYDMFMR-GEEILSGAQRVHDPELLTERARHHGIDLEKIKAYIDSFRYGAPPHAGGGIGLERVTMLYLGLHNVRQTSMFPR 524          
BLAST of SMED30003415 vs. Ensembl Yeast
Match: SLM5 (Mitochondrial asparaginyl-tRNA synthetase [Source:SGD;Acc:S000000618])

HSP 1 Score: 226.483 bits (576), Expect = 9.644e-69
Identity = 170/474 (35.86%), Postives = 242/474 (51.05%), Query Frame = -1
Query:   55 ISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVV--LTNN---LVHKNFYRGCCIKVSGEVVDS------PGEGQIK-EVRALS-CESLSENHHIFNDQFNLASETLVNSMKTGIKSETAR--KELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIET-PNESIII-KPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCN----SIEHLIKT--------LSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEI---EFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEG-GETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNET-DMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRT 1374
            ISI GW+ SI  LK  +FL L DG S   +++V  LTN       K    G  + +S     S      P E QIK  V+++     +SEN+ +                    K +T R  + L   ++R    SAI R+R+F +     Y   N + +V PPILTS DCEGAGE ++    T P  S    KP  LTVS QLHLE L L   + +TL P FRA KS T  HLSEF MLEVE   +NSV +L +    +I+H+IK         L + F ++  +N      S L  ++E   ++   E + +  +  I++  A+EILK+        + E           E+ L       PVFVTD+P   KPFY + N    +TV   DLL+P +GE++GGS+R+ DYD+L   MK   +N + +++WY+ LR  GS PH GFG+GF+R + +  G +NI+D + F RT
Sbjct:   34 ISINGWIKSIRLLKRIAFLDLQDGTSVNPLRIVIPLTNTDEVQFLKILKTGQTLSISNATWQSTPNRKQPFELQIKNPVKSIKLVGPVSENYPLQK------------------KYQTLRYLRSLPTLKYRTAYLSAILRLRSFVEFQFMLYFQKNHFTKVSPPILTSNDCEGAGELFQVSTNTSPTASSYFGKPTYLTVSTQLHLEILALSLSRCWTLSPCFRAEKSDTPRHLSEFWMLEVEMCFVNSVNELTSFVETTIKHIIKACIDNQQELLPKQFISSQENNAS----SELSINQETQQIKTRWEDLINEKWHNITYTNAIEILKKRHNEVSHFKYEPKWGQPLQTEHEKFLAGEYFKSPVFVTDYPRLCKPFYMKQNSTPDDTVGCFDLLVPGMGEIIGGSLREDDYDKLCREMKARGMNRSGELDWYVSLRKEGSAPHGGFGLGFERFISYLYGNHNIKDAIPFYRT 485          
BLAST of SMED30003415 vs. Ensembl Yeast
Match: DED81 (Cytosolic asparaginyl-tRNA synthetase; required for protein synthesis, catalyzes the specific attachment of asparagine to its cognate tRNA [Source:SGD;Acc:S000001061])

HSP 1 Score: 151.754 bits (382), Expect = 1.247e-40
Identity = 124/458 (27.07%), Postives = 207/458 (45.20%), Query Frame = -1
Query:   43 KNISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHK----NFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRH---RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEF----SKSEEQRLVSLLGNRPVFVTDFPMSQKPFYC-RPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1380
            + + + GW+H +   K   F+ L DG     IQ VL+ +L       +      + + G +V  P EG+     A     L+ +++          ++  N +  G         LL  RH   R D  SA+ ++RA   +S+R         EV PP +     EG    +K        +   +   LT S+QL+LE  +   G VYT+   FRA KS TR HLSE+  +E E +   +  DL   IE LI   S  +   +     L+++ N             +       F+R+ ++ A+  L E  I +     E+ +F    +++ E+++   +G  P+F+T FP+  K FY  R ++      +VD+L+P VGE+ GGS+R  D D L +  K   ++     W++D R  G+CPH G+G+G +R+L +    + ++D   +PR    C
Sbjct:  130 QRVKVSGWIHRLRSNKKVIFVVLRDGSG--FIQCVLSGDLALAQQTLDLTLESTVTLYGTIVKLP-EGKT----APGGVELNVDYYEVVGLAPGGEDSFTNKIAEGSDPSL----LLDQRHLALRGDALSAVMKVRAALLKSVRRVYDEEHLTEVTPPCMVQTQVEGGSTLFKM-------NYYGEEAYLTQSSQLYLETCLASLGDVYTIQESFRAEKSHTRRHLSEYTHIEAE-LAFLTFDDLLQHIETLI-VKSVQYVLEDPIAGPLVKQLN------------PNFKAPKAPFMRLQYKDAITWLNEHDIKNE--EGEDFKFGDDIAEAAERKMTDTIGV-PIFLTRFPVEIKSFYMKRCSDDPRVTESVDVLMPNVGEITGGSMRIDDMDELMAGFKREGIDTDAYYWFIDQRKYGTCPHGGYGIGTERILAWLCDRFTVRDCSLYPRFSGRC 552          
BLAST of SMED30003415 vs. Ensembl Yeast
Match: DPS1 (Aspartyl-tRNA synthetase, primarily cytoplasmic; homodimeric enzyme that catalyzes the specific aspartylation of tRNA(Asp); class II aminoacyl tRNA synthetase; binding to its own mRNA may confer autoregulation; shares five highly conserved amino acids with human that when mutated cause leukoencephalopathy characterized by hypomyelination with brain stem and spinal cord involvement and leg spasticity (HBSL) [Source:SGD;Acc:S000003941])

HSP 1 Score: 104.76 bits (260), Expect = 1.763e-24
Identity = 82/328 (25.00%), Postives = 147/328 (44.82%), Query Frame = -1
Query:   58 SAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLG-YGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTD------FPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETD--MNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 1014
             AI RI+A   +  R Y+ T ++ EV  P L     EG    ++        +       L  S Q + + L++  + +VY +GP+FRA  S T  H++EF  L++E        ++ +++  L   +  +     A  +EL+RK   V+  +            D   +R+++++ +E+L+     + G  I + E   +E ++ +  L  R  + TD      FP+  +PFY  P+                 E++ G+ R  D+  L+ RMK   L+  D  +  Y D    G  PH+G G+G +R++ F+  + NI+    FPR
Sbjct:  245 QAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEV-------TYFKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRHMTEFTGLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLP---------KDGKMVRLTYKEGIEMLR-----AAGKEIGDFEDLSTENEKFLGKL-VRDKYDTDFYILDKFPLEIRPFYTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHALLQERMKAHGLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPR 550          
BLAST of SMED30003415 vs. Ensembl Nematostella
Match: EDO42109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2H8])

HSP 1 Score: 152.14 bits (383), Expect = 3.033e-40
Identity = 124/462 (26.84%), Postives = 202/462 (43.72%), Query Frame = -1
Query:   43 DCKN--ISIVGWVHSISRL-KNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRH---RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSE------FLMLEVESININSVIDLCNSIEHLIKT-LSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRP-NEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1386
            DC+   + I GWVH + R  KN  F+ L DG     +Q VLT+ L H   Y    +     V      G +K V     +S    H +  D + L  E+    +   +  E+A    L  RH   R +  + I R+R+      R +     Y+E+ PP +     EG    +K        +   +   LT S+QL+LE  +   G V+ +   +RA +SRTR HL+E      +L    ES NI ++   C +I  ++K+ +   F  + +     + K+  ++    +    L  +I+   F                     L+I   +  +  E+++   + N P+ +  FP+  K FY +  ++      +VDLL+P VGE++GGS+R   YD L    K   ++     WY D R  GSCPH G+G+G +R L +     +I+DV  +PR    C
Sbjct:  140 DCREQRVKIFGWVHRLRRQGKNLMFVVLRDGTG--FLQCVLTDILCHT--YEALVLSTEATVCLY---GVVKAVP--EGKSAPGGHEMAVDYWELVGESPAGGVDNLVNEESAIDTQLDNRHIMLRGETLAKILRMRSVVTHCFREHYFDRGYVELTPPCMVQTQVEGGSTLFKF-------NYFGEDAFLTQSSQLYLETAIPALGDVFCIAESYRAEQSRTRRHLAETFDLLIYLGTRPESCNIVAI--YCQAINQVLKSHIPCSFCTDLSLRPRPVHKACRLRFLSTALFSRLISSINSETFT--------------------LKIRVNDIPEMPERKMTDQI-NEPILLCRFPVEIKSFYMQKCDDDRRLTESVDLLMPGVGEIIGGSMRMWKYDELIEGYKREGIDPAPYFWYTDQRKYGSCPHGGYGLGLERFLTWLLNRQHIRDVCFYPRFVGRC 562          
BLAST of SMED30003415 vs. Ensembl Nematostella
Match: EDO42231 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S265])

HSP 1 Score: 90.1225 bits (222), Expect = 2.202e-19
Identity = 100/460 (21.74%), Postives = 195/460 (42.39%), Query Frame = -1
Query:   58 KNISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQF---NLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSI-----------RNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLE-ALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNR---PVFVTD-FPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 1380
            K + +   +H+      + F+ L D R   +  +   +++V K+  +         ++D  GE +    +  SC    ++  I  D+    +L+   L   ++   + ET   EL H        + I  +R    Q+I           R ++ +  + E+  P + S   EG    ++        S       L  S QL+ + AL   + KVYT+G +FRA  S T  HL+EF+ L+VE        ++  +I  +   + +      A+++  ++K    +  +F               + + +++ V++L+E+ I    +  EE + S   E+ L  L+  +     F+ D +P+  +PFY  P+     V     +     EV+ G+ R  D ++LK R  H  ++   +  Y+D    G+ PH+G G+G  R++  +  ++N++    FPR
Sbjct:   67 KRVLVRARIHTSRATGKQCFMTLRD-RQYTVQALCAASDVVSKHMVKFAAGINRESIIDVEGEVKAAAQKIKSCSQ--QDVEILVDKLFVISLSEPRLPLQIEDASRPET--DELAHVNQDTRLDNRIIDLRTVPNQAIFSIEAGVCKLFREFLDSKGFHEIHTPKIISAASEGGANVFEV-------SYFKGKAFLAQSPQLYKQMALTGDFDKVYTIGSVFRAEDSNTHRHLTEFIGLDVEMSFYEHYHEVVRTIGDMFNYIFKGLQERYAEDIAKVQKQYPSEPFKFLEPA-----------LILEYREGVDMLREAGI---EMGYEE-DLSTPNEKFLGKLVKQKYDTDFFILDKYPLCIRPFYTMPDPFNPNVSNSYDMFIRGEEVLSGAQRIHDPEKLKERASHHGIDLETIKSYIDSFRYGAPPHAGGGIGLARVVMLYLDLHNVRKSSMFPR 499          
BLAST of SMED30003415 vs. Ensembl Nematostella
Match: EDO36953 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH39])

HSP 1 Score: 79.337 bits (194), Expect = 2.600e-18
Identity = 36/85 (42.35%), Postives = 49/85 (57.65%), Query Frame = -1
Query:   43 VDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 297
            VDLL+P VGE++GGS+R   YD L    K   ++     WY D R  GSCPH G+G+G +R L +     +I+DV  +PR    C
Sbjct:    1 VDLLMPGVGEIIGGSMRMWKYDELIEGYKREGIDPAPYFWYTDQRKYGSCPHGGYGLGLERFLTWLLNRQHIRDVCFYPRFVGRC 85          
BLAST of SMED30003415 vs. Ensembl Medaka
Match: nars2 (asparaginyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:101171019])

HSP 1 Score: 252.677 bits (644), Expect = 5.620e-78
Identity = 160/459 (34.86%), Postives = 241/459 (52.51%), Query Frame = -1
Query:   37 KNISIVGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETP-----NE-SIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISD---NNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEG--GETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM 1380
            +N+ I GWV S    K   FL ++DG S + +QV+    +       GC ++V G +  SP   Q  E+ A     + E + + +  F +     +  ++          + LH R R + +S++ RIR+    ++ +Y   N +L +  P +TS DCEGAGE ++  +E P     NE S    P  LTVS QLHLE +   + +VYT GP FRA  S++R HL+EF M+E E     S+ DL   +E L ++++     +  ++++L  K                +T+ D    +F  I++ +A++ILK S            +     E+ LV   GN PVFVTD+P   KPFY R N+     T  AVDLL+P VGE+ GGS+R+   D L+SR+    L +T  +WYLDLR  GS PH GFG+GF+R LQ   GV NI+DV+ FPR  ++C++
Sbjct:   49 ENVRIQGWVRSFRPQKQNLFLHVNDGSSLKSLQVIAPAGMNDPLLGFGCAVEVKGILKKSPHSKQPVELEAEQIRVIGECNPV-DFPFKIKERHSLEYIR----------QFLHLRCRTNAFSSLLRIRSEATAAVHSYFKNNGFLLIHTPTITSNDCEGAGELFQ--VEPPGTTFANEGSFFSVPVYLTVSGQLHLEVMSGAFPRVYTFGPTFRAENSQSRRHLAEFFMVEAEISFTESIEDLTKVMEELFRSVTESVLAHCEEDVDLFHK---------YVAPGHRDTLDDMLRKSFPVITYTEAIDILKRSSETFTFPTDWGCDLMTEHEKFLVKHCGNIPVFVTDYPYDLKPFYARDNQDHPKHTAAAVDLLVPGVGELCGGSLREERLDLLRSRLGECGLEDT-YSWYLDLRRFGSVPHGGFGLGFERYLQCILGVDNIKDVIPFPRFSHSCLL 484          
BLAST of SMED30003415 vs. Ensembl Medaka
Match: nars2 (asparaginyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:101171019])

HSP 1 Score: 233.032 bits (593), Expect = 6.895e-71
Identity = 153/451 (33.92%), Postives = 229/451 (50.78%), Query Frame = -1
Query:   37 VGWVHSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETP-----NE-SIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEG--GETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM 1365
            +GWV S    K   FL ++DG S + +QV+    +       GC ++V G +  SP   Q  E+ A     + E + + +  F +     +  ++          + LH R R + +S++ RIR+    ++ +Y   N +L +  P +TS DCEGAGE ++  +E P     NE S    P  LTVS QLHLE +   + +VYT GP FRA  S++R HL+EF M+E E     S+ DL   +E L ++++     +  ++++L  K                  +S      I++ +A++ILK S            +     E+ LV   GN PVFVTD+P   KPFY R N+     T  AVDLL+P VGE+ GGS+R+   D L+SR+            YLDLR  GS PH GFG+GF+R LQ   GV NI+DV+ FPR  ++C++
Sbjct:   32 LGWVRSFRPQKQNLFLHVNDGSSLKSLQVIAPAGMNDPLLGFGCAVEVKGILKKSPHSKQPVELEAEQIRVIGECNPV-DFPFKIKERHSLEYIR----------QFLHLRCRTNAFSSLLRIRSEATAAVHSYFKNNGFLLIHTPTITSNDCEGAGELFQ--VEPPGTTFANEGSFFSVPVYLTVSGQLHLEVMSGAFPRVYTFGPTFRAENSQSRRHLAEFFMVEAEISFTESIEDLTKVMEELFRSVTESVLAHCEEDVDLFHK-----------YVAPGHRVSPEGH-SITYTEAIDILKRSSETFTFPTDWGCDLMTEHEKFLVKHCGNIPVFVTDYPYDLKPFYARDNQDHPKHTAAAVDLLVPGVGELCGGSLREERLDLLRSRLGE----------YLDLRRFGSVPHGGFGLGFERYLQCILGVDNIKDVIPFPRFSHSCLL 447          
BLAST of SMED30003415 vs. Ensembl Medaka
Match: nars1 (asparaginyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101158962])

HSP 1 Score: 157.918 bits (398), Expect = 6.532e-42
Identity = 126/453 (27.81%), Postives = 196/453 (43.27%), Query Frame = -1
Query:   43 KNISIVGWVHSISRL-KNKSFLKLHDGRSNEMIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRH---RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEI--EFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYC-RPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1380
            + + + GWVH + R  KN  F+ L DG     +Q VL++ L     Y G  +     VV     G I  V     +     H +  D + L            +  E+     L+ RH   R +  S I R+R+   Q  R++  +  Y E+ PP L     EG    +       N +   +   LT S+QL+LE  +   G  + +   +RA +SRTR HL+E+  +E E   I +  DL N +E L+  +      + A  L      N                     F R+++ +A+E LKE  +        E   +  ++ E+++   + N  + +  FP   K FY  R  E      +VD+L+P VGE+VGGS+R  D D L    K   ++ T   WY D R  G+CPH G+G+G DR L +    ++I+DV  +PR    C
Sbjct:  137 QRVKVFGWVHRLRRQGKNLMFIVLRDGTG--FLQCVLSDKLCQ--CYNGLMLSTESSVVLY---GTINAVP--EGKQAPGGHELHCDFWELIGLAPAGGADNLLNEESDVDVQLNNRHMMIRGENVSKILRVRSTVTQCFRDHFFSRGYYEITPPTLVQTQVEGGSTLF-------NLNYFGEEAYLTQSSQLYLETCIPALGDTFCIAQSYRAEQSRTRRHLAEYTHIEAECPFI-TFEDLLNRLEDLVCDVVDRVLKSPAGQLLYDINPNF--------------QPPKRPFKRMNYTEAIEWLKEHDVKKDDGSYYEFGEDIPEAPERQMTDAI-NETILLCRFPAEIKSFYMQRCPEDRRLTESVDVLMPNVGEIVGGSMRIWDSDELLDGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLDRFLTWLLNRHHIRDVCLYPRFIQRC 557          
BLAST of SMED30003415 vs. Ensembl Medaka
Match: dars1 (aspartyl-tRNA synthetase 1 [Source:NCBI gene;Acc:100049512])

HSP 1 Score: 88.5817 bits (218), Expect = 2.254e-18
Identity = 78/334 (23.35%), Postives = 151/334 (45.21%), Query Frame = -1
Query:   58 RYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLG-YGKVYTLGPIFRANKSRTRHHLSEFLMLEVE---SININSVID-LCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRI-EEIEFSKSEEQ---RLVSLLGNRPVFVTD-FPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 1029
            R     A+ R+++   Q  R+ +    ++E+  P + S   EG    +         S       L  S QL+ +  +   + KV+ +GP+FRA  S T  HL+EF+ L++E   + + + VI+ + +++  + K L RD F      +     S   +  E +              +R+ + + V +L+E+     G+ + +E + S   E+   RLV    +   +V D +P++ +PFY  P+           +     E++ G+ R  D   L  R +H +++   +  Y+D    G+ PH+G G+G +R+   + G++N++    FPR
Sbjct:  218 RTTTSQAVFRLQSGVCQLFRDTLTKKGFVEIQTPKIISAASEGGANVFTV-------SYFKTSAYLAQSPQLYKQMCICADFDKVFCVGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYHEVIESITDTMVQIFKGL-RDNFQTEIQTVNKQFPSEPFKFLEPT--------------LRLEYTEGVAMLREA-----GVEMGDEDDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPHNPKYSNSYDMFMRGEEILSGAQRVHDAQLLTERAQHHQIDLEKIKSYIDSFRYGAPPHAGGGIGLERVCMLYLGLHNVRQTSMFPR 524          
BLAST of SMED30003415 vs. Ensembl Medaka
Match: si:ch211-256m1.8 (uncharacterized LOC101165397 [Source:NCBI gene;Acc:101165397])

HSP 1 Score: 55.8398 bits (133), Expect = 9.134e-8
Identity = 59/251 (23.51%), Postives = 103/251 (41.04%), Query Frame = -1
Query:   58 VYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNR--------PVFVTDFPMSQKPFYCRPNEGGE--TVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 780
             Y + P FR       H L++F  +E E +    + D  +  E  +  L+R     ++D L L     L                 ++   RI   QA+ ++  +  +      E ++  + E  R ++  G R         V++T+      PFY    EG +     A DLLL  +GE VG   R +  + ++  + H K+ E    WY+D+R       SG+G+G +R L +     +++D+   PR
Sbjct: 1332 TYYISPSFRGEDPDATH-LNQFYHVECELLG--DMDDAISVAEGYLGHLTRSMLKKHSD-LILSSAGTLTHVTALLSKLQ-----GNSALPRIPLDQAIPMMPSADCL------EWVQDGQPEFGRKLTRKGERVLIEKYGGAVWLTEMDHLGVPFYQAYVEGTKRHKAKAADLLL-GLGETVGLGERHSTREMVQEALVHHKVPEESYKWYIDMRQVKPLLTSGWGMGTERYLCWLLQHNDVRDLHIIPR 1566          
BLAST of SMED30003415 vs. Planmine SMEST
Match: SMESG000000003.1 (SMESG000000003.1)

HSP 1 Score: 837.795 bits (2163), Expect = 0.000e+0
Identity = 418/418 (100.00%), Postives = 418/418 (100.00%), Query Frame = -1
Query:   37 MIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM 1290
            MIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQSEEFSGLELLSETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM
Sbjct:    1 MIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSENHHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQSEEFSGLELLSETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTCIM 418          
BLAST of SMED30003415 vs. Planmine SMEST
Match: SMESG000064550.1 (SMESG000064550.1)

HSP 1 Score: 140.584 bits (353), Expect = 1.931e-36
Identity = 125/452 (27.65%), Postives = 201/452 (44.47%), Query Frame = -1
Query:   43 HSISRLKNKSFLKLHDGRSNEMIQVVLTNNLVH----KNFYRGCCIKVSGEVVDSPGEGQIK---EVRALSCESLS--ENHHIFNDQFNLASETLV--NSMKTGIKSETARKELLHFRHRYDCYSAIGRIRAFTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESININSVIDLCNSIEHLIKTLSRDFFNNNADNLEL-IRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKII-SPGLRIE-EIEFSKSEEQRLVSLLGNRPVFVTDFPMSQKPFY-CRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPRTFNTC 1353
            H   + K   FL L DG     +Q VL + L          R C + + G V + P + +     E+ A   E +   E         N  SE  V  N+    I+ E   K +L              +++F  ++ R +     + E  PP +    CEG    +K            +   L+ S+QL+LE LV   G  + +   +RA KSRTR HLSE+  +E E ++  S  DL   IE ++ ++S+         L L I  S L+                +  F R+ ++ A++ L E  I  + G + E   +  ++ E+R+  ++ N+P+ +T FP+  K FY  + ++      +VD+L+P VGE+VGGS+R  D   L +      L+ T   WY D+R  GS PH G+G+GF+R L +     +I+DV  +PR    C
Sbjct:   41 HLRKQSKKLWFLTLRDGTG--YLQCVLEDKLCKIKEASQLERECSVAIYGTVKELPADNKTVGGIELIADFWELIGGVERAGGIESVVNADSEPDVQFNNRHLMIRGENTSKTIL--------------MQSFAFEAFRKFYKNGGFSETAPPTIVQTQCEGGSTLFKF-------DYFGEDAYLSQSSQLYLETLVPVLGNCFCITRSYRAEKSRTRRHLSEYNHIEAE-LDFISFDDLLTHIEDMLVSVSK---------LALEIGGSTLLDVNPNYKPL-------EKPFCRMEYKDAIKFLDEHNICKAEGGKYEFGDDIPEAAERRMTDII-NKPIMLTRFPVELKAFYMAKCHDDPRVTESVDVLIPGVGEIVGGSMRIWDSKELLAGYARENLDPTPYYWYTDMRAFGSSPHGGYGLGFERFLTWMLDKEHIRDVCLYPRYTGRC 451          
BLAST of SMED30003415 vs. Planmine SMEST
Match: SMESG000009022.1 (SMESG000009022.1)

HSP 1 Score: 76.2554 bits (186), Expect = 9.196e-15
Identity = 80/315 (25.40%), Postives = 148/315 (46.98%), Query Frame = -1
Query:   58 NYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLE-ALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVE---SININSVI-DLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIE-FSKSEE----QRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLK-SRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 969
            +Y+ +  + +++ P + S   EG    ++  ++  N+        L  S QL+ + A+V G  KVYT+  +FRA  S T  HL+EF  L++E   S + + V+  +C+++ H+ K L +    NNA  +  ++K   ++  EF               + ++F + V +L E+     G+ + E E  + + E    + +    G     +  FP++ +PFY  P+                 E++ G+ R  D   L+ S +KH    +T +  YL+    G  PH+G G+G +R++  + G+ NI+ V  FPR
Sbjct:  105 SYLRSQGFRDINCPSIISAASEGGANVFE--VKYFNDKAY-----LAQSPQLYKQMAIVGGCKKVYTISRVFRAENSNTHRHLTEFTGLDLEMQFSRHYHEVLHTICDTMVHIFKELEK----NNAAEIAAVKKQFNIEPFEFLEPT-----------LILNFSEGVAMLNEA-----GIEMGEFEDLTTTNEKILGKLIKKKFGTDFYVLDKFPLAVRPFYTMPDADYPGFSNSYDFFMRGEEIMSGAQRVHDPVMLRESAVKHGIKLDT-IKDYLESFEYGCSPHAGGGIGLERVVMLYLGLDNIRRVSMFPR 391          
BLAST of SMED30003415 vs. Planmine SMEST
Match: SMESG000009022.1 (SMESG000009022.1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.057e-14
Identity = 80/315 (25.40%), Postives = 148/315 (46.98%), Query Frame = -1
Query:   58 NYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKPQNLTVSAQLHLE-ALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVE---SININSVI-DLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQXXXXXXXXXXXETISDNNFIRISFQQAVEILKESKIISPGLRIEEIE-FSKSEE----QRLVSLLGNRPVFVTDFPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDTDYDRLK-SRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGVYNIQDVVTFPR 969
            +Y+ +  + +++ P + S   EG    ++  ++  N+        L  S QL+ + A+V G  KVYT+  +FRA  S T  HL+EF  L++E   S + + V+  +C+++ H+ K L +    NNA  +  ++K   ++  EF               + ++F + V +L E+     G+ + E E  + + E    + +    G     +  FP++ +PFY  P+                 E++ G+ R  D   L+ S +KH    +T +  YL+    G  PH+G G+G +R++  + G+ NI+ V  FPR
Sbjct:  128 SYLRSQGFRDINCPSIISAASEGGANVFE--VKYFNDKAY-----LAQSPQLYKQMAIVGGCKKVYTISRVFRAENSNTHRHLTEFTGLDLEMQFSRHYHEVLHTICDTMVHIFKELEK----NNAAEIAAVKKQFNIEPFEFLEPT-----------LILNFSEGVAMLNEA-----GIEMGEFEDLTTTNEKILGKLIKKKFGTDFYVLDKFPLAVRPFYTMPDADYPGFSNSYDFFMRGEEIMSGAQRVHDPVMLRESAVKHGIKLDT-IKDYLESFEYGCSPHAGGGIGLERVVMLYLGLDNIRRVSMFPR 414          
The following BLAST results are available for this feature:
BLAST of SMED30003415 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NARS24.222e-8036.23asparaginyl-tRNA synthetase 2, mitochondrial [Sour... [more]
NARS22.232e-5241.38asparaginyl-tRNA synthetase 2, mitochondrial [Sour... [more]
NARS18.013e-4128.38asparaginyl-tRNA synthetase 1 [Source:HGNC Symbol;... [more]
NARS28.823e-2047.78asparaginyl-tRNA synthetase 2, mitochondrial [Sour... [more]
DARS16.321e-1622.55aspartyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of SMED30003415 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nars-28.751e-6731.63Asparaginyl(N) Amino-acyl tRNA Synthetase [Source... [more]
nars-28.751e-6731.63Asparaginyl(N) Amino-acyl tRNA Synthetase [Source... [more]
nars-16.246e-4127.39Asparagine--tRNA ligase, cytoplasmic [Source:UniP... [more]
dars-11.355e-2125.31Aspartate--tRNA ligase, cytoplasmic [Source:UniPr... [more]
dars-11.355e-2125.31Aspartate--tRNA ligase, cytoplasmic [Source:UniPr... [more]
back to top
BLAST of SMED30003415 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AsnRS-m2.319e-7633.83gene:FBgn0034177 transcript:FBtr0087057[more]
AsnRS3.023e-3525.97gene:FBgn0086443 transcript:FBtr0332578[more]
AsnRS3.023e-3525.97gene:FBgn0086443 transcript:FBtr0081162[more]
AspRS1.997e-1823.40gene:FBgn0002069 transcript:FBtr0332882[more]
AspRS1.997e-1823.40gene:FBgn0002069 transcript:FBtr0087784[more]
back to top
BLAST of SMED30003415 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nars23.636e-7633.91asparaginyl-tRNA synthetase 2, mitochondrial [Sour... [more]
nars12.835e-4028.32asparaginyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB... [more]
dars14.215e-1924.18aspartyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
nars24.692e-1040.00asparaginyl-tRNA synthetase 2, mitochondrial [Sour... [more]
si:ch211-256m1.81.380e-723.55si:ch211-256m1.8 [Source:ZFIN;Acc:ZDB-GENE-131127-... [more]
back to top
BLAST of SMED30003415 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NARS22.204e-7334.43asparaginyl-tRNA synthetase 2, mitochondrial [Sour... [more]
NARS22.204e-7334.43asparaginyl-tRNA synthetase 2, mitochondrial [Sour... [more]
NARS23.133e-7333.77asparaginyl-tRNA synthetase 2, mitochondrial [Sour... [more]
NARS12.408e-3827.07asparaginyl-tRNA synthetase 1 [Source:NCBI gene;Ac... [more]
NARS13.953e-3827.07asparaginyl-tRNA synthetase 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of SMED30003415 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nars29.273e-8135.18asparaginyl-tRNA synthetase 2 (mitochondrial)(puta... [more]
Nars23.338e-4731.28asparaginyl-tRNA synthetase 2 (mitochondrial)(puta... [more]
Nars5.805e-4128.38asparaginyl-tRNA synthetase [Source:MGI Symbol;Acc... [more]
Nars1.202e-4028.38asparaginyl-tRNA synthetase [Source:MGI Symbol;Acc... [more]
Nars1.384e-4028.38asparaginyl-tRNA synthetase [Source:MGI Symbol;Acc... [more]
back to top
BLAST of SMED30003415 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BGV0|SYNM_MOUSE6.486e-8035.18Probable asparagine--tRNA ligase, mitochondrial OS... [more]
sp|Q96I59|SYNM_HUMAN2.028e-7936.23Probable asparagine--tRNA ligase, mitochondrial OS... [more]
sp|Q6ANL4|SYN_DESPS3.129e-7732.68Asparagine--tRNA ligase OS=Desulfotalea psychrophi... [more]
sp|A6L0U5|SYN_BACV85.927e-7633.55Asparagine--tRNA ligase OS=Bacteroides vulgatus (s... [more]
sp|Q5L8W2|SYN_BACFN4.465e-7533.33Asparagine--tRNA ligase OS=Bacteroides fragilis (s... [more]
back to top
BLAST of SMED30003415 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068WFT43.147e-8839.61Asparaginyl tRNA synthetase OS=Echinococcus granul... [more]
A0A0R3W6818.813e-8740.13AA_TRNA_LIGASE_II domain-containing protein OS=Tae... [more]
A0A1X2HS131.164e-8634.23Asparaginyl-tRNA synthetase OS=Syncephalastrum rac... [more]
A0A068Y9N42.105e-8639.39Asparaginyl tRNA synthetase OS=Echinococcus multil... [more]
I1BH119.043e-8635.79Asparaginyl-tRNA synthetase OS=Rhizopus delemar (s... [more]
back to top
BLAST of SMED30003415 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nars21.496e-7935.29asparaginyl-tRNA synthetase 2, mitochondrial [Sour... [more]
nars23.212e-7834.52asparaginyl-tRNA synthetase 2, mitochondrial [Sour... [more]
nars11.916e-4229.36asparaginyl-tRNA synthetase 1 [Source:NCBI gene;Ac... [more]
nars11.756e-3427.49asparaginyl-tRNA synthetase 1 [Source:NCBI gene;Ac... [more]
dars14.005e-826.42aspartyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of SMED30003415 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dars11.384e-2023.88aspartyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of SMED30003415 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SLM59.644e-6935.86Mitochondrial asparaginyl-tRNA synthetase [Source:... [more]
DED811.247e-4027.07Cytosolic asparaginyl-tRNA synthetase; required fo... [more]
DPS11.763e-2425.00Aspartyl-tRNA synthetase, primarily cytoplasmic; h... [more]
back to top
BLAST of SMED30003415 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO421093.033e-4026.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422312.202e-1921.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369532.600e-1842.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30003415 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nars25.620e-7834.86asparaginyl-tRNA synthetase 2, mitochondrial [Sour... [more]
nars26.895e-7133.92asparaginyl-tRNA synthetase 2, mitochondrial [Sour... [more]
nars16.532e-4227.81asparaginyl-tRNA synthetase 1 [Source:NCBI gene;Ac... [more]
dars12.254e-1823.35aspartyl-tRNA synthetase 1 [Source:NCBI gene;Acc:1... [more]
si:ch211-256m1.89.134e-823.51uncharacterized LOC101165397 [Source:NCBI gene;Acc... [more]
back to top
BLAST of SMED30003415 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000000003.10.000e+0100.00SMESG000000003.1[more]
SMESG000064550.11.931e-3627.65SMESG000064550.1[more]
SMESG000009022.19.196e-1525.40SMESG000009022.1[more]
SMESG000009022.11.057e-1425.40SMESG000009022.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003415 ID=SMED30003415|Name=SMED30003415|organism=Schmidtea mediterranea sexual|type=transcript|length=1476bp
TTTTTTTTTGAGCTTTATAATTGTATTGAAAATCTACATAATACAAGTGT
TGAATGTGCGGGGGAAAGTTACCACGTCCTGAATATTGTAGACCCCCGTC
CAGAACTGTAGCAGCCGGTCAAAGCCCACACCGAATCCTGAATGTGGACA
ACTGCCAGTTCCCCTCAAATCCAAATACCAATTCATATCAGTCTCATTTA
ATTTTGCGTGTTTCATTCTAGATTTCAATCGATCATAATCGGTGTCCCTG
ACGCTGCCTCCGACTACCTCTCCAACAAATGGCAACAGCAAATCTACGGC
CATTACAGTCTCGCCCCCCTCATTAGGCCTGCAATAAAAAGGTTTCTGAC
TCATGGGGAAATCCGTGACAAAGACCGGCCGGTTACCTAGCAACGACACC
AAACGCTGCTCTTCTGACTTGCTGAATTCAATTTCCTCAATCCTCAAACC
AGGAGAAATGATCTTGGACTCCTTCAATATTTCCACGGCTTGTTGGAATG
AAATTCTGATGAAATTATTGTCGGAAATTGTTTCACTCAGTAATTCCAGT
CCACTGAATTCTTCGGATTGAACCAAATTCGATTTTCTTATCAACTCCAG
ATTATCAGCATTATTATTGAAAAAATCTCTTGACAAAGTTTTAATTAAAT
GCTCAATAGAATTGCATAAATCAATAACAGAATTGATATTGATCGATTCA
ACTTCCAACATTAGAAATTCTGACAAATGGTGTCGAGTTCGTGATTTATT
GGCGCGAAATATTGGTCCTAGAGTGTAGACTTTACCATATCCCAATACTA
ATGCTTCTAAATGGAGTTGAGCGCTCACAGTTAAATTCTGAGGTTTTATT
ATAATTGATTCATTTGGAGTTTCTATAATTGCTTTATACGCTTCTCCCGC
GCCTTCGCAATCTATCGATGTTAGAATTGGTGGATCAACTTCTAAGTATT
CATTAGTTATCATGTAATTTCTAATTGACTGTTTTGTAAAAGCTCTTATT
CGACCTATGGCAGAATAACAATCATATCGGTGACGAAAATGGAGAAGTTC
TTTTCTGGCTGTTTCGCTTTTTATCCCTGTTTTCATTGAATTTACTAAAG
TTTCACTTGCCAAATTAAATTGATCGTTAAAAATATGATGATTTTCTGAT
AATGATTCACAACTTAAAGCTCGAACTTCTTTGATTTGTCCCTCCCCGGG
GGAATCAACTACTTCGCCACTAACTTTTATGCAACACCCTCTATAAAAGT
TTTTGTGAACTAAATTATTTGTCAAAACTACTTGGATCATTTCATTAGAT
CGTCCATCGTGCAACTTTAAAAATGATTTATTTTTAAGCCTTGAAATAGA
ATGGACCCATCCAACTATAGAAATGTTCTTACAATCATTTAATAAATGAA
TATTTAAAAAAATATTTTTTAATAAAAATAAGTTCAATAAACATTATACT
AACCCCATGCCAAACCGGAAATATAA
back to top

protein sequence of SMED30003415-orf-1

>SMED30003415-orf-1 ID=SMED30003415-orf-1|Name=SMED30003415-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=419bp
MIQVVLTNNLVHKNFYRGCCIKVSGEVVDSPGEGQIKEVRALSCESLSEN
HHIFNDQFNLASETLVNSMKTGIKSETARKELLHFRHRYDCYSAIGRIRA
FTKQSIRNYMITNEYLEVDPPILTSIDCEGAGEAYKAIIETPNESIIIKP
QNLTVSAQLHLEALVLGYGKVYTLGPIFRANKSRTRHHLSEFLMLEVESI
NINSVIDLCNSIEHLIKTLSRDFFNNNADNLELIRKSNLVQSEEFSGLEL
LSETISDNNFIRISFQQAVEILKESKIISPGLRIEEIEFSKSEEQRLVSL
LGNRPVFVTDFPMSQKPFYCRPNEGGETVMAVDLLLPFVGEVVGGSVRDT
DYDRLKSRMKHAKLNETDMNWYLDLRGTGSCPHSGFGVGFDRLLQFWTGV
YNIQDVVTFPRTFNTCIM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR002312Asp/Asn-tRNA-synth_IIb
IPR004365NA-bd_OB_tRNA
IPR004364Aa-tRNA-synt_II
IPR012340NA-bd_OB-fold
IPR006195aa-tRNA-synth_II
Vocabulary: biological process
TermDefinition
GO:0006418tRNA aminoacylation for protein translation
Vocabulary: molecular function
TermDefinition
GO:0004812aminoacyl-tRNA ligase activity
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0003676nucleic acid binding