Bestrophin homolog

Overview
NameBestrophin homolog
Smed IDSMED30003406
Length (bp)1709
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bestrophin homolog (SMED30003406) t-SNE clustered cells

Violin plots show distribution of expression levels for Bestrophin homolog (SMED30003406) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bestrophin homolog (SMED30003406) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bestrophin homolog (SMED30003406) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003406

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30003406SMESG000060552.1 dd_Smed_v4_4179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30003406SMESG000060552.1 dd_Smed_v4_4179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003406SMESG000060552.1 dd_Smed_v4_4179_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30003406SMESG000060552.1 dd_Smed_v4_4179_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30003406SMESG000060552.1 dd_Smed_v4_4179_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST1 (bestrophin 1 [Source:HGNC Symbol;Acc:HGNC:12703])

HSP 1 Score: 195.282 bits (495), Expect = 2.331e-54
Identity = 120/358 (33.52%), Postives = 192/358 (53.63%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDIC 1198
            M  +Y+  +++ +    F++LL+ W+GS+YKLL+ + L+++  +Y + F+YR  L ++ +  FE++  YCD+    IP+SF+LGF+V  V+ RWW  Y  +PW +R+  +  G + G+  E+   ++ TL+RY  L  +L++R +S  +  RF                         +Q+ F   +T AE +  E ++  +    N+     +W+P  W + L  K +L G I D      L+ E++ LR Q  +L     I IPLVYTQVV +AVYS+FL  L   QF   +K         GH +D    P+FT  QF F +GWLKVA  L+N FG+  +DF+T  I+D NL + 
Sbjct:    1 MTITYTSQVANARLG-SFSRLLLCWRGSIYKLLYGEFLIFLLCYYIIRFIYRLALTEEQQLMFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGK-DEQGRLLRRTLIRYANLGNVLILRSVSTAVYKRFPSAQ-------------------HLVQAGF---MTPAEHKQLEKLSLPH----NM-----FWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYP------GHELDLVV-PVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVS 318          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 191.045 bits (484), Expect = 2.416e-53
Identity = 121/357 (33.89%), Postives = 190/357 (53.22%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +Y+  +++ +    F++LL+ W+GS+YKLLW +LL ++  + +L   YR  L +  K  FE++V YCD   + IP+SF+LGF+V  V++RWW  Y+ +P  + +  +  G + G+  +R    + TLMRY  LS +L++R +S  +  RF                      D  +++ F   +T  E + FE++   N + N      +YW+P  W S L  +    G I D      L+EEL+  R +   L     I +PLVYTQVV IA+YSYFL  L   QF   ++G  +      H++D    P+FT+ QF F  GWLKVA  L+N FG+  +DF+T  ++D N  +
Sbjct:    1 MTVTYTARVANARFG-GFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGR-DDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFP-------------------TIDHVVEAGF---MTREERKKFENL---NSSYN------KYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKD------HDLDLCV-PIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQV 317          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 191.045 bits (484), Expect = 2.416e-53
Identity = 121/357 (33.89%), Postives = 190/357 (53.22%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +Y+  +++ +    F++LL+ W+GS+YKLLW +LL ++  + +L   YR  L +  K  FE++V YCD   + IP+SF+LGF+V  V++RWW  Y+ +P  + +  +  G + G+  +R    + TLMRY  LS +L++R +S  +  RF                      D  +++ F   +T  E + FE++   N + N      +YW+P  W S L  +    G I D      L+EEL+  R +   L     I +PLVYTQVV IA+YSYFL  L   QF   ++G  +      H++D    P+FT+ QF F  GWLKVA  L+N FG+  +DF+T  ++D N  +
Sbjct:    1 MTVTYTARVANARFG-GFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGR-DDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFP-------------------TIDHVVEAGF---MTREERKKFENL---NSSYN------KYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKD------HDLDLCV-PIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQV 317          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 191.045 bits (484), Expect = 2.416e-53
Identity = 121/357 (33.89%), Postives = 190/357 (53.22%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +Y+  +++ +    F++LL+ W+GS+YKLLW +LL ++  + +L   YR  L +  K  FE++V YCD   + IP+SF+LGF+V  V++RWW  Y+ +P  + +  +  G + G+  +R    + TLMRY  LS +L++R +S  +  RF                      D  +++ F   +T  E + FE++   N + N      +YW+P  W S L  +    G I D      L+EEL+  R +   L     I +PLVYTQVV IA+YSYFL  L   QF   ++G  +      H++D    P+FT+ QF F  GWLKVA  L+N FG+  +DF+T  ++D N  +
Sbjct:    1 MTVTYTARVANARFG-GFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGR-DDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFP-------------------TIDHVVEAGF---MTREERKKFENL---NSSYN------KYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKD------HDLDLCV-PIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQV 317          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 186.037 bits (471), Expect = 1.173e-52
Identity = 115/372 (30.91%), Postives = 192/372 (51.61%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNL-HDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEM 1240
            M  +YS  +++  +   F +LL++W+GS+YKLL+ + +V+  L+ ++  +YR L     K  FE++  YCD     IP++F+LGF+V  V++RWW  ++ +PW +R+ F+   ++ G + E    ++ TLMRY+ L+ +L+ R +S  +  RF                      D  +++ F   +T  E + F  + + +          +YW+P  W   L  K    G I D      L+ E++  R+    L     + IPLVYTQVV +AVY++F   L   QF   +KG +      GH++D +  P+FT+ QF F  GWLKVA  L+N FG+  +DF+T   +D NL +     +    + P+M
Sbjct:    1 MTVTYSSKVANA-TFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGVQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHG-SDEHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFP-------------------TMDHVVEAGF---MTTDERKLFNHLKSPHL---------KYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYA------GHDLDLYI-PIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKM 332          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-4 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O17205])

HSP 1 Score: 177.563 bits (449), Expect = 1.495e-48
Identity = 109/355 (30.70%), Postives = 189/355 (53.24%), Query Frame = 2
Query:  185 KLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNLHDK-HKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGH--NIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEM 1240
            K+L+RWKGS++K +W +LL+++  +  L  +YR L +K  +  FEQ+  + D     IP++F+LGF+V+ V +RW K++  + W++  A      I G TSE+   ++   +RY+I++ +++ R++S  I+ RF           +++ ++               ++T+ E+  F++I +            +YW P+QW   L+      G I D    V LI+++   R ++ NL +   + IPLVYTQVV +AV +YF+  LF  QF      + N   I G    ID +F P+ T  Q +FI+GWLKV+  +LN  G+  EDF+T  I++ NL + +   +     +P +
Sbjct:   19 KVLLRWKGSVWKSIWSELLIWLLCYSILSVIYRILLNKAQREVFEQLCTFFDTFSVFIPVTFMLGFYVSIVYNRWTKVFDNVGWIDTSALTIAQYIRG-TSEKARLIRRNCVRYMIVAQVMVFRDVSPAIRRRFP----------TIKHLI------------GAGLLTEDELTEFDAITSPQ---------SKYWQPIQWLFSLVTVAKDEGLIADSYLYVDLIDKMREFRTKILNLVIFDMVPIPLVYTQVVNLAVRTYFVLALFGRQF------LENNNNIPGAKWKIDIYF-PIMTSLQIVFIVGWLKVSEVMLNPLGEDDEDFETNWIIERNLQVGYAVVDQAYGRYPTL 334          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-23 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:A5JYR2])

HSP 1 Score: 171.014 bits (432), Expect = 1.846e-47
Identity = 116/358 (32.40%), Postives = 180/358 (50.28%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDIC 1198
            M  SYS T         F KLL RWKGSL+K +W  LL++++++Y ++  YR  +  + ++ F + V   D     IPL+FLLGF+VA ++ RWW     I W + + +     I GQ  E    ++ T+ RY IL+ +L  R IS ++ +R+       T+++ V   L                +T  E+  F+SI        ++    ++W+PL W   ++ + F  G +        L++ L+  RN    L +   I IPLVYTQV  I+VY YFL  L   Q+P K++      EI+       + P+FT+ QFLF +GWLKV   L+  FG   EDF+   IL+ NL++ 
Sbjct:    1 MTISYSDT---------FLKLLFRWKGSLWKAIWKHLLIFLTMYYIINAYYRFGMTKEQQNEFIKYVMLVDGWTKEIPLTFLLGFYVAMIVRRWWDCCQLISWPDHLLYNVSALIRGQDPE-TRIIRKTIARYTILTSVLAWRSISLRVLARYP------TDDHLVDSGL----------------MTKEEMVMFKSILV------HVDPHQKWWVPLNWIQTMMVRCFEKGTLTHTNELRVLLDALEKYRNGFFQLFIYDWIAIPLVYTQVSTISVYGYFLFALIGRQYPSKNEN----EEIVD-----VYVPIFTILQFLFYVGWLKVGEDLMFPFGADDEDFEFNYILERNLEVS 311          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-3 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O17206])

HSP 1 Score: 174.096 bits (440), Expect = 5.272e-47
Identity = 112/372 (30.11%), Postives = 185/372 (49.73%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNLHD-KHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEM 1240
            M  +YS  ++   S     KLL RWKGS++K +W +L+V++ L+  L  +YR L   K ++ FE +  + D     IP++F+LGF+V+ V  RWW+++  I W++         I G+T ER   ++   +RY IL+  ++ R+++  ++ RF   N   T                        ++T+ E+  FESI + +          +YW P+ W   ++      G I      V L+E++   R  + +L +   + +PLVYTQVV +AV SYFL  LF  Q+       SN+       ID +  P+ ++ QF+F +GW+KVA  LLN  G+  +DF+   ILD NL +     +T    +P +
Sbjct:    1 MTVTYSLDVA-SSSFFCLYKLLFRWKGSIWKSVWAELVVWLCLYAVLSVIYRCLLTMKQRATFEDLCIFFDTYSNFIPITFMLGFYVSAVFTRWWQIFDNIGWIDTPCLWITQYIKGET-ERAKCVRRNCIRYSILTQAMVYRDVAASVRKRFPTFNHLVTA----------------------GLMTEKEMAEFESIPSPH---------AKYWQPMHWLFSMITLARDEGMISSDIIYVDLMEKMRQFRVNILSLTLFDWVPVPLVYTQVVHLAVRSYFLIALFGRQYLHPE---SNRLNDFKQTIDLYV-PIMSLLQFIFFIGWMKVAEVLLNPLGEDDDDFECNWILDRNLQVGLMVVDTAYNRYPTL 335          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-24 (Bestrophin homolog 24 [Source:UniProtKB/Swiss-Prot;Acc:P34672])

HSP 1 Score: 173.711 bits (439), Expect = 1.227e-46
Identity = 111/360 (30.83%), Postives = 191/360 (53.06%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRN-LHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDR--KIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCS---IMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNL 1189
            M  +Y+  +S  +   +F KLL++W+GS++K + ++L V++ L+  L  +YR  L+   +  FE+IV+YCD+  + IPL+F+LGFFV  V++RW  +Y  I +++ +  MA   + G+T E+    +  ++RY  L+ +L+ R+IS + + RF      + +       ++   +DR  +IQ  + K                            YW+P QWA  L  +    G I      V + +E+   R     L  +C+   + IP++Y Q+V +AV++YFL  L A Q+ + S+   NKTEI     D +F P+ +  QF+F MGW+KVA  +LN FG+  +DF+   ++D N+
Sbjct:    1 MTINYNLAVSTSKPWTLF-KLLLKWRGSIWKAVILELAVWLVLYGILSVIYRTALNPGQQRTFERIVQYCDSRLSYIPLNFMLGFFVTAVVNRWTYLYQIIGFIDNIGLMAAEYVRGRT-EQARMYRRNIVRYCELAQVLVFRDISMRTRRRFP-----TLDTVVAAGFMMPHEKDRFDEIQYKYSK----------------------------YWVPFQWAFSLTYEARKKGLIESDYYQVVVQDEIKKFRT---GLAWICNYDWVPIPIMYPQLVCLAVHTYFLVCLLARQY-VVSEHADNKTEI-----DLYF-PIMSTLQFIFYMGWMKVAEAMLNPFGEDDDDFECNALIDRNI 315          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-8 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O62095])

HSP 1 Score: 164.081 bits (414), Expect = 5.599e-44
Identity = 119/375 (31.73%), Postives = 186/375 (49.60%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDA-MKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEMLT 1246
            M  SY+  +S   S   F KLL RW+GS++K +W +L++++  +Y +   YR  L  + K+   + +++ D  +   +PL+F+L FFV  ++DRW  M+  I ++   A +A   +V  T   V   K T++RYL+L+ +L+ R+IS +++ RF                    N D  I++ F   + D E      I   +  R N      YW+P+ W+S +LQK F +G I        + +E+   R+ M  L     + IP+ Y QVV  AV  YF   LF  Q          KT      ID++F P+ TVFQF F MGW+KVA  LLN  G+  +DF+   ++D N+       N++    PEML 
Sbjct:    1 MTVSYNLDVS-SVSFFNFFKLLFRWRGSVWKSIWSELVLWLLGYYLVMVTYRVALTTEQKAGVRKYIDHLDQNLDKCVPLTFMLAFFVTIIVDRWKNMFANIGFIENTA-IAIATLVKGTEGDVLLAKRTIIRYLVLTQVLVFRDISLKVRRRFP-------------------NHDAIIKAGF---LQDHE----SIILGGDNGRTN------YWMPVNWSSAILQKLFEDGNIPAAPLFNSVWQEVKTFRSNMATLCNYDWVPIPIAYPQVVFFAVRVYFFTCLFTRQ---HLDMEDTKT------IDYYF-PILTVFQFTFFMGWMKVAEALLNPLGEDDDDFECNYLIDRNIATGMAIVNSKYSDVPEMLA 331          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0082183)

HSP 1 Score: 228.409 bits (581), Expect = 6.975e-66
Identity = 129/373 (34.58%), Postives = 205/373 (54.96%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEML 1243
            M  +Y+  ++  +    F KLL+RW+GS+YKL+W+DLL +++++Y+++ +YR  L+   K  FE IV+YCD+ +  IPLSF+LGF+V+ V+ RWW  Y +IPW + +A      + GQ  ER   M+ T+MRY+ L   +++  +S +++ RF   N        V   L+N N          K I +   +AF   +             ++W+P+ WA+ ++ +    G I D      +I+EL+  R Q   L    +I +PLVYTQVV +AVYSYFL      Q+    K + N T +  + +D +F P+FT  QF F MGWLKVA  L+N FG+  +DF+   ++D NL + +   +      PE+L
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLNPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQ-DERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLN------NLVEAGLLNDN---------EKTIIETMNKAFPRPS-------------KHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQW-TDGKVVGNTTYL--NKVDLYF-PVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELL 340          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0337020)

HSP 1 Score: 228.409 bits (581), Expect = 1.126e-65
Identity = 129/373 (34.58%), Postives = 205/373 (54.96%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEML 1243
            M  +Y+  ++  +    F KLL+RW+GS+YKL+W+DLL +++++Y+++ +YR  L+   K  FE IV+YCD+ +  IPLSF+LGF+V+ V+ RWW  Y +IPW + +A      + GQ  ER   M+ T+MRY+ L   +++  +S +++ RF   N        V   L+N N          K I +   +AF   +             ++W+P+ WA+ ++ +    G I D      +I+EL+  R Q   L    +I +PLVYTQVV +AVYSYFL      Q+    K + N T +  + +D +F P+FT  QF F MGWLKVA  L+N FG+  +DF+   ++D NL + +   +      PE+L
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLNPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQ-DERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLN------NLVEAGLLNDN---------EKTIIETMNKAFPRPS-------------KHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQW-TDGKVVGNTTYL--NKVDLYF-PVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELL 340          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0114590)

HSP 1 Score: 228.409 bits (581), Expect = 1.482e-65
Identity = 129/373 (34.58%), Postives = 205/373 (54.96%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEML 1243
            M  +Y+  ++  +    F KLL+RW+GS+YKL+W+DLL +++++Y+++ +YR  L+   K  FE IV+YCD+ +  IPLSF+LGF+V+ V+ RWW  Y +IPW + +A      + GQ  ER   M+ T+MRY+ L   +++  +S +++ RF   N        V   L+N N          K I +   +AF   +             ++W+P+ WA+ ++ +    G I D      +I+EL+  R Q   L    +I +PLVYTQVV +AVYSYFL      Q+    K + N T +  + +D +F P+FT  QF F MGWLKVA  L+N FG+  +DF+   ++D NL + +   +      PE+L
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLNPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQ-DERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLN------NLVEAGLLNDN---------EKTIIETMNKAFPRPS-------------KHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQW-TDGKVVGNTTYL--NKVDLYF-PVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELL 340          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0306023)

HSP 1 Score: 228.794 bits (582), Expect = 1.587e-65
Identity = 129/373 (34.58%), Postives = 205/373 (54.96%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEML 1243
            M  +Y+  ++  +    F KLL+RW+GS+YKL+W+DLL +++++Y+++ +YR  L+   K  FE IV+YCD+ +  IPLSF+LGF+V+ V+ RWW  Y +IPW + +A      + GQ  ER   M+ T+MRY+ L   +++  +S +++ RF   N        V   L+N N          K I +   +AF   +             ++W+P+ WA+ ++ +    G I D      +I+EL+  R Q   L    +I +PLVYTQVV +AVYSYFL      Q+    K + N T +  + +D +F P+FT  QF F MGWLKVA  L+N FG+  +DF+   ++D NL + +   +      PE+L
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLNPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQ-DERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLN------NLVEAGLLNDN---------EKTIIETMNKAFPRPS-------------KHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQW-TDGKVVGNTTYL--NKVDLYF-PVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELL 340          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best3 (gene:FBgn0036492 transcript:FBtr0075618)

HSP 1 Score: 207.994 bits (528), Expect = 9.285e-60
Identity = 119/361 (32.96%), Postives = 192/361 (53.19%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYV--PEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICW 1201
            M  SY+  ++       F KLL+RW+ S+YK++W+DLL ++S FY +  +YR  L D  K  FE IV YC +    IPLSF+LGF+V  +++RWW  Y+ +PW + +A      + GQ  E    M+ T+MRY+ L+  +++  IS  I+ RF                            T+ ++I   E+    +  A      ++K+   P+YW+P+ WA+ ++ +    G I D  +   +I+EL+  R   + L    +I +PLVYTQVV +AVYSYF+  +F  Q+    + I +   I+      +++PLF+  +F F MGWLKVA  L+  FGD  +DF+   ++D NL + +
Sbjct:    1 MTVSYTAEVATCSHFGCFWKLLMRWRASIYKIIWVDLLAFLSCFYFMAVIYRYALRDVDKPVFEDIVMYCHSYSNLIPLSFVLGFYVGIIIERWWNQYITVPWPDPLAVYVSALVRGQ-DEHGRLMRRTIMRYVCLALTMVLSMISPVIKRRF---------------------------PTYDQLI---EVGLLNANEANIMKAMDVKFPKHPKYWMPIVWAASIVTRARKEGRIWDDFSLKSMIDELNKFRAGCNMLIHYDTISVPLVYTQVVTLAVYSYFVASIFGHQW--IDRDIKHYNNIVS-----YYFPLFSTLEFFFFMGWLKVAETLICPFGDDDDDFELNWLIDRNLQVSY 323          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 202.601 bits (514), Expect = 1.297e-56
Identity = 120/357 (33.61%), Postives = 191/357 (53.50%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRN-LHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +YS  ++D +    F +LL+RWKGS+YKLL+ +LL++  ++  +   YR  L ++ +  FE++  YCD     IP+SF+LGF+V  V+ RWW  + ++PW +R++ +  G + G   E    ++ +LMRY  LS IL+ R +S  +  RF       T  + V+  L                +T  E+R  + + + +          ++W+P  W   L  +    G I +      ++ EL+ LR+Q   L     I +PLVYTQVV +AVYS+FL  L   QF   ++G        GHN+DF+  P+FT+ QF F +GWLKVA  L+N FG+  +DF+T  ++D NL +
Sbjct:    1 MTVTYSRRVADARLG-TFYRLLLRWKGSIYKLLYRELLIFTVMYCIISITYRCVLTEEQRRMFEKLSLYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLSALVSGHVRG-ADEGARLIRRSLMRYANLSGILIYRSVSTAVYKRF------PTMSHLVQAGL----------------MTAEELRQLQELPSPHN---------KFWVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLDPAQGYP------GHNLDFYL-PVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQV 317          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 193.741 bits (491), Expect = 3.298e-55
Identity = 123/359 (34.26%), Postives = 190/359 (52.92%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRN-LHDKHKSNFEQIVEYCDAMKTNIPLSFLLG--FFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +Y+  +++ +    F+KLL+ WKGS+YK+L+ + L + +++ ++   YR  L D  K  FE++  YCD   + IP+SF+LG  F+V  V++RWW  Y +IP  +R+  +  G + G + ER   ++ TLMRY  LS +L++R +S  +  RF                      D  +++ F   +T  E + FES+ +            +YWIP  W + L       G I D  T   L+EEL+N R +   L     I +PLVYTQVV +AVYS+FL  L   QF    +G        GH++D +  P+FT+ QF F  GWLKVA  L+N FG+  +DF+T  ++D N  +
Sbjct:    1 MTVTYTARVANARFC-GFSKLLLAWKGSIYKVLYKEFLAFFAMYTAISITYRFFLVDGQKRYFEKLSIYCDNYASLIPMSFVLGMRFYVTLVVNRWWSQYTSIPLPDRVMCVLSGGVQG-SDERGRLLRRTLMRYSSLSALLILRSVSTAVFKRFPTI-------------------DHVVEAGF---MTREERKKFESLHSP---------YNKYWIPCVWFTNLAAAARCEGRIKDDNTYKLLLEELNNFRGKCSMLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPGQGYP------GHDLDLYV-PIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQV 319          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 182.185 bits (461), Expect = 3.997e-52
Identity = 115/360 (31.94%), Postives = 190/360 (52.78%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRN-LHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQF--PIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDIC 1198
            M  SY+  +++ +    F+KLL RWKGS+YKLL+ + LV+  L+  +  LYR  L++  +  F ++  +C+     IP+SF+LGF+V     RWW  Y + P  + +  +  G + G T ER   ++ TLMRY  LS +L++R IS +++ RF+          ++ +I         +++ F   +T  E+R    + +            +YW+PL W + L  +    G + D      L++EL+N R++   L     I IPLVYTQVV +AVYS+F   L   QF  P  S+           ++D +  P+FT+ +F F  GWLKV   ++N FG+  +DF+T +++D N+ +C
Sbjct:    1 MTVSYTLKVANAKFG-GFSKLLFRWKGSIYKLLYREFLVFCLLYTFISILYRCVLNNNQQEIFARLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHG-TDERGRLLRRTLMRYANLSSVLILRSISTRVRKRFT----------TLEDI---------VEAGF---MTTDELRKLNHLYSD---------FNKYWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFTFSLIGRQFVKPASSE----------EHLDLYI-PIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVC 316          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 178.718 bits (452), Expect = 1.788e-50
Identity = 114/359 (31.75%), Postives = 189/359 (52.65%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRN-LHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQF--PIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  SY+  +++ +    F+KLL RWKGS+YKLL+ + LV+  L+  +  LYR  L++  +  F ++  +C+     IP+SF+LGF+V     RWW  Y + P  + +  +  G + G T ER   ++ TLMRY  LS +L++R IS +++ RF+          ++ +I         +++ F   +T  E+R    + +            +YW+PL W + L  +    G + D      L++EL+N R++   L     I IPLVYTQVV +AVYS+F   L   QF  P  S+           ++D +  P+FT+ +F F  GWLKV   ++N FG+  +DF+T +++D N+ +
Sbjct:    1 MTVSYTLKVANAKFG-GFSKLLFRWKGSIYKLLYREFLVFCLLYTFISILYRCVLNNNQQEIFARLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHG-TDERGRLLRRTLMRYANLSSVLILRSISTRVRKRFT----------TLEDI---------VEAGF---MTTDELRKLNHLYSD---------FNKYWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFTFSLIGRQFVKPASSE----------EHLDLYI-PIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQV 315          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 118.242 bits (295), Expect = 1.032e-29
Identity = 78/259 (30.12%), Postives = 133/259 (51.35%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRN-LHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKM 901
            M  +Y+  +++ +    F+KLL+ WKGS+YK+L+ + L + +++ ++   YR  L D  K  FE++  YCD   + IP+SF+LGF+V  V++RWW  Y +IP  +R+  +  G + G + ER   ++ TLMRY  LS +L++R +S  +  RF                      D  +++ F   +T  E + FES+ +            +YWIP  W + L       G I D   T KL+ E++ L+N    +++
Sbjct:    1 MTVTYTARVANARFC-GFSKLLLAWKGSIYKVLYKEFLAFFAMYTAISITYRFFLVDGQKRYFEKLSIYCDNYASLIPMSFVLGFYVTLVVNRWWSQYTSIPLPDRVMCVLSGGVQG-SDERGRLLRRTLMRYSSLSALLILRSVSTAVFKRFP-------------------TIDHVVEAGF---MTREERKKFESLHSP---------YNKYWIPCVWFTNLAAAARCEGRIKD-DNTYKLLLEVNTLKNGFIKVRV 225          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 198.749 bits (504), Expect = 1.555e-57
Identity = 119/357 (33.33%), Postives = 191/357 (53.50%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNL-HDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +YS+ ++D +    F++LL+RW+GS+YKLL+ + L+++S ++ +   YR L +++ +  FE++  YCD     IP+SF+LGF+V  V+ RWW  Y ++PW +R+  +    + G T ER   ++ TLMRY  L+ +L++R +S  +  RF       T ++ V                    +T  E   F+ + + +          ++W+P  W + L       G I D      +++EL++LR Q   L     I +PLVYTQVV +AVYS+FL  L   QF    KG        GH++D +  P+FT+ QF F  GWLKVA  L+N FG   +DF+T  ++D NL +
Sbjct:    1 MTVTYSNRVADARLG-TFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHG-TDERGRMLRRTLMRYANLTGLLILRSVSTAVYMRF------PTLQHVVNA----------------GFMTPTERSKFDGLVSSH---------NKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYP------GHDMDLYV-PVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQV 317          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 197.978 bits (502), Expect = 2.725e-57
Identity = 119/357 (33.33%), Postives = 191/357 (53.50%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNL-HDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +YS+ ++D +    F++LL+RW+GS+YKLL+ + L+++S ++ +   YR L +++ +  FE++  YCD     IP+SF+LGF+V  V+ RWW  Y ++PW +R+  +    + G T ER   ++ TLMRY  L+ +L++R +S  +  RF       T ++ V                    +T  E   F+ + + +          ++W+P  W + L       G I D      +++EL++LR Q   L     I +PLVYTQVV +AVYS+FL  L   QF    KG        GH++D +  P+FT+ QF F  GWLKVA  L+N FG   +DF+T  ++D NL +
Sbjct:    1 MTVTYSNRVADARLG-TFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHG-TDERGRMLRRTLMRYANLTGLLILRSVSTAVYMRF------PTLQHVVNA----------------GFMTPTERSKFDGLVSSH---------NKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYP------GHDMDLYV-PVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQV 317          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 197.978 bits (502), Expect = 6.003e-57
Identity = 119/357 (33.33%), Postives = 191/357 (53.50%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNL-HDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +YS+ ++D +    F++LL+RW+GS+YKLL+ + L+++S ++ +   YR L +++ +  FE++  YCD     IP+SF+LGF+V  V+ RWW  Y ++PW +R+  +    + G T ER   ++ TLMRY  L+ +L++R +S  +  RF       T ++ V                    +T  E   F+ + + +          ++W+P  W + L       G I D      +++EL++LR Q   L     I +PLVYTQVV +AVYS+FL  L   QF    KG        GH++D +  P+FT+ QF F  GWLKVA  L+N FG   +DF+T  ++D NL +
Sbjct:    1 MTVTYSNRVADARLG-TFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHG-TDERGRMLRRTLMRYANLTGLLILRSVSTAVYMRF------PTLQHVVNA----------------GFMTPTERSKFDGLVSSH---------NKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYP------GHDMDLYV-PVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQV 317          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 198.364 bits (503), Expect = 1.018e-56
Identity = 119/357 (33.33%), Postives = 191/357 (53.50%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNL-HDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +YS+ ++D +    F++LL+RW+GS+YKLL+ + L+++S ++ +   YR L +++ +  FE++  YCD     IP+SF+LGF+V  V+ RWW  Y ++PW +R+  +    + G T ER   ++ TLMRY  L+ +L++R +S  +  RF       T ++ V                    +T  E   F+ + + +          ++W+P  W + L       G I D      +++EL++LR Q   L     I +PLVYTQVV +AVYS+FL  L   QF    KG        GH++D +  P+FT+ QF F  GWLKVA  L+N FG   +DF+T  ++D NL +
Sbjct:    1 MTVTYSNRVADARLG-TFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHG-TDERGRMLRRTLMRYANLTGLLILRSVSTAVYMRF------PTLQHVVNA----------------GFMTPTERSKFDGLVSSH---------NKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYP------GHDMDLYV-PVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQV 317          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 201.06 bits (510), Expect = 2.129e-56
Identity = 119/357 (33.33%), Postives = 191/357 (53.50%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNL-HDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +YS+ ++D +    F++LL+RW+GS+YKLL+ + L+++S ++ +   YR L +++ +  FE++  YCD     IP+SF+LGF+V  V+ RWW  Y ++PW +R+  +    + G T ER   ++ TLMRY  L+ +L++R +S  +  RF              + +VN              +T  E   F+ + + +          ++W+P  W + L       G I D      +++EL++LR Q   L     I +PLVYTQVV +AVYS+FL  L   QF    KG        GH++D +  P+FT+ QF F  GWLKVA  L+N FG   +DF+T  ++D NL +
Sbjct:    1 MTVTYSNRVADARLG-TFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHG-TDERGRMLRRTLMRYANLTGLLILRSVSTAVYMRF-----------PTLQHVVNAG-----------FMTPTERSKFDGLVSSHN---------KFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYP------GHDMDLYV-PVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQV 317          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best1 (bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332])

HSP 1 Score: 195.667 bits (496), Expect = 3.431e-56
Identity = 122/357 (34.17%), Postives = 186/357 (52.10%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRN-LHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +Y++ +++ +    F+ LL+ W+GS+YKLL+ + LV++ L+YS+  LYR  L    +  FE++  YCD+    IP+SF+LGF+V  V+ RWW  Y  +PW +R+       + G+  E    ++ TL+RY IL  +L++R IS  +  RF   +           +L  F             +T  E +  + +   +           +W+P  W + L  K +L G I D      L+ E+  LR Q   L     I IPLVYTQVV +AVYS+FL  L   QF      ++   +  GH +D    P+FT+ QFLF MGWLKVA  L+N FG+  +DF+T  I+D NL +
Sbjct:    1 MTITYTNKVANARLG-SFSSLLLCWRGSIYKLLYGEFLVFIFLYYSIRGLYRMVLSSDQQLLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVEGKDEEG-RLLRRTLIRYAILGQVLILRSISTSVYKRFPTLH---------HLVLAGF-------------MTHGEHKQLQKLGLPH---------NTFWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQF------LNPNKDYPGHEMDLVV-PVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQV 317          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best1 (bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332])

HSP 1 Score: 198.364 bits (503), Expect = 5.551e-56
Identity = 122/357 (34.17%), Postives = 186/357 (52.10%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRN-LHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +Y++ +++ +    F+ LL+ W+GS+YKLL+ + LV++ L+YS+  LYR  L    +  FE++  YCD+    IP+SF+LGF+V  V+ RWW  Y  +PW +R+       + G+  E    ++ TL+RY IL  +L++R IS  +  RF   +           +L  F             +T  E +  + +   +           +W+P  W + L  K +L G I D      L+ E+  LR Q   L     I IPLVYTQVV +AVYS+FL  L   QF      ++   +  GH +D    P+FT+ QFLF MGWLKVA  L+N FG+  +DF+T  I+D NL +
Sbjct:    1 MTITYTNKVANARLG-SFSSLLLCWRGSIYKLLYGEFLVFIFLYYSIRGLYRMVLSSDQQLLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVEGK-DEEGRLLRRTLIRYAILGQVLILRSISTSVYKRFPTLH---------HLVLAGF-------------MTHGEHKQLQKLGLPHNT---------FWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQF------LNPNKDYPGHEMDLVV-PVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQV 317          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 193.356 bits (490), Expect = 1.770e-54
Identity = 124/357 (34.73%), Postives = 191/357 (53.50%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNL-HDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +Y+  +++ +    F++LL+ W+GS+YKLLW +LL ++ L+ +L   YR L  ++ K  FE++V YCD   + IP+SF+LGF+V  V+ RWW  Y+ +P  + +  +  G + G+  +R    + TLMRY  LS +L++R +S  +  RF                      D  +++ F   +T  E + FE++   N + N      +YW+P  W S L  +    G I D      L+EEL+  R++   L     I IPLVYTQVV IAVYSYFL  L   QF   ++G  +      H +D    P+FT+ QF F  GWLKVA  L+N FG+  +DF+T  ++D N  +
Sbjct:    1 MTVTYTARVANARFG-GFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGR-DDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFP-------------------TIDHVVEAGF---MTREERKKFENL---NSSYN------KYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKD------HTLDLCV-PIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQV 317          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 193.356 bits (490), Expect = 1.770e-54
Identity = 124/357 (34.73%), Postives = 191/357 (53.50%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNL-HDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +Y+  +++ +    F++LL+ W+GS+YKLLW +LL ++ L+ +L   YR L  ++ K  FE++V YCD   + IP+SF+LGF+V  V+ RWW  Y+ +P  + +  +  G + G+  +R    + TLMRY  LS +L++R +S  +  RF                      D  +++ F   +T  E + FE++   N + N      +YW+P  W S L  +    G I D      L+EEL+  R++   L     I IPLVYTQVV IAVYSYFL  L   QF   ++G  +      H +D    P+FT+ QF F  GWLKVA  L+N FG+  +DF+T  ++D N  +
Sbjct:    1 MTVTYTARVANARFG-GFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGR-DDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFP-------------------TIDHVVEAGF---MTREERKKFENL---NSSYN------KYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKD------HTLDLCV-PIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQV 317          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 193.356 bits (490), Expect = 1.770e-54
Identity = 124/357 (34.73%), Postives = 191/357 (53.50%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNL-HDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +Y+  +++ +    F++LL+ W+GS+YKLLW +LL ++ L+ +L   YR L  ++ K  FE++V YCD   + IP+SF+LGF+V  V+ RWW  Y+ +P  + +  +  G + G+  +R    + TLMRY  LS +L++R +S  +  RF                      D  +++ F   +T  E + FE++   N + N      +YW+P  W S L  +    G I D      L+EEL+  R++   L     I IPLVYTQVV IAVYSYFL  L   QF   ++G  +      H +D    P+FT+ QF F  GWLKVA  L+N FG+  +DF+T  ++D N  +
Sbjct:    1 MTVTYTARVANARFG-GFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGR-DDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFP-------------------TIDHVVEAGF---MTREERKKFENL---NSSYN------KYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKD------HTLDLCV-PIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQV 317          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|O88870|BEST1_MOUSE (Bestrophin-1 OS=Mus musculus OX=10090 GN=Best1 PE=2 SV=3)

HSP 1 Score: 198.364 bits (503), Expect = 3.883e-55
Identity = 122/357 (34.17%), Postives = 186/357 (52.10%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRN-LHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +Y++ +++ +    F+ LL+ W+GS+YKLL+ + LV++ L+YS+  LYR  L    +  FE++  YCD+    IP+SF+LGF+V  V+ RWW  Y  +PW +R+       + G+  E    ++ TL+RY IL  +L++R IS  +  RF   +           +L  F             +T  E +  + +   +           +W+P  W + L  K +L G I D      L+ E+  LR Q   L     I IPLVYTQVV +AVYS+FL  L   QF      ++   +  GH +D    P+FT+ QFLF MGWLKVA  L+N FG+  +DF+T  I+D NL +
Sbjct:    1 MTITYTNKVANARLG-SFSSLLLCWRGSIYKLLYGEFLVFIFLYYSIRGLYRMVLSSDQQLLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVEGK-DEEGRLLRRTLIRYAILGQVLILRSISTSVYKRFPTLH---------HLVLAGF-------------MTHGEHKQLQKLGLPHNT---------FWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQF------LNPNKDYPGHEMDLVV-PVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQV 317          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|O76090|BEST1_HUMAN (Bestrophin-1 OS=Homo sapiens OX=9606 GN=BEST1 PE=1 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.119e-53
Identity = 120/358 (33.52%), Postives = 192/358 (53.63%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDIC 1198
            M  +Y+  +++ +    F++LL+ W+GS+YKLL+ + L+++  +Y + F+YR  L ++ +  FE++  YCD+    IP+SF+LGF+V  V+ RWW  Y  +PW +R+  +  G + G+  E+   ++ TL+RY  L  +L++R +S  +  RF                         +Q+ F   +T AE +  E ++  +    N+     +W+P  W + L  K +L G I D      L+ E++ LR Q  +L     I IPLVYTQVV +AVYS+FL  L   QF   +K         GH +D    P+FT  QF F +GWLKVA  L+N FG+  +DF+T  I+D NL + 
Sbjct:    1 MTITYTSQVANARLG-SFSRLLLCWRGSIYKLLYGEFLIFLLCYYIIRFIYRLALTEEQQLMFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGK-DEQGRLLRRTLIRYANLGNVLILRSVSTAVYKRFPSAQ-------------------HLVQAGF---MTPAEHKQLEKLSLPH----NM-----FWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYP------GHELDLVV-PVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVS 318          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8BGM5|BEST2_MOUSE (Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=2 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.735e-53
Identity = 124/357 (34.73%), Postives = 191/357 (53.50%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNL-HDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +Y+  +++ +    F++LL+ W+GS+YKLLW +LL ++ L+ +L   YR L  ++ K  FE++V YCD   + IP+SF+LGF+V  V+ RWW  Y+ +P  + +  +  G + G+  +R    + TLMRY  LS +L++R +S  +  RF                      D  +++ F   +T  E + FE++   N + N      +YW+P  W S L  +    G I D      L+EEL+  R++   L     I IPLVYTQVV IAVYSYFL  L   QF   ++G  +      H +D    P+FT+ QF F  GWLKVA  L+N FG+  +DF+T  ++D N  +
Sbjct:    1 MTVTYTARVANARFG-GFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGR-DDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFP-------------------TIDHVVEAGF---MTREERKKFENL---NSSYN------KYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKD------HTLDLCV-PIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQV 317          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q6UY87|BEST1_MACFA (Bestrophin-1 OS=Macaca fascicularis OX=9541 GN=BEST1 PE=2 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 3.624e-53
Identity = 119/358 (33.24%), Postives = 191/358 (53.35%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDIC 1198
            M  +Y+  +++ +    F++LL+ W+GS+YKLL+ +  +++  +Y + F+YR  L ++ +  FE++  YCD+    IP+SF+LGF+V  V+ RWW  Y  +PW +R+  +  G + G+  E+   ++ TL+RY  L  +L++R +S  +  RF                         +Q+ F   +T AE +  E ++  +    N+     +W+P  W + L  K +L G I D      L+ E++ LR Q  +L     I IPLVYTQVV +AVYS+FL  L   QF   +K         GH +D    P+FT  QF F +GWLKVA  L+N FG+  +DF+T  I+D NL + 
Sbjct:    1 MTITYTSQVANARLG-SFSRLLLCWRGSIYKLLYGEFFIFLLCYYIIRFIYRLALTEEQQLMFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGK-DEQGRLLRRTLIRYANLGNVLILRSVSTAVYKRFPSAQ-------------------HLVQAGF---MTPAEHKQLEKLSLPH----NM-----FWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYP------GHELDLVV-PVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVS 318          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8NFU1|BEST2_HUMAN (Bestrophin-2 OS=Homo sapiens OX=9606 GN=BEST2 PE=1 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 1.160e-52
Identity = 121/357 (33.89%), Postives = 190/357 (53.22%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +Y+  +++ +    F++LL+ W+GS+YKLLW +LL ++  + +L   YR  L +  K  FE++V YCD   + IP+SF+LGF+V  V++RWW  Y+ +P  + +  +  G + G+  +R    + TLMRY  LS +L++R +S  +  RF                      D  +++ F   +T  E + FE++   N + N      +YW+P  W S L  +    G I D      L+EEL+  R +   L     I +PLVYTQVV IA+YSYFL  L   QF   ++G  +      H++D    P+FT+ QF F  GWLKVA  L+N FG+  +DF+T  ++D N  +
Sbjct:    1 MTVTYTARVANARFG-GFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGR-DDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFP-------------------TIDHVVEAGF---MTREERKKFENL---NSSYN------KYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKD------HDLDLCV-PIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQV 317          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267FNT5 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025133g2 PE=3 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 1.074e-111
Identity = 193/440 (43.86%), Postives = 272/440 (61.82%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNLHDKH-KSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVG--QTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEE-YSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQF---PIKSKGISNKTEI------------IGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCT-FPEMLTPVNFK-FRGGDSQYTDSFHCFIEATEDDLEEIDPPLVEHDVTALELS 1384
            M  +YS TIS  Q   +F K+L+ WKGSLYKL++ DL+ Y+ ++Y  +  YR L     + NFE +V +C  M  NIPLSF+LGFFVAGV+ RWW+MYM IPWLNR+AF   G I G   T E   +++ +LMRY+ L+WILLM  IS++I  RFS     + +E   VR +L N NR  K+Q  FRK++T+ EI AF    A+   +   KYVP+YW+PL WA+ L +K  ++GY  D R+ V ++ E++ +R  MH L +   +MIPLVYTQVVIIAVYSYFL QLF+ QF    + ++ +S +T               G  ID +F P+FTV QFLF+MGWLKVA+C++N FGD  EDF T++ILD NL+I  RC   +    +PE LT  + +  +       D+   +++A E +   + PP  E  +  L+++
Sbjct:    1 MTVAYSETISSSQGG-VFIKILLLWKGSLYKLVYTDLIAYLLIYYVFNISYRVLMPPETRQNFELVVRFCSGMDKNIPLSFILGFFVAGVIGRWWEMYMNIPWLNRIAFCCYGLITGTKDTFEVAKQIRCSLMRYMNLAWILLMHSISERIVHRFSNTEEAAADENGGVRALLENINRCDKVQLHFRKLVTENEIDAFARAEAEYKIKYQKKYVPDYWLPLHWAALLSKKAMIHGY-CDPRSMVMIMREVERVRCMMHTLNIYNDVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKLTAEMMSARTNATVMPVTVTSSSSTGDVIDMYF-PIFTVLQFLFLMGWLKVAMCVMNPFGDDDEDFHTSDILDYNLEITSRCVEGQSAPHYPEGLTEPSMEWLKKSAGSEGDNMLEYLDAAEMEFSVVPPPPPEKFLEPLQMT 437          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A1I8HMQ9 (Bestrophin homolog OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 1.196e-111
Identity = 193/443 (43.57%), Postives = 274/443 (61.85%), Query Frame = 2
Query:  119 YSIMPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNLHDKH-KSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVG--QTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEE-YSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQF---PIKSKGISNKTEI------------IGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCT-FPEMLTPVNFK-FRGGDSQYTDSFHCFIEATEDDLEEIDPPLVEHDVTALELS 1384
            ++ M  +YS TIS  Q   +F K+L+ WKGSLYKL++ DL+ Y+ ++Y  +  YR L     + NFE +V +C  M  NIPLSF+LGFFVAGV+ RWW+MYM IPWLNR+AF   G I G   T E   +++ +LMRY+ L+WILLM  IS++I  RFS     + +E   VR +L N NR  K+Q  FRK++T+ EI AF    A+   +   KYVP+YW+PL WA+ L +K  ++GY  D R+ V ++ E++ +R  MH L +   +MIPLVYTQVVIIAVYSYFL QLF+ QF    + ++ +S +T               G  ID +F P+FTV QFLF+MGWLKVA+C++N FGD  EDF T++ILD NL+I  RC   +    +PE LT  + +  +       D+   +++A E +   + PP  E  +  L+++
Sbjct:   12 FAEMTVAYSETISSSQGG-VFIKILLLWKGSLYKLVYTDLIAYLLIYYVFNISYRVLMPPETRQNFELVVRFCSGMDKNIPLSFILGFFVAGVIGRWWEMYMNIPWLNRIAFCCYGLITGTKDTFEVAKQIRCSLMRYMNLAWILLMHSISERIVHRFSNTEEAAADENGGVRALLENINRCDKVQLHFRKLVTENEIDAFARAEAEYKIKYQKKYVPDYWLPLHWAALLSKKAMIHGY-CDPRSMVMIMREVERVRCMMHTLNIYNDVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKLTAEMMSARTNATVMPVTVTSSSSTGDVIDMYF-PIFTVLQFLFLMGWLKVAMCVMNPFGDDDEDFHTSDILDYNLEITSRCVEGQSAPHYPEGLTEPSMEWLKKSAGSEGDNMLEYLDAAEMEFSVVPPPPPEKFLEPLQMT 451          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267DTW2 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000907g3 PE=3 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 2.281e-107
Identity = 191/458 (41.70%), Postives = 277/458 (60.48%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRN-LHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTS--ERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKN-------------FDS------------------TEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQF----------------PIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEMLTPVNFKFRGGDSQY-TDSFHCFIEATEDDLEEIDPP 1348
            M  SYS TIS  Q   +F K+L+ WKGSLYKLL+ DL+VY+ ++Y+ + +YR  +  + + +FE +V++C+ M  +IPLSF+LGFFVAGV+ RWW+MY+ IPWLNR++F A G + G     E   ++++++MRY+ L WILLM  IS+QI  RFS +              FD                    EE  VR +L N N+  +++  FRK++T+AEI AF     +   +   KYVPEYW+PLQWA+ L +K  ++G+  D R+ V ++EE++ +R  M  L +   +MIPLVYTQVVIIAVYS+FL QLF+ QF                 +    I NK    G  ID +F P+FTVFQF+F+MGWLKVA+C++N FGD  EDF T+EIL+ NL+I  RC+  +  TFPE L+  + ++      +  D+   ++EA E +   ++PP
Sbjct:    1 MTVSYSETISSSQGG-VFIKILLLWKGSLYKLLYTDLIVYLIMYYAFNIIYRACMGPEARQSFELVVKFCEEMDKSIPLSFILGFFVAGVIGRWWQMYLNIPWLNRISFFAYGILTGTKDSFETARRLRLSIMRYMNLGWILLMHSISEQIMHRFSGQEEEEQDMRSRLAYLFDRLRGMNQLSAELRSNSKKVQEERGVRGLLENINKCPEVKLHFRKLVTEAEIEAFVRAEGEYKNKYQKKYVPEYWLPLQWAALLCKKAMMHGF-CDPRSMVMMMEEIEEVRGTMQTLVIYNDVMIPLVYTQVVIIAVYSFFLLQLFSQQFVNPKLTADLLSAERNVTVTPISIGNKDNH-GEVIDMYF-PVFTVFQFMFLMGWLKVAMCVMNPFGDDDEDFHTSEILNYNLEISSRCAEGQAITFPEGLSEPSMEWIKKSPGFEADNLFEYLEAAEMEFSAVEPP 454          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267F2G9 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000907g1 PE=3 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 2.527e-107
Identity = 181/396 (45.71%), Postives = 257/396 (64.90%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRN-LHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTS--ERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDST--------EEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQF----------------PIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFP 1234
            M  SYS TIS  Q   +F K+L+ WKGSLYKLL+ DL+VY+ ++Y+ + +YR  +  + + +FE +V++C+ M  +IPLSF+LGFFVAGV+ RWW+MY+ IPWLNR++F A G + G     E   ++++++MRY+ L WILLM  IS+QI  RFS +  +          EE  VR +L N N+  +++  FRK++T+AEI AF     +   +   KYVPEYW+PLQWA+ L +K  ++G+  D R+ V ++EE++ +R  M  L +   +MIPLVYTQVVIIAVYS+FL QLF+ QF                 +    I NK    G  ID +F P+FTVFQF+F+MGWLKVA+C++N FGD  EDF T+EIL+ NL+I  RC+  +  TFP
Sbjct:    1 MTVSYSETISSSQGG-VFIKILLLWKGSLYKLLYTDLIVYLIMYYAFNIIYRACMGPEARQSFELVVKFCEEMDKSIPLSFILGFFVAGVIGRWWQMYLNIPWLNRISFFAYGILTGTKDSFETARRLRLSIMRYMNLGWILLMHSISEQIMHRFSGQEEEEPQSKSNLVQEERGVRGLLENINKCPEVKLHFRKLVTEAEIEAFVRAEGEYKNKYQKKYVPEYWLPLQWAALLCKKAMMHGF-CDPRSMVMMMEEIEEVRGTMQTLVIYNDVMIPLVYTQVVIIAVYSFFLLQLFSQQFVNPKLTADLLSAERNVTVTPISIGNKDNH-GEVIDMYF-PVFTVFQFMFLMGWLKVAMCVMNPFGDDDEDFHTSEILNYNLEISSRCAEGQAITFP 392          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267GQY7 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016709g1 PE=3 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 3.659e-107
Identity = 193/469 (41.15%), Postives = 272/469 (58.00%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNLHDKH-KSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVG--QTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSK------------------------------KNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQF---PIKSKGISNKTEI------------IGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCT-FPEMLTPVNFK-FRGGDSQYTDSFHCFIEATEDDLEEIDPPLVEHDVTALELS 1384
            M  +YS TIS  Q   +F K+L+ WKGSLYKL++ DL+ Y+ ++Y  +  YR L     + NFE +V +C  M  NIPLSF+LGFFVAGV+ RWW+MYM IPWLNR+AF   G I G   T E   +++ +LMRY+ L+WILLM  IS++I  RFS                               +   + E   VR +L N NR  K+Q  FRK++T+ EI AF    A+   +   KYVP+YW+PL WA+ L +K  ++GY  D R+ V ++ E++ +R  MH L +   +MIPLVYTQVVIIAVYSYFL QLF+ QF    + ++ +S +T               G  ID +F P+FTV QFLF+MGWLKVA+C++N FGD  EDF T++ILD NL+I  RC   +    +PE LT  + +  +       D+   +++A E +   + PP  E  +  L+++
Sbjct:    1 MTVAYSETISSSQGG-VFIKILLLWKGSLYKLVYTDLIAYLLIYYVFNISYRVLMPPETRQNFELVVRFCSGMDKNIPLSFILGFFVAGVIGRWWEMYMNIPWLNRIAFCCYGLITGTKDTFEVAKQIRCSLMRYMNLAWILLMHSISERIVHRFSNTEEAAQQGGQSKLRYLFGRLIGMNQLSAELRATKADENGGVRALLENINRCDKVQLHFRKLVTENEIDAFARAEAEYKIKYQKKYVPDYWLPLHWAALLSKKAMIHGY-CDPRSMVMIMREVERVRCMMHTLNIYNDVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKLTAEMMSARTNATVMPVTVTSSSSTGDVIDMYF-PIFTVLQFLFLMGWLKVAMCVMNPFGDDDEDFHTSDILDYNLEITSRCVEGQSAPHYPEGLTEPSMEWLKKSAGSEGDNMLEYLDAAEMEFSVVPPPPPEKFLEPLQMT 466          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 204.912 bits (520), Expect = 3.021e-57
Identity = 124/357 (34.73%), Postives = 192/357 (53.78%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNLHDKHKSN-FEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +YS  ++D +    F+ LL+RWKGS+YKLL+ +LL++  L+ ++  LYR L D  +   FE++  YCD     IP+SF+LGF+V  V+ RWW  + ++PW +R+A +  GA V    E    ++ +L+RY  LS +L+ R IS  +  RF       T E+ V+  L+     R++                +  +  N          ++W+P  W   L  +    G I +      ++ EL+ LR+Q   L     I +PLVYTQVV +AVYS+FL  L   QF   ++G S      GH++DF+  P+FT+ QF F +GWLKVA  L+N FG+  +DF+T  ++D NL +
Sbjct:    1 MTVTYSRRVADARLG-TFSHLLLRWKGSIYKLLYRELLIFTVLYCTISVLYRFLLDNEQRRLFEKLAIYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLAALV-GAYVRGADEGARLIRRSLVRYANLSGVLIYRSISTAVYKRF------PTIEHLVQAGLMTVEERRQLD---------------DLPSPHN----------KFWVPCMWFVNLALRARTEGRINNDVALSAILNELNTLRSQCMKLYSYDWISLPLVYTQVVTVAVYSFFLACLIGRQFLDPTQGYS------GHDLDFYL-PVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQV 317          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 188.734 bits (478), Expect = 9.025e-52
Identity = 118/355 (33.24%), Postives = 183/355 (51.55%), Query Frame = 2
Query:  179 FAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRN-LHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEM 1240
            F+KLL+ W+GS+YK+L+ ++L +  L+ ++   YR  L D+ K  FE++  YC+   + IP+SF+LGF+V  +++RWW  Y +IP  + +  +  G + G   ER   ++ TLMRY  L+ +L++R +S  +  RF                      D  +++ F   +T  E + FES+ +            +YWIP  W + L       G I D  T   L+EEL+  R +   L     I +PLVYTQVV +AVYS+FL  L   QF   S+         GH++D +  P+FT+ QF F  GWLKVA  L+N FG+  +DF+T  ++D N  +     +      P M
Sbjct:   17 FSKLLLAWRGSIYKVLYKEVLAFFILYTAISITYRFFLLDEQKRYFEKLSIYCNHYASLIPMSFVLGFYVTLIVNRWWSQYTSIPLPDSIMCVLSGGLQG-GDERGRLLRRTLMRYASLASLLILRSVSTAVFKRFP-------------------TMDHVVEAGF---MTREERKKFESLHSP---------YNKYWIPCVWFTNLAAVARSEGRIKDDNTYKLLLEELNKFRGKCSLLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQAYP------GHDLDLYV-PIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAVDEMFGDLPMM 332          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 168.318 bits (425), Expect = 9.422e-47
Identity = 111/358 (31.01%), Postives = 176/358 (49.16%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRN-LHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQ-VVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  SY+  +++ + A  F KLL RWKGS+YKLL+ + L++  L+     +YR  L D  +  FE+   +C+     IP+SF+L F+V     RWW  Y + P  + +  +  G + G + ER   ++ TLMRY  LS +L++R IS ++  RF                         +Q      +T+ E+R  + + +            +YW+PL W + L  K    G + D      L++EL+N R +   L     I IPLVYTQ VV +AVYS+F   L   QF    +    K  +        + P+FT+ +F F  GWLKV   ++N FG+  +DF+T +++D N+ +
Sbjct:    1 MTVSYTLEVANARFA-GFTKLLFRWKGSIYKLLYKEFLLFCFLYSLFSLIYRCVLTDGQQELFERAARHCNKFAKLIPMSFVL-FYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHG-SDERGRLLRRTLMRYANLSSVLILRSISTRVHKRFPT-----------------------LQHIVDAFMTEEEMRTLDHLYSD---------FNKYWMPLTWFANLASKAREEGRVKDDIALRLLMDELNNYRGKCSMLFHYDWISIPLVYTQQVVTLAVYSFFAFCLIGRQFVKPERADELKVHVD------LYVPVFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQV 317          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 173.711 bits (439), Expect = 2.592e-46
Identity = 114/357 (31.93%), Postives = 179/357 (50.14%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNLHDKHKSN-FEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +YS  ++D +    F+ LL+RWKGS+YKLL+ +LL++  L+ ++  LYR L D  +   FE++  YCD     IP+SF+LGF+V  V+ RWW  + ++PW +R+A +  GA V    E    ++ +L+RY  LS +L+ R IS  +  RF       T E+ V+  L+     R++                +  +  N          ++W+P  W   L  +    G I                    +N   L +I+       VV +AVYS+FL  L   QF   ++G S      GH++DF+  P+FT+ QF F +GWLKVA  L+N FG+  +DF+T  ++D NL +
Sbjct:    1 MTVTYSRRVADARLG-TFSHLLLRWKGSIYKLLYRELLIFTVLYCTISVLYRFLLDNEQRRLFEKLAIYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLAALV-GAYVRGADEGARLIRRSLVRYANLSGVLIYRSISTAVYKRF------PTIEHLVQAGLMTVEERRQLD---------------DLPSPHN----------KFWVPCMWFVNLALRARTEGRI--------------------NNDVALSAIL------NVVTVAVYSFFLACLIGRQFLDPTQGYS------GHDLDFYL-PVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQV 291          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 98.2117 bits (243), Expect = 1.976e-21
Identity = 68/212 (32.08%), Postives = 99/212 (46.70%), Query Frame = 2
Query:  671 FRKVITDAEIRAFE--SIAAQNFARN-NIKYV-----PE--------------YWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEM 1240
            +R V+TD + R FE  SI    +A    + +V     PE              YWIP  W + L  K   +G I D      ++ E++  R     L     + IPLVYTQVV +AVY++F   +   QF   ++G        GH++D +  P+FT+ QF F  GWLKVA  L+N FG+  +DF+    +D NL +     +      P M
Sbjct:   50 YRWVLTDPQRRLFEKLSIYCDRYAEQIPVTFVLGFMTPEEKKIFENLKSPHLKYWIPTVWFTNLASKARKDGRIQDSVDLQTILTEMNRFRTWCSTLFGYDWVGIPLVYTQVVTLAVYTFFSASIIGRQFLDPAQGYP------GHDLDLYV-PVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWCIDRNLQVSLMAVDEMHMNIPRM 254          

HSP 2 Score: 61.6178 bits (148), Expect = 1.102e-9
Identity = 32/85 (37.65%), Postives = 52/85 (61.18%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGF 379
            M  +YS  +++  +   F +LL+RW+GS+YKLL+ + L +  L+  L  +YR  L D  +  FE++  YCD     IP++F+LGF
Sbjct:    1 MTVTYSSKVANA-TFFGFHRLLLRWRGSIYKLLYREFLFFALLYSILSLVYRWVLTDPQRRLFEKLSIYCDRYAEQIPVTFVLGF 84          
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 195.282 bits (495), Expect = 2.320e-57
Identity = 118/357 (33.05%), Postives = 193/357 (54.06%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRN-LHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +YS+ +++ +    F++LL+RWKGS+YKLL+ +  +++ LF++L  +YR  L +  K  FE++  YC+     IP+SF+LGF+V  V+ RWW  Y ++PW +R+  +    + G   ER   ++ TLMRY  LS +L++R +S  +  RF                      D  +++ F   +T AE R F+ + + +          ++W+P  W + L  +    G I+D  +   ++ +L+N R+    L     + IPLVYTQVV +AVYS+FL  L   QF +  +G        GH++D +  P+FT+ QF F  GWLKVA  L+N FG+  +DF+    +D NL +
Sbjct:    1 MTVTYSNKVANARLG-GFSQLLLRWKGSIYKLLYKEFCIFLVLFFTLSSVYRYMLQENQKRYFEKLAMYCNKYAELIPVSFVLGFYVTLVVSRWWSQYESLPWPDRLMHLVACNVHG-ADERGRLLRRTLMRYANLSALLILRSVSTAVYKRFP-------------------TMDHVVEAGF---MTPAERRKFDGLRSPH---------NKFWVPCVWFANLAAQAKAEGRILDNVSLQLILNDLNNFRSCCSMLYSYDWVSIPLVYTQVVTVAVYSFFLACLIGRQF-LGPQGYP------GHDMDLYI-PVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFEANWCVDRNLQV 316          
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 178.718 bits (452), Expect = 9.279e-50
Identity = 113/357 (31.65%), Postives = 181/357 (50.70%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +Y++ +++ +    F+KLL++W+GS+YKLL+ +  +Y  ++ +L    R  L +  K  FE++  YC+     IP+    GF+VA V+ RWW  Y +IP  +R+     G + G   ER   ++ TLMRY  LS +L++R +S  +  RF                      D  +++ F   +T  E + F+ +              +YW+P  W S L  +    G + D      L++E++  R     L     I +PLVYTQVV +AVYS+FL  L   QF   ++G        GH++D +  P+FT+ QF F  GWLKVA  L+N FG+  +DF+T  ++D NL +
Sbjct:    1 MTVTYTNRVANAR-LCGFSKLLLQWRGSIYKLLYREFSIYFMMYAALSLTSRFALSEDQKRLFEKLSLYCNNYANLIPVRSCSGFYVALVVSRWWSQYTSIPTPDRLMCAVAGTVHG-VDERGRLLRRTLMRYANLSALLILRSVSTAVYKRFPTM-------------------DHVVEAGF---MTRDERKRFDGLRCS---------YNKYWVPCVWLSSLAAQARAEGRVRDDVALKLLLDEMNVYRGNCGMLFHYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPAQGYP------GHDMDLYI-PVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNLQV 317          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:101167866])

HSP 1 Score: 201.06 bits (510), Expect = 5.681e-56
Identity = 121/356 (33.99%), Postives = 188/356 (52.81%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            M  +YS  ++D      F  LL+RWKGS+YKLL+ +L+++  L+Y L  +Y  L +  +  FE++  YCD     IP+SF+L F+V  V+ RWW  +  IPW +R+A +  G + G T E     +  LMRY+ LS +L+ R +S  +  RF       T E+ V+ ++                 T  E+R FE + + +          ++W+P  W   L  +    G I +      ++ EL++LR +   L     I +PLVYTQV  +AVYS+FL  L   QF   ++G        GH++DF+  P+FT+ QF F +GWLKVA  L+N FG+  +DF+T  ++D NL +
Sbjct:    1 MTVTYSRRVADAGLGTFF-HLLLRWKGSIYKLLYRELIIFTLLYYFLSLVYYMLDNDQRRLFERLSIYCDRYAELIPVSFVL-FYVTLVVSRWWGQFENIPWPDRLAALVGGHVRG-TDEASRLTRRALMRYVNLSGVLIYRSVSTAVYKRF------PTTEHLVQALM-----------------TSEELRHFEELPSPHN---------KFWVPCMWFVNLALRARTEGRINNDVALTAILTELNSLRAKCMKLYGYDWISLPLVYTQVATVAVYSFFLACLIGRQFLDPAQGYP------GHDVDFYL-PVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWVVDRNLQV 314          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: BEST3 (bestrophin 3 [Source:NCBI gene;Acc:101172121])

HSP 1 Score: 194.126 bits (492), Expect = 8.576e-54
Identity = 119/379 (31.40%), Postives = 196/379 (51.72%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIM-------IPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEM 1240
            M  +YS  +++  + L F +LL+RW+GS+YKLL+ + L++  L+  L  +YR  L ++ K  FE++  YCD     IP++F+LGF+V  V++RWW  ++ +PW +R+ F     + G+  E    ++ TL+RY+ L+ +L+ R +S  +  RF                      D  +++ F   +T  E + FE+I + +          +YWIP+ W S L  +    G I D         +L N+ N+M+  +  C+ +       IPLVYTQVV +AVY++F   +   QF   ++G        GH++D +  P+FT+ QF F  GWLKVA  L+N FG+  +DF+   I+D NL +     +      P M
Sbjct:    1 MTVTYSSKVANA-TFLSFHRLLLRWRGSIYKLLYREFLLFALLYTILSLIYRLALSEQQKRLFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFLNLPWPDRLMFHISSCVQGK-DEYGRLLRRTLVRYINLTSLLIFRSVSTAVCKRFPTI-------------------DHVVEAGF---MTPEERKVFENIRSPHL---------KYWIPVVWFSNLASRARQEGRIQDA-------IDLQNILNEMNTFRTWCATLFGYDWVGIPLVYTQVVTLAVYTFFFACIIGRQFLDPAQGHP------GHDLDLYV-PVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWIIDRNLQVSLLAVDEMHMNLPHM 332          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: best2 (bestrophin 2 [Source:NCBI gene;Acc:110015962])

HSP 1 Score: 189.889 bits (481), Expect = 1.474e-52
Identity = 114/340 (33.53%), Postives = 179/340 (52.65%), Query Frame = 2
Query:  179 FAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRN-LHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDI 1195
            F+KLL+ WKGS+YK+L+ + L +  L+ ++   YR  L++  K  FE++  YC+   + IP+SF+LGF+V  +++RWW  Y +IP  +R+  +  G + G   ER   ++ ++MRY  LS +L++R +S  +  RF                      D  +++ F   +T  E + FE + +            +YWIP  W + L       G I D      L+EEL+  R +   L     + +PLVYTQVV +AVYS+FL  L   QF   S+G        GH++D +  P+FT+ QF F  GWLKVA  L+N FG+  +DF+T  ++D N  +
Sbjct:   17 FSKLLLAWKGSIYKVLYKEFLAFFVLYAAISITYRFFLYEDQKRYFEKLAIYCNHYASLIPMSFVLGFYVTLIVNRWWNQYTSIPLPDRIMCVLSGGLQGN-DERGRLLRRSMMRYASLSALLILRSVSTAVFKRFP-------------------TMDHVVEAGF---MTREERKKFEGLHSP---------YNKYWIPCVWFTNLAAVARCEGRIRDDHALKLLLEELNAFRGKCSLLFHYDMVSVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQGYQ------GHDLDLYV-PIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQV 317          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000060552.1 (SMESG000060552.1)

HSP 1 Score: 1023.46 bits (2645), Expect = 0.000e+0
Identity = 508/510 (99.61%), Postives = 508/510 (99.61%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEMLTPVNFKFRGGDSQYTDSFHCFIEATEDDLEEIDPPLVEHDVTALELSPTTXXXXXXXXXXXXGENDEFISPFDKQRDKNVSKSKSSLDESWNEEHFRDNKSFPILNEPTSSHSNGDSLLGSNVNLISRTYSRQNMLDR 1657
            MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLN FGDAQEDFKTTEILDMNLDICWRCSN ELCTFPEMLTPVNFKFRGGDSQYTDSFHCFIEATEDDLEEIDPPLVEHDVTALELSPTTCMKLKKCLCSKCGENDEFISPFDKQRDKNVSKSKSSLDESWNEEHFRDNKSFPILNEPTSSHSNGDSLLGSNVNLISRTYSRQNMLDR
Sbjct:    1 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNPFGDAQEDFKTTEILDMNLDICWRCSNAELCTFPEMLTPVNFKFRGGDSQYTDSFHCFIEATEDDLEEIDPPLVEHDVTALELSPTTCMKLKKCLCSKCGENDEFISPFDKQRDKNVSKSKSSLDESWNEEHFRDNKSFPILNEPTSSHSNGDSLLGSNVNLISRTYSRQNMLDR 510          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000022757.1 (SMESG000022757.1)

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 265/426 (62.21%), Postives = 335/426 (78.64%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKG--ISN--KTEII--GHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEMLTPVNFKFRGGDSQYTDSFHCFIEATEDDLEEIDPPLVEHDVTALELS 1384
            MPT Y+  +++GQ  LIF KLL+RWKGSLYKLLWIDLL+Y+  FY+LH +YR  L D  K NFE+I+ YC+ MKT IP+SFLLGFFV+GV+ RWW+MYM IPWLNR+ F++DG I+G++     K+K TLMRYLILSWILLM++ISKQI+SRF  K   + ++ SVR++L+NFN+DRKIQ TF+K++TD+EIR FE IAAQN+ R + KY+PEYWIPLQWASRLLQK  +NG+IVD+RTTVKLI+ELD LR QM NL++LCSIMIPLVYTQVVIIAVYSYFLCQLFASQF +   G  +SN  KTE +  G +IDF FYPLFT+FQFLFIMGWLKVAICLLN FG+ +EDF+T++ILD NLD+CWR        +P++L+P  F F+   +   DS + FI  TE+D+ EI+P L + +  + E S
Sbjct:    1 MPTPYADDVANGQGVLIFFKLLMRWKGSLYKLLWIDLLIYIGCFYALHVVYRFALDDSQKRNFEEIIIYCEKMKTTIPISFLLGFFVSGVVGRWWQMYMGIPWLNRVTFLSDGIIIGKSPPESRKIKTTLMRYLILSWILLMKKISKQIESRFIIKGGKNGDKVSVRDMLLNFNQDRKIQRTFKKIVTDSEIRTFECIAAQNYVRTDTKYIPEYWIPLQWASRLLQKALMNGFIVDIRTTVKLIDELDRLRGQMQNLRLLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFSVDYDGDNVSNITKTEPLRKGSDIDFIFYPLFTIFQFLFIMGWLKVAICLLNPFGNGEEDFQTSDILDQNLDVCWRSGCAHDDNYPDLLSPPLFNFKVT-APSNDSLNTFISLTEEDISEIEPSLDDKNHPSFEWS 425          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000070057.1 (SMESG000070057.1)

HSP 1 Score: 456.447 bits (1173), Expect = 2.982e-156
Identity = 222/422 (52.61%), Postives = 302/422 (71.56%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNL--HDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEMLTPVNFKFRGGDSQYTDSFHCFIEATEDDLEEIDPPLVEHDVTALELSP 1387
            M  SYS  ISDGQ  +IF KLL RWKGSLYKL++ DL+ YV ++Y ++ +YR        K +FE+IV++CD MK NIP+SFLLGFFV GV+ RW+++Y+ IP+LNRMAF+++G I G   E+  K++ TLMRYL LSWIL MR++S QI  RF   + ++ EE+  R   +NFNRD+KIQSTFRK+ITDAE+RAFE+IAA+N+++   K+ PE+W+P+QW+SRLLQK F++G+I D RT   +I +LD LR QMH L++   IMIPLVYTQV+IIAVYSYFLCQLFASQF      +  +++I GH +D +  P+FT+FQFLF MGWLKVA+C++N FGD  EDF+T++ILD NLD+ +R    +   +PE L P    ++   +   D    F++  + DLEE      E DVT LE++P
Sbjct:    1 MTVSYSEDISDGQGFMIFIKLLTRWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKHNDENNNEEHHFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQF------VDPESKITGHEVDLYV-PIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITP 415          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000070057.1 (SMESG000070057.1)

HSP 1 Score: 431.795 bits (1109), Expect = 1.287e-146
Identity = 209/403 (51.86%), Postives = 290/403 (71.96%), Query Frame = 2
Query:  185 KLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYRNL--HDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEMLTPVNFKFRGGDSQYTDSFHCFIEATEDDLEEIDPPLVEHDVTALELSP 1387
            +LL +WKGSLYKL++ DL+ YV ++Y ++ +YR        K +FE+IV++CD MK NIP+SFLLGFFV GV+ RW+++Y+ IP+LNRMAF+++G I G   E+  K++ TLMRYL LSWIL MR++S QI  RF   + ++ EE+  R   +NFNRD+KIQSTFRK+ITDAE+RAFE+IAA+N+++   K+ PE+W+P+QW+SRLLQK F++G+I D RT   +I +LD LR QMH L++   IMIPLVYTQV+IIAVYSYFLCQLFASQF      +  +++I GH +D +  P+FT+FQFLF MGWLKVA+C++N FGD  EDF+T++ILD NLD+ +R    +   +PE L P    ++   +   D    F++  + DLEE      E DVT LE++P
Sbjct:   20 RLLKKWKGSLYKLVYKDLMGYVGIYYVINLIYRFALKTPAQKRSFEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRFKHNDENNNEEHHFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQF------VDPESKITGHEVDLYV-PIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITP 415          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000065100.1 (SMESG000065100.1)

HSP 1 Score: 427.172 bits (1097), Expect = 2.635e-145
Identity = 207/411 (50.36%), Postives = 290/411 (70.56%), Query Frame = 2
Query:  128 MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFLYR-NLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAIPWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQSRFSK-KNF--DSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQNFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLRNQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKTEIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEILDMNLDICWRCSNTELCTFPEMLTPVNFKFRGGDSQYTDSFHCFIEATEDDLEEIDPP 1348
            M  SY+  ISDGQ       L +RWKGSLYKLLW+DLL+YV L+Y ++ +YR  L+++ +  FE+IV++CD+ K NIPLSFLLGFFVAG++ RWWKMY+ IPWLN++AF+    I+G    +  ++++ +MRY+ L+WILLMR IS QI+ RF + KN   +   E  ++EIL N N D +I+ TF+K+IT +EIRAFE+IA +   RN I+Y PE+W+P+QWASR++ K F++G+I D RT   L EE++ LR QM NL++  +I+IPLVYTQVV+IAVYSYFL  LFA+QF      +     I+GH +DF+  P+FT+FQFLF+MGWLKVA+C++N FGD  EDF+T+E+LD NLDI +R S      +P +L P   K+R  D+   D+   FI+  E++L +   P
Sbjct:    1 MTISYAAEISDGQGLYCIYTLFMRWKGSLYKLLWVDLLIYVGLYYLINIMYRFALNEQQRRIFEEIVKFCDSKKNNIPLSFLLGFFVAGIIGRWWKMYLCIPWLNKIAFICQSIIIGNGPVKSRRVRLIIMRYMNLAWILLMRNISAQIKVRFQQHKNMKVNYRSENYIKEILENINADERIRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQF------VDPGQRIVGHEVDFYI-PVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDVENNLYKYSEP 404          
The following BLAST results are available for this feature:
BLAST of Bestrophin homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BEST12.331e-5433.52bestrophin 1 [Source:HGNC Symbol;Acc:HGNC:12703][more]
BEST22.416e-5333.89bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST22.416e-5333.89bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST22.416e-5333.89bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST31.173e-5230.91bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best-41.495e-4830.70Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
best-231.846e-4732.40Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:A... [more]
best-35.272e-4730.11Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
best-241.227e-4630.83Bestrophin homolog 24 [Source:UniProtKB/Swiss-Pro... [more]
best-85.599e-4431.73Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best16.975e-6634.58gene:FBgn0040238 transcript:FBtr0082183[more]
Best11.126e-6534.58gene:FBgn0040238 transcript:FBtr0337020[more]
Best11.482e-6534.58gene:FBgn0040238 transcript:FBtr0114590[more]
Best11.587e-6534.58gene:FBgn0040238 transcript:FBtr0306023[more]
Best39.285e-6032.96gene:FBgn0036492 transcript:FBtr0075618[more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best11.297e-5633.61bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best23.298e-5534.26bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best43.997e-5231.94bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best41.788e-5031.75bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best21.032e-2930.12bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best11.555e-5733.33bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best12.725e-5733.33bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best16.003e-5733.33bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best11.018e-5633.33bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best12.129e-5633.33bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best13.431e-5634.17bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332][more]
Best15.551e-5634.17bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332][more]
Best21.770e-5434.73bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best21.770e-5434.73bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best21.770e-5434.73bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
back to top
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O88870|BEST1_MOUSE3.883e-5534.17Bestrophin-1 OS=Mus musculus OX=10090 GN=Best1 PE=... [more]
sp|O76090|BEST1_HUMAN1.119e-5333.52Bestrophin-1 OS=Homo sapiens OX=9606 GN=BEST1 PE=1... [more]
sp|Q8BGM5|BEST2_MOUSE1.735e-5334.73Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=... [more]
sp|Q6UY87|BEST1_MACFA3.624e-5333.24Bestrophin-1 OS=Macaca fascicularis OX=9541 GN=BES... [more]
sp|Q8NFU1|BEST2_HUMAN1.160e-5233.89Bestrophin-2 OS=Homo sapiens OX=9606 GN=BEST2 PE=1... [more]
back to top
BLAST of Bestrophin homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FNT51.074e-11143.86Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A1I8HMQ91.196e-11143.57Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A267DTW22.281e-10741.70Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A267F2G92.527e-10745.71Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A267GQY73.659e-10741.15Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best13.021e-5734.73bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
best29.025e-5233.24bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best49.422e-4731.01bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best12.592e-4631.93bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
BEST31.976e-2132.08bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
best12.320e-5733.05bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best29.279e-5031.65bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bestrophin homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bestrophin homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
best15.681e-5633.99bestrophin-2 [Source:NCBI gene;Acc:101167866][more]
BEST38.576e-5431.40bestrophin 3 [Source:NCBI gene;Acc:101172121][more]
best21.474e-5233.53bestrophin 2 [Source:NCBI gene;Acc:110015962][more]
back to top
BLAST of Bestrophin homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060552.10.000e+099.61SMESG000060552.1[more]
SMESG000022757.10.000e+062.21SMESG000022757.1[more]
SMESG000070057.12.982e-15652.61SMESG000070057.1[more]
SMESG000070057.11.287e-14651.86SMESG000070057.1[more]
SMESG000065100.12.635e-14550.36SMESG000065100.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003406 ID=SMED30003406|Name=Bestrophin homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1709bp
CCCAAATCTCTACTGTTACTGTTTGACAATTATATCTGTTCAAGTTGCAG
ATCATAAATAACGGAATTTAGTATATATGATTAATAGATTGTAACCATTT
GGGATAATTGATTATTAGTATTCTATTATGCCGACATCCTATTCTCACAC
GATTTCAGACGGTCAAAGTGCTTTGATATTTGCCAAATTATTGATAAGGT
GGAAAGGAAGTTTATACAAATTATTATGGATCGATCTTTTAGTCTATGTC
AGCTTGTTTTACAGTCTTCATTTCCTTTATCGCAATCTTCACGACAAACA
CAAAAGTAATTTTGAACAGATTGTAGAATATTGCGATGCAATGAAAACAA
ACATTCCTTTGTCTTTCCTGTTGGGGTTTTTTGTAGCTGGAGTTTTGGAC
AGGTGGTGGAAGATGTACATGGCAATTCCTTGGTTAAATCGAATGGCTTT
TATGGCAGATGGTGCAATTGTCGGCCAGACGTCAGAACGAGTGAGCAAAA
TGAAAATGACATTAATGAGATATTTGATTCTTTCTTGGATTCTTTTAATG
AGAGAAATCAGCAAACAAATACAGTCTAGGTTTTCCAAGAAAAATTTCGA
TTCTACCGAAGAATATTCAGTGAGGGAAATTCTAGTCAATTTTAATAGGG
ACCGGAAAATTCAAAGCACGTTTAGAAAAGTCATCACGGACGCTGAAATT
CGTGCATTTGAGAGCATAGCGGCACAGAACTTTGCTCGCAACAATATCAA
ATACGTTCCAGAATACTGGATTCCGTTGCAGTGGGCTTCGAGACTTTTGC
AGAAAGGTTTTCTAAATGGATACATTGTAGACATGAGGACTACCGTTAAA
TTAATAGAAGAACTTGACAATTTACGCAATCAAATGCATAATTTGAAAAT
GTTGTGTAGCATCATGATACCGCTTGTTTATACGCAGGTGGTTATCATAG
CTGTTTACAGTTATTTCTTGTGTCAACTATTTGCTTCTCAATTCCCAATT
AAATCCAAAGGGATTTCAAATAAAACAGAAATCATCGGTCATAACATAGA
TTTTTTCTTTTATCCCTTGTTTACAGTGTTTCAGTTTCTATTCATTATGG
GGTGGTTAAAAGTAGCAATTTGTTTATTAAATCATTTTGGGGATGCCCAA
GAAGACTTTAAAACAACTGAGATATTGGATATGAATCTTGACATTTGCTG
GAGATGTAGTAATACAGAATTATGCACTTTCCCAGAAATGTTGACTCCTG
TCAATTTCAAATTCAGAGGTGGAGACAGCCAGTATACAGATTCTTTTCAT
TGTTTCATTGAAGCTACAGAAGACGACTTAGAAGAAATAGATCCTCCTCT
TGTAGAGCATGATGTAACAGCTTTGGAGTTATCCCCAACTACATGTATGA
AACTGAAAAAGTGTCTGTGCTCAAAATGTGGTGAAAATGACGAATTTATT
TCCCCTTTTGATAAACAGAGAGACAAAAATGTCAGCAAAAGCAAATCTTC
ACTGGACGAATCTTGGAATGAAGAGCATTTCAGAGATAATAAATCATTTC
CTATTCTCAATGAACCAACTAGCAGTCATTCCAATGGAGATAGTTTGCTC
GGAAGCAATGTAAACCTGATTTCAAGGACTTACTCAAGACAAAATATGTT
GGACAGGTGATTATGATAACTAGAGAGATTTATTTGAATAATATTTTGTA
AATAATAAT
back to top

protein sequence of SMED30003406-orf-1

>SMED30003406-orf-1 ID=SMED30003406-orf-1|Name=SMED30003406-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=511bp
MPTSYSHTISDGQSALIFAKLLIRWKGSLYKLLWIDLLVYVSLFYSLHFL
YRNLHDKHKSNFEQIVEYCDAMKTNIPLSFLLGFFVAGVLDRWWKMYMAI
PWLNRMAFMADGAIVGQTSERVSKMKMTLMRYLILSWILLMREISKQIQS
RFSKKNFDSTEEYSVREILVNFNRDRKIQSTFRKVITDAEIRAFESIAAQ
NFARNNIKYVPEYWIPLQWASRLLQKGFLNGYIVDMRTTVKLIEELDNLR
NQMHNLKMLCSIMIPLVYTQVVIIAVYSYFLCQLFASQFPIKSKGISNKT
EIIGHNIDFFFYPLFTVFQFLFIMGWLKVAICLLNHFGDAQEDFKTTEIL
DMNLDICWRCSNTELCTFPEMLTPVNFKFRGGDSQYTDSFHCFIEATEDD
LEEIDPPLVEHDVTALELSPTTCMKLKKCLCSKCGENDEFISPFDKQRDK
NVSKSKSSLDESWNEEHFRDNKSFPILNEPTSSHSNGDSLLGSNVNLISR
TYSRQNMLDR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000615Bestrophin
IPR021134Bestrophin/UPF0187
Vocabulary: cellular component
TermDefinition
GO:0034707chloride channel complex
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:1902476chloride transmembrane transport
GO:0006810transport
GO:0006811ion transport
GO:0006821chloride transport
Vocabulary: molecular function
TermDefinition
GO:0005254chloride channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 239..259
NoneNo IPR availablePANTHERPTHR10736:SF55BESTROPHIN 1, ISOFORM C-RELATEDcoord: 208..360
NoneNo IPR availablePANTHERPTHR10736:SF55BESTROPHIN 1, ISOFORM C-RELATEDcoord: 2..154
NoneNo IPR availableTMHMMTMhelixcoord: 29..51
NoneNo IPR availableTMHMMTMhelixcoord: 315..337
NoneNo IPR availableTMHMMTMhelixcoord: 259..281
NoneNo IPR availableTMHMMTMhelixcoord: 71..90
IPR021134Bestrophin/UPF0187PFAMPF01062Bestrophincoord: 17..354
e-value: 1.0E-66
score: 225.4
IPR000615BestrophinPANTHERPTHR10736BESTROPHINcoord: 208..360
IPR000615BestrophinPANTHERPTHR10736BESTROPHINcoord: 2..154