Glutamate receptor ionotropic, NMDA 2B

NameGlutamate receptor ionotropic, NMDA 2B
Smed IDSMED30003404
Length (bp)3276
Neoblast Clusters

Zeng et. al., 2018

▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population





Single cell RNA-seq of pluripotent neoblasts and its early progenies

We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)

Explore this single cell expression dataset with our NB Cluster Shiny App


Neoblast Population


t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.

Expression of Glutamate receptor ionotropic, NMDA 2B (SMED30003404) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate receptor ionotropic, NMDA 2B (SMED30003404) in cells (dots) of each of the 12 neoblast clusters.


back to top


Sub-lethal Irradiated Surviving X1 and X2 Cell Population


t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate receptor ionotropic, NMDA 2B (SMED30003404) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate receptor ionotropic, NMDA 2B (SMED30003404) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.


back to top


Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods


back to top
Anatomical Expression

PAGE et. al., 2020


has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE

PAGE Curations: 3

Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30003404SMESG000055022.1 SMESG000055019.1 SMESG000055017.1 SMESG000055013.1 SmedASXL_000945SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30003404SMESG000055022.1 SmedASXL_001242SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30003404SMESG000055022.1 SMESG000055019.1 SMESG000055017.1 SMESG000055013.1 dd_Smed_v6_19886_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Human
Match: GRIN2A (glutamate ionotropic receptor NMDA type subunit 2A [Source:HGNC Symbol;Acc:HGNC:4585])

HSP 1 Score: 328.946 bits (842), Expect = 7.809e-95
Identity = 229/784 (29.21%), Postives = 382/784 (48.72%), Query Frame = 3
            ++   A  M   ++ Y+W+    L++T  P Y E    ++   +N       +    D+  VI  D  T   D             +  L+KI +S   +IL +  K +  ++   A    LT   G D+ WI+     P     N   + KE              GL   +   +   LE  ++ G+ I  +A + +  K   +              K S     +  ++    +   + N+  +G+ + F E G+    +  +     + KD    W KVG W N+ +S  + +      WP   +      P    L + TL E PFVI        +TC  N +PC+  VK+++   + +N K                    CC G  +D+LK+L + +KF  DL+ V+ +  H     + WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E+ SP G +R       P    F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P+++ P FRF T+PNG+TE NI+ ++P M QYM  FN+  V +A+ +LK  ++DAF+YDA VL++K   D+ CKL  +G   ++A TGYG+ L +GS   + I+  +L +   G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH F+  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Human
Match: GRIN2A (glutamate ionotropic receptor NMDA type subunit 2A [Source:HGNC Symbol;Acc:HGNC:4585])

HSP 1 Score: 328.946 bits (842), Expect = 4.720e-94
Identity = 229/784 (29.21%), Postives = 382/784 (48.72%), Query Frame = 3
            ++   A  M   ++ Y+W+    L++T  P Y E    ++   +N       +    D+  VI  D  T   D             +  L+KI +S   +IL +  K +  ++   A    LT   G D+ WI+     P     N   + KE              GL   +   +   LE  ++ G+ I  +A + +  K   +              K S     +  ++    +   + N+  +G+ + F E G+    +  +     + KD    W KVG W N+ +S  + +      WP   +      P    L + TL E PFVI        +TC  N +PC+  VK+++   + +N K                    CC G  +D+LK+L + +KF  DL+ V+ +  H     + WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E+ SP G +R       P    F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P+++ P FRF T+PNG+TE NI+ ++P M QYM  FN+  V +A+ +LK  ++DAF+YDA VL++K   D+ CKL  +G   ++A TGYG+ L +GS   + I+  +L +   G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH F+  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Human
Match: GRIN2A (glutamate ionotropic receptor NMDA type subunit 2A [Source:HGNC Symbol;Acc:HGNC:4585])

HSP 1 Score: 328.946 bits (842), Expect = 1.865e-93
Identity = 229/784 (29.21%), Postives = 381/784 (48.60%), Query Frame = 3
            ++   A  M   ++ Y+W+    L++T  P Y E    ++   +N       +    D+  VI  D  T   D             +  L+KI +S   +IL +  K +  ++   A    LT   G D+ WI+     P     N   + KE              GL   +   +   LE  ++ G+ I  +A + +  K   +              K S     +  ++    +   + N+  +G+ + F E G+    +  +     + KD    W KVG W N+ +S      +    WP   +      P    L + TL E PFVI        +TC  N +PC+  VK+++   + +N K                    CC G  +D+LK+L + +KF  DL+ V+ +  H     + WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E+ SP G +R       P    F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P+++ P FRF T+PNG+TE NI+ ++P M QYM  FN+  V +A+ +LK  ++DAF+YDA VL++K   D+ CKL  +G   ++A TGYG+ L +GS   + I+  +L +   G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH F+  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Human
Match: GRIN2A (glutamate ionotropic receptor NMDA type subunit 2A [Source:HGNC Symbol;Acc:HGNC:4585])

HSP 1 Score: 328.946 bits (842), Expect = 1.865e-93
Identity = 229/784 (29.21%), Postives = 381/784 (48.60%), Query Frame = 3
            ++   A  M   ++ Y+W+    L++T  P Y E    ++   +N       +    D+  VI  D  T   D             +  L+KI +S   +IL +  K +  ++   A    LT   G D+ WI+     P     N   + KE              GL   +   +   LE  ++ G+ I  +A + +  K   +              K S     +  ++    +   + N+  +G+ + F E G+    +  +     + KD    W KVG W N+ +S      +    WP   +      P    L + TL E PFVI        +TC  N +PC+  VK+++   + +N K                    CC G  +D+LK+L + +KF  DL+ V+ +  H     + WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E+ SP G +R       P    F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P+++ P FRF T+PNG+TE NI+ ++P M QYM  FN+  V +A+ +LK  ++DAF+YDA VL++K   D+ CKL  +G   ++A TGYG+ L +GS   + I+  +L +   G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH F+  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Human
Match: GRIN2B (glutamate ionotropic receptor NMDA type subunit 2B [Source:HGNC Symbol;Acc:HGNC:4586])

HSP 1 Score: 325.094 bits (832), Expect = 4.039e-92
Identity = 247/862 (28.65%), Postives = 413/862 (47.91%), Query Frame = 3
            + P SI+  +C+ +  RK  +  V+         I  I   I       +  +    + I   K E +M      P++   A  M + +  Y+W     +++T  P Y +   +IR           EN F   ++ +V+  D      D SKI+N          L+K+ +    IIL +  K + + ++   EV N   + G  Y WI+       TD            +  EF       GL   +   +   L   ++ G+ I  +A + + ++   +        PK +C    NT    + K +Y++  + + + N+   GR + F E+G+    +  I     + K+    W +VG W++  +       +    WP M   P         L + TL E PFVI         TC  N +PCQ ++   + +N  D++  Y +              CC G  +D+LK++ K +KF  DL+ V+  N   G   +G WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ +  W ++F+  +     A+F++E+ SP G +R     RE     F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P +  P FRF T+PNG+TE NI+ ++ EM  YM  FN+  V +A+ +LK  ++DAF+YDA VL++    D+ CKL  +  G+++A TGYG+ + + S   + ++  IL     G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH F+   R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Celegans
Match: nmr-2 (NMDA class glutamate Receptor [Source:UniProtKB/TrEMBL;Acc:E0AHC1])

HSP 1 Score: 416.387 bits (1069), Expect = 2.622e-128
Identity = 227/625 (36.32%), Postives = 357/625 (57.12%), Query Frame = 3
            +C+       W  GK +Y+ MK +    N   +          F + G L  +  +I N +   K   + W KVG      +  NN + +  V WPG    PP G   K+ +KV TL E PF+ +     D + C  N              +I D  D  Y++      N +     CC+G  +DLL +L  D+ F   L++V      + + E+GWNGLI  L+ +K+DM VTSLK+   R   IDFS+PF +TGI I++K+R G +SPTAFL+P++ ++W +I    +H    +IF++EW+SP+  +    PP EH+FSLFRS WL+W+ LF A+V+ D P+   SR +A +WA F L FLA YTANLAAFMI++  +Y+L G++D  L  P++ KP FRF T+  G T E +K ++ +M +Y+K+  + + ++S  I+A+K +E+DAF+YDA VLD+    D +C L  VG+  +MTGYG+G P+ S     +N  +L YQ+ G L+R + FW++GAC         +  LG++NF+SAF+LL GG+I+S ++L  EH +  ++R  ++  D  G CG++S++MG+ L+F ++V++  +     +        Q++R + A
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Celegans
Match: nmr-2 (NMDA class glutamate Receptor [Source:UniProtKB/TrEMBL;Acc:E0AHC1])

HSP 1 Score: 367.466 bits (942), Expect = 1.074e-116
Identity = 165/397 (41.56%), Postives = 261/397 (65.74%), Query Frame = 3
            K+DM VTSLK+   R   IDFS+PF +TGI I++K+R G +SPTAFL+P++ ++W +I    +H    +IF++EW+SP+  +    PP EH+FSLFRS WL+W+ LF A+V+ D P+   SR +A +WA F L FLA YTANLAAFMI++  +Y+L G++D  L  P++ KP FRF T+  G T E +K ++ +M +Y+K+  + + ++S  I+A+K +E+DAF+YDA VLD+    D +C L  VG+  +MTGYG+G P+ S     +N  +L YQ+ G L+R + FW++GAC         +  LG++NF+SAF+LL GG+I+S ++L  EH +  ++R  ++  D  G CG++S++MG+ L+F ++V++  +     +        Q++R + A
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Celegans
Match: nmr-1 (NMDA class glutamate Receptor; NMDA-type ionotropic glutamate receptor NMR-1 [Source:UniProtKB/TrEMBL;Acc:G5EGQ9])

HSP 1 Score: 159.458 bits (402), Expect = 1.786e-39
Identity = 144/515 (27.96%), Postives = 238/515 (46.21%), Query Frame = 3
            R+  D + W G +   PL       L+V T+A+ PFV          C E         ++ +  +I DK  +    YS  L   + +++  + CCAGLA+DLL  L   +    +D  F  S H N   G  +         +G+I  L    +DM +  + I P R  ++DF+ P+   GI IL K         +FL+P  S+ W  +FI SV   G AI+  ++ SP    +  D+      +  F L+             ++W +W +L  + V+   PR  ++R L  +W  F ++ +ASYTANLAAF++  +    L G+ D RL +P     +F F T+ N    +  K  ++   M + M+  N    SEA+ +L    +DAF++D+  L+ + A  + C+LR  G L+  + YG+GL + S    +I S IL   ++G +++  + W+  G      E   +  +LG+ N    FIL+  G+ L   L   E  + R +  + R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Celegans
Match: nmr-1 (NMDA class glutamate Receptor; NMDA-type ionotropic glutamate receptor NMR-1 [Source:UniProtKB/TrEMBL;Acc:G5EGQ9])

HSP 1 Score: 159.458 bits (402), Expect = 1.786e-39
Identity = 144/515 (27.96%), Postives = 238/515 (46.21%), Query Frame = 3
            R+  D + W G +   PL       L+V T+A+ PFV          C E         ++ +  +I DK  +    YS  L   + +++  + CCAGLA+DLL  L   +    +D  F  S H N   G  +         +G+I  L    +DM +  + I P R  ++DF+ P+   GI IL K         +FL+P  S+ W  +FI SV   G AI+  ++ SP    +  D+      +  F L+             ++W +W +L  + V+   PR  ++R L  +W  F ++ +ASYTANLAAF++  +    L G+ D RL +P     +F F T+ N    +  K  ++   M + M+  N    SEA+ +L    +DAF++D+  L+ + A  + C+LR  G L+  + YG+GL + S    +I S IL   ++G +++  + W+  G      E   +  +LG+ N    FIL+  G+ L   L   E  + R +  + R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Celegans
Match: glr-3 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q21415])

HSP 1 Score: 136.732 bits (343), Expect = 1.645e-32
Identity = 107/368 (29.08%), Postives = 182/368 (49.46%), Query Frame = 3
            W+G++  L    +D+ V SL I+  R+E+IDF+VP+   GI IL K   +R+       F+ P  +  W + F  S      AI+I   +SP+       D G   P +++FSL  S W     L         PR  ++R L  IW  FAL+ ++SYTANLAA + ++     +E  +D         +   ++ T+  G+T     E  I+  +  M Q M +    F ++S  E I  +K+ +  A++ ++++L++  A ++DC+L  +G L    GYG+GLP+GS   + I++ IL  Q+  +L   K+ W         +    ++  G ++    FI+L+ G++L+ VL+I E    R   P
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0301844)

HSP 1 Score: 519.62 bits (1337), Expect = 2.609e-166
Identity = 318/942 (33.76%), Postives = 516/942 (54.78%), Query Frame = 3
            K+  +D  S   +P +IL++LC   L+V  S +   M+ + +        +Y + L   +G+P ++W  +  G + +  ++ + L L P++ H + AM   L  Y W+   ++ S  A     +Q    R++    EM +   FK  I   I    +T+ +D                L ++VNS  R++L +  + +   +  AAE   LT   G +YVW++S S + + D                    S  P G+ G         L  +I   + I++  V        N D   +      +C        W  G++ +K ++  SI  ++N   I+F  +G L   + +I N +    +    W ++G W++++     ++ I  + WPG S+ PP G P K+ LK+  L E P++      P   K   +  + C+V     +A +I+            H N+S   + CC+G  +DLL++  ++L F  +L  V   +   G+ E+G WNGLI  LV+ K+DMV+TSL I   R  ++DFS PF ETGI I++  R G ISPTAFL+P+D+ASW ++ I ++ +    IF++EWLSP G D        N+ P  +RFSLFR+ WL+W++LF AAV+ D+PRG  SRF+ ++WALFA+VFLA YTANLAAFMI++E+F+   GLND RL  P++HKPSF+F TIP   T+  I   F  M  YM+ +NKTSV++ + A+    +D+F+YD  VLD+ VA D+DC+L  VG  YAMTGYG+   R SK ++  N  +L ++  G L+R +++WM+G C+   +   ++  L ++ F+SAF+LL+ G++L+ +LL+ EH +F+Y+R R+   D   CC L+SLSMG+ L+F  +V +  ++LK  +C +P+C++ + ++K  LD+S+ R++QLE
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0339592)

HSP 1 Score: 519.235 bits (1336), Expect = 3.809e-166
Identity = 316/942 (33.55%), Postives = 516/942 (54.78%), Query Frame = 3
            K+  +D  S   +P +IL++LC   L+V  S +   M+ + +        +Y + L   +G+P ++W  +  G + +  ++ + L L P++ H + AM   L  Y W+   ++ S  A     +Q    R++    EM +   FK  I   I    +T+ +D                L ++VNS  R++L +  + +   +  AAE   LT   G +YVW++S S + + D                    S  P G+ G         L  +I   + I++  V        N D   +      +C        W  G++ +K ++  SI  ++N   I+F  +G L   + +I N +    +    W ++G W++++     ++ I  + WPG S+ PP G P K+ LK+  L E P++      P   K   +  + C+V     +A +I+          V  ++ +   + CC+G  +DLL++  ++L F  +L  V   +   G+ E+G WNGLI  LV+ K+DMV+TSL I   R  ++DFS PF ETGI I++  R G ISPTAFL+P+D+ASW ++ I ++ +    IF++EWLSP G D        N+ P  +RFSLFR+ WL+W++LF AAV+ D+PRG  SRF+ ++WALFA+VFLA YTANLAAFMI++E+F+   GLND RL  P++HKPSF+F TIP   T+  I   F  M  YM+ +NKTSV++ + A+    +D+F+YD  VLD+ VA D+DC+L  VG  YAMTGYG+   R SK ++  N  +L ++  G L+R +++WM+G C+   +   ++  L ++ F+SAF+LL+ G++L+ +LL+ EH +F+Y+R R+   D   CC L+SLSMG+ L+F  +V +  ++LK  +C +P+C++ + ++K  LD+S+ R++QLE
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0070288)

HSP 1 Score: 519.235 bits (1336), Expect = 4.772e-166
Identity = 318/942 (33.76%), Postives = 516/942 (54.78%), Query Frame = 3
            K+  +D  S   +P +IL++LC   L+V  S +   M+ + +        +Y + L   +G+P ++W  +  G + +  ++ + L L P++ H + AM   L  Y W+   ++ S  A     +Q    R++    EM +   FK  I   I    +T+ +D                L ++VNS  R++L +  + +   +  AAE   LT   G +YVW++S S + + D                    S  P G+ G         L  +I   + I++  V        N D   +      +C        W  G++ +K ++  SI  ++N   I+F  +G L   + +I N +    +    W ++G W++++     ++ I  + WPG S+ PP G P K+ LK+  L E P++      P   K   +  + C+V     +A +I+            H N+S   + CC+G  +DLL++  ++L F  +L  V   +   G+ E+G WNGLI  LV+ K+DMV+TSL I   R  ++DFS PF ETGI I++  R G ISPTAFL+P+D+ASW ++ I ++ +    IF++EWLSP G D        N+ P  +RFSLFR+ WL+W++LF AAV+ D+PRG  SRF+ ++WALFA+VFLA YTANLAAFMI++E+F+   GLND RL  P++HKPSF+F TIP   T+  I   F  M  YM+ +NKTSV++ + A+    +D+F+YD  VLD+ VA D+DC+L  VG  YAMTGYG+   R SK ++  N  +L ++  G L+R +++WM+G C+   +   ++  L ++ F+SAF+LL+ G++L+ +LL+ EH +F+Y+R R+   D   CC L+SLSMG+ L+F  +V +  ++LK  +C +P+C++ + ++K  LD+S+ R++QLE
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0301843)

HSP 1 Score: 514.998 bits (1325), Expect = 5.224e-166
Identity = 314/926 (33.91%), Postives = 508/926 (54.86%), Query Frame = 3
            IL++LC   L+V  S +   M+ + +        +Y + L   +G+P ++W  +  G + +  ++ + L L P++ H + AM   L  Y W+   ++ S  A     +Q    R++    EM +   FK  I   I    +T+ +D                L ++VNS  R++L +  + +   +  AAE   LT   G +YVW++S S + + D                    S  P G+ G         L  +I   + I++  V        N D   +      +C        W  G++ +K ++  SI  ++N   I+F  +G L   + +I N +    +    W ++G W++++     ++ I  + WPG S+ PP G P K+ LK+  L E P++      P   K   +  + C+V     +A +I+            H N+S   + CC+G  +DLL++  ++L F  +L  V   +   G+ E+G WNGLI  LV+ K+DMV+TSL I   R  ++DFS PF ETGI I++  R G ISPTAFL+P+D+ASW ++ I ++ +    IF++EWLSP G D        N+ P  +RFSLFR+ WL+W++LF AAV+ D+PRG  SRF+ ++WALFA+VFLA YTANLAAFMI++E+F+   GLND RL  P++HKPSF+F TIP   T+  I   F  M  YM+ +NKTSV++ + A+    +D+F+YD  VLD+ VA D+DC+L  VG  YAMTGYG+   R SK ++  N  +L ++  G L+R +++WM+G C+   +   ++  L ++ F+SAF+LL+ G++L+ +LL+ EH +F+Y+R R+   D   CC L+SLSMG+ L+F  +V +  ++LK  +C +P+C++ + ++K  LD+S+ R++QLE
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0091453)

HSP 1 Score: 512.301 bits (1318), Expect = 1.441e-165
Identity = 306/892 (34.30%), Postives = 493/892 (55.27%), Query Frame = 3
            +Y + L   +G+P ++W  +  G + +  ++ + L L P++ H + AM   L  Y W+   ++ S  A     +Q    R++    EM +   FK  I   I    +T+ +D                L ++VNS  R++L +  + +   +  AAE   LT   G +YVW++S S + + D                    S  P G+ G         L  +I   + I++  V        N D   +      +C        W  G++ +K ++  SI  ++N   I+F  +G L   + +I N +    +    W ++G W++++     ++ I  + WPG S+ PP G P K+ LK+  L E P++      P   K   +  + C+V     +A +I+            H N+S   + CC+G  +DLL++  ++L F  +L  V   +   G+ E+G WNGLI  LV+ K+DMV+TSL I   R  ++DFS PF ETGI I++  R G ISPTAFL+P+D+ASW ++ I ++ +    IF++EWLSP G D        N+ P  +RFSLFR+ WL+W++LF AAV+ D+PRG  SRF+ ++WALFA+VFLA YTANLAAFMI++E+F+   GLND RL  P++HKPSF+F TIP   T+  I   F  M  YM+ +NKTSV++ + A+    +D+F+YD  VLD+ VA D+DC+L  VG  YAMTGYG+   R SK ++  N  +L ++  G L+R +++WM+G C+   +   ++  L ++ F+SAF+LL+ G++L+ +LL+ EH +F+Y+R R+   D   CC L+SLSMG+ L+F  +V +  ++LK  +C +P+C++ + ++K  LD+S+ R++QLE
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Zebrafish
Match: BX649405.2 (glutamate receptor, ionotropic, N-methyl D-aspartate 2A, b [Source:NCBI gene;Acc:570493])

HSP 1 Score: 330.872 bits (847), Expect = 1.005e-94
Identity = 229/790 (28.99%), Postives = 388/790 (49.11%), Query Frame = 3
            M   +  Y+W+    +++TK P + E    +R          D +  + D+  V+  DG+ +  D + ++           L++I      +IL +  K + +++   A    LT   GA +VWI+     P     N           +E I  +   G+   T   +   LE  +Q  + I +SA   +F +   + D T        +C   S         L    M     N+ G+   F+++G+    +  +     +  +    W K+G W N+ +       +    WP  ++   +     + L + TL E PFVI     DD      TC  N++PC+                   + + D++ + +    CC G  +D+LK++ +++KF  DL+ V+ +  H     + WNG++  +V  K+ M V SL I   R+E IDFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E++SP G +R       P    F++ +++WL+W ++F  +V   NPRG  S+F+ S+WA FA++FLASYTANLAAFMI +E    + GL+D +  SPY++ P FRF T+PNG+TE NI+ ++P M QYM  +++T V +A+ +LK  ++DAF+YDA VL++    D  CKL  +G   ++A TGYG+ + +GS   + ++  IL     G+++  +  W++G C  H E     + +L V N    F +L   M LS +  + EH F+     R+R C    C G
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Zebrafish
Match: grin2ab (glutamate receptor, ionotropic, N-methyl D-aspartate 2A, b [Source:ZFIN;Acc:ZDB-GENE-070424-223])

HSP 1 Score: 331.643 bits (849), Expect = 1.388e-94
Identity = 229/790 (28.99%), Postives = 388/790 (49.11%), Query Frame = 3
            M   +  Y+W+    +++TK P + E    +R          D +  + D+  V+  DG+ +  D + ++           L++I      +IL +  K + +++   A    LT   GA +VWI+     P     N           +E I  +   G+   T   +   LE  +Q  + I +SA   +F +   + D T        +C   S         L    M     N+ G+   F+++G+    +  +     +  +    W K+G W N+ +       +    WP  ++   +     + L + TL E PFVI     DD      TC  N++PC+                   + + D++ + +    CC G  +D+LK++ +++KF  DL+ V+ +  H     + WNG++  +V  K+ M V SL I   R+E IDFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E++SP G +R       P    F++ +++WL+W ++F  +V   NPRG  S+F+ S+WA FA++FLASYTANLAAFMI +E    + GL+D +  SPY++ P FRF T+PNG+TE NI+ ++P M QYM  +++T V +A+ +LK  ++DAF+YDA VL++    D  CKL  +G   ++A TGYG+ + +GS   + ++  IL     G+++  +  W++G C  H E     + +L V N    F +L   M LS +  + EH F+     R+R C    C G
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Zebrafish
Match: grin2ab (glutamate receptor, ionotropic, N-methyl D-aspartate 2A, b [Source:ZFIN;Acc:ZDB-GENE-070424-223])

HSP 1 Score: 331.643 bits (849), Expect = 1.388e-94
Identity = 229/790 (28.99%), Postives = 388/790 (49.11%), Query Frame = 3
            M   +  Y+W+    +++TK P + E    +R          D +  + D+  V+  DG+ +  D + ++           L++I      +IL +  K + +++   A    LT   GA +VWI+     P     N           +E I  +   G+   T   +   LE  +Q  + I +SA   +F +   + D T        +C   S         L    M     N+ G+   F+++G+    +  +     +  +    W K+G W N+ +       +    WP  ++   +     + L + TL E PFVI     DD      TC  N++PC+                   + + D++ + +    CC G  +D+LK++ +++KF  DL+ V+ +  H     + WNG++  +V  K+ M V SL I   R+E IDFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E++SP G +R       P    F++ +++WL+W ++F  +V   NPRG  S+F+ S+WA FA++FLASYTANLAAFMI +E    + GL+D +  SPY++ P FRF T+PNG+TE NI+ ++P M QYM  +++T V +A+ +LK  ++DAF+YDA VL++    D  CKL  +G   ++A TGYG+ + +GS   + ++  IL     G+++  +  W++G C  H E     + +L V N    F +L   M LS +  + EH F+     R+R C    C G
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Zebrafish
Match: GRIN2B (glutamate receptor ionotropic, NMDA 2B-like [Source:NCBI gene;Acc:110438919])

HSP 1 Score: 325.865 bits (834), Expect = 1.182e-92
Identity = 236/796 (29.65%), Postives = 389/796 (48.87%), Query Frame = 3
            ++  M     P++   A  M + +  Y+W     +++T  P Y +   +IR           EN F   ++ +V+  D      D +KI+N+         L+K+ +    +IL +  K + +I++  A    LT   G  Y WI+        D+           +  EF       G+   +   +   LE  ++ G+ + A+A + +   R          L K  C    + +S   G   ++L   M        GR + F E+G+    +  I     +  D    W +VG W N  +S    +      WP       P  R   + L + TL E PFVI         TC  N +PC+ +L    A N      +Y +              CC G  +D+LK++ K++KF  DL+ V+  N   G   +G WNG++  +V   + M V SL I   R+E+IDFSVPF ETGI +++    G +SP+AFL+P+ +  W ++F+  +     A+FI+E+ SP G +R     RE     F++ +++WL+W ++F  +V   NPRG  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +  +P +  P FRF T+PNG+TE NI+ ++ +M  YM  F++ +V EA+++LK  ++DAF+YDA VL++    D+ CKL  +  G+++A TGYG+ + + S   + ++  IL     G+++  +  W++G C  H +    + +L V N    F +L   M LS +  I+EH F+ +MR
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Zebrafish
Match: grin2aa (glutamate receptor, ionotropic, N-methyl D-aspartate 2A, a [Source:ZFIN;Acc:ZDB-GENE-070424-129])

HSP 1 Score: 325.094 bits (832), Expect = 2.042e-92
Identity = 203/626 (32.43%), Postives = 333/626 (53.19%), Query Frame = 3
            LE  ++ GL I  +A   +  +  ++              K S     +  KL   A+ K + N+  +G+ + F E+G+    +  +     + KD    W K+G W N  ++      +    WP   N           L + TL E PFVI    +    TC  N++PC+      I  N  +    Y +              CC G  +D+LK++ +++KF  DL+ V+ +  H     + WNG++  +V+ K+ M V SL I   R+E+IDFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E++SP G +R       P    F++ +++WL+W ++F  +V   NP+G  S+F+ S+WA FA++FLASYTANLAAFMI +E    + GL+D +  SPY++ P FRF T+PNG+TE NI+ ++P+M QYM  +++T V++A+ +LK  ++DAF+YDA VL++    D+ CKL  +G   ++A TGYG+ L +GS   + ++  IL+    G+++  +  W++G C  H E     + +L V N    F +L   M LS +  + EH F+     R+R C    C G    L S+S G
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Xenopus
Match: GRIN2B (glutamate receptor, ionotropic, N-methyl D-aspartate 2B [Source:NCBI gene;Acc:100490580])

HSP 1 Score: 328.946 bits (842), Expect = 1.402e-93
Identity = 246/862 (28.54%), Postives = 413/862 (47.91%), Query Frame = 3
            S P SI+  +C+ +  +K  V  V+         I  I   I +     +  +    + I   K EE  M     P++   A  M + +  Y+W     +++T  P Y + + ++R           EN F   ++ +VI+ D     ND SKI+N          L+K+ +    +IL +  K + + ++  A    LT   G  Y WI+       TD            +  EF       GL   +   +   L   ++ G+ I  +A + + ++  ++  +      K +C  +  +        +Y+A  +K+ + N+   GR + F E+G+    +  I      +K     W +VG +++  +       +    WP     P         L + TL E PFVI         TC  N +PC              + +I +E   +     N    CC G  +D+LK++ K +KF  DL+ V+  N   G   +G WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ +  W ++F+  +     A+F++E+ SP G +R     RE     F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P +  P+FRF T+PNG+TE NI+ ++ EM  YM  FN+ SV +A+ +LK  ++DAF+YDA VL++    D+ CKL  +  G+++A TGYG+ + + S   + ++  IL     G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH FF  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Xenopus
Match: GRIN2B (glutamate receptor, ionotropic, N-methyl D-aspartate 2B [Source:NCBI gene;Acc:100490580])

HSP 1 Score: 328.561 bits (841), Expect = 1.879e-93
Identity = 246/862 (28.54%), Postives = 413/862 (47.91%), Query Frame = 3
            S P SI+  +C+ +  +K  V  V+         I  I   I +     +  +    + I   K EE  M     P++   A  M + +  Y+W     +++T  P Y + + ++R           EN F   ++ +VI+ D     ND SKI+N          L+K+ +    +IL +  K + + ++  A    LT   G  Y WI+       TD            +  EF       GL   +   +   L   ++ G+ I  +A + + ++  ++  +      K +C  +  +        +Y+A  +K+ + N+   GR + F E+G+    +  I      +K     W +VG +++  +       +    WP     P         L + TL E PFVI         TC  N +PC              + +I +E   +     N    CC G  +D+LK++ K +KF  DL+ V+  N   G   +G WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ +  W ++F+  +     A+F++E+ SP G +R     RE     F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P +  P+FRF T+PNG+TE NI+ ++ EM  YM  FN+ SV +A+ +LK  ++DAF+YDA VL++    D+ CKL  +  G+++A TGYG+ + + S   + ++  IL     G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH FF  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Xenopus
Match: sdr42e1 (short chain dehydrogenase/reductase family 42E, member 1 [Source:Xenbase;Acc:XB-GENE-985965])

HSP 1 Score: 319.701 bits (818), Expect = 2.005e-93
Identity = 236/842 (28.03%), Postives = 410/842 (48.69%), Query Frame = 3
            L L  +     + +F+ L  Y+W  +  +++T  P Y +  + I  ++++   +  EN   L +        +T     SK+K         + L +I     ++ L +  + +   ++ AA    LT   G  Y+W +  + +  TDY     M + L +           GLF   +  +   L   +Q G+ I A     L+         +   +P+FN  CR  + T        + + + +   NI+  G+   F E+G+L      +     +  +    W  VG W +  +          + +P  S      +P      L VATL E PFVI  G      TC  +++PC+        + +N  D   ++ ++           CC G  +D+LK L K + F  DL+ V+ +  H    +  WNG+I  +   ++DM + SL I   R+E+IDFSVPF ETGI +++    G +SP+AFL+PY  A W ++F+  +      +FI+E+ SP G +R       P   +F++ +S+WL+W+++F  +V  +NP+G  S+ +  IWA FA++FLASYTANLAAFMI +E    + GL+D +   P+   P  +F T+PNG+TE+NI+ ++P+M  YM  +N+  V +A++ LK  ++DAF+YDA VL++    D+ CKL  +  G+++A TGYG+ L +GSK  + I+  +L +    +++  ++ W+SG C  + ++   + KL + N    F +LL  M LS ++   EH  +  +R  +R   K          +  LL+F +  ++ Q V  LK+ +     C+ ++
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Xenopus
Match: GRIN2B (glutamate receptor, ionotropic, N-methyl D-aspartate 2B [Source:NCBI gene;Acc:100490580])

HSP 1 Score: 326.25 bits (835), Expect = 2.845e-93
Identity = 243/860 (28.26%), Postives = 407/860 (47.33%), Query Frame = 3
            S P SI+  +C+ +  +K  V  V+         I  I   I +     +  +    + I   K EE  M     P++   A  M + +  Y+W     +++T  P Y + + ++R           EN F   ++ +VI+ D     ND SKI+N          L+K+ +    +IL +  K + + ++  A    LT   G  Y WI+       TD            +  EF       GL   +   +   L   ++ G+ I  +A + + ++  ++  +      K +C  +  +  ++   L     K+ + N+   GR + F E+G+    +  I      +K     W +VG +++  +       +    WP     P         L + TL E PFVI         TC  N +PC+   +                         N    CC G  +D+LK++ K +KF  DL+ V+  N   G   +G WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ +  W ++F+  +     A+F++E+ SP G +R     RE     F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P +  P+FRF T+PNG+TE NI+ ++ EM  YM  FN+ SV +A+ +LK  ++DAF+YDA VL++    D+ CKL  +  G+++A TGYG+ + + S   + ++  IL     G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH FF  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Xenopus
Match: GRIN2B (glutamate receptor, ionotropic, N-methyl D-aspartate 2B [Source:NCBI gene;Acc:100490580])

HSP 1 Score: 325.094 bits (832), Expect = 2.719e-92
Identity = 243/860 (28.26%), Postives = 407/860 (47.33%), Query Frame = 3
            S P SI+  +C+ +  +K  V  V+         I  I   I +     +  +    + I   K EE  M     P++   A  M + +  Y+W     +++T  P Y + + ++R           EN F   ++ +VI+ D     ND SKI+N          L+K+ +    +IL +  K + + ++  A    LT   G  Y WI+       TD            +  EF       GL   +   +   L   ++ G+ I  +A + + ++  ++  +      K +C  +  +  ++   L     K+ + N+   GR + F E+G+    +  I      +K     W +VG +++  +       +    WP     P         L + TL E PFVI         TC  N +PC+   +                         N    CC G  +D+LK++ K +KF  DL+ V+  N   G   +G WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ +  W ++F+  +     A+F++E+ SP G +R     RE     F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P +  P+FRF T+PNG+TE NI+ ++ EM  YM  FN+ SV +A+ +LK  ++DAF+YDA VL++    D+ CKL  +  G+++A TGYG+ + + S   + ++  IL     G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH FF  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Mouse
Match: Grin2a (glutamate receptor, ionotropic, NMDA2A (epsilon 1) [Source:MGI Symbol;Acc:MGI:95820])

HSP 1 Score: 329.331 bits (843), Expect = 1.039e-93
Identity = 231/784 (29.46%), Postives = 382/784 (48.72%), Query Frame = 3
            ++   A  M   ++ Y+W+    L++T  P Y +    I+   +N       +    D+  VI  D  T   D             +  L+KI +S   +IL +  K +  ++   A    LT   G D+ WI+     P     N   + KE              GL   +   +   LE  ++ GL I  +A + +  K           +P+        TE     +     + + + N+  +G+ + F E G+    +  +     + KD    W KVG W N  +S  + +      WP   +      P    L + TL E PFVI        +TC  N +PC+  VK+++   + +N K                    CC G  +D+LK+L + +KF  DL+ V+ +  H     + WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E+ SP G +R       P    F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P+++ P FRF T+PNG+TE NI+ ++P M QYM  FN+  V +A+ +LK  ++DAF+YDA VL++K   D+ CKL  +G   ++A TGYG+ L +GS   + I+  +L +   G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH F+  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Mouse
Match: Grin2a (glutamate receptor, ionotropic, NMDA2A (epsilon 1) [Source:MGI Symbol;Acc:MGI:95820])

HSP 1 Score: 329.331 bits (843), Expect = 1.039e-93
Identity = 231/784 (29.46%), Postives = 382/784 (48.72%), Query Frame = 3
            ++   A  M   ++ Y+W+    L++T  P Y +    I+   +N       +    D+  VI  D  T   D             +  L+KI +S   +IL +  K +  ++   A    LT   G D+ WI+     P     N   + KE              GL   +   +   LE  ++ GL I  +A + +  K           +P+        TE     +     + + + N+  +G+ + F E G+    +  +     + KD    W KVG W N  +S  + +      WP   +      P    L + TL E PFVI        +TC  N +PC+  VK+++   + +N K                    CC G  +D+LK+L + +KF  DL+ V+ +  H     + WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E+ SP G +R       P    F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P+++ P FRF T+PNG+TE NI+ ++P M QYM  FN+  V +A+ +LK  ++DAF+YDA VL++K   D+ CKL  +G   ++A TGYG+ L +GS   + I+  +L +   G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH F+  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Mouse
Match: Grin2a (glutamate receptor, ionotropic, NMDA2A (epsilon 1) [Source:MGI Symbol;Acc:MGI:95820])

HSP 1 Score: 329.331 bits (843), Expect = 1.039e-93
Identity = 231/784 (29.46%), Postives = 382/784 (48.72%), Query Frame = 3
            ++   A  M   ++ Y+W+    L++T  P Y +    I+   +N       +    D+  VI  D  T   D             +  L+KI +S   +IL +  K +  ++   A    LT   G D+ WI+     P     N   + KE              GL   +   +   LE  ++ GL I  +A + +  K           +P+        TE     +     + + + N+  +G+ + F E G+    +  +     + KD    W KVG W N  +S  + +      WP   +      P    L + TL E PFVI        +TC  N +PC+  VK+++   + +N K                    CC G  +D+LK+L + +KF  DL+ V+ +  H     + WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E+ SP G +R       P    F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P+++ P FRF T+PNG+TE NI+ ++P M QYM  FN+  V +A+ +LK  ++DAF+YDA VL++K   D+ CKL  +G   ++A TGYG+ L +GS   + I+  +L +   G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH F+  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Mouse
Match: Grin2b (glutamate receptor, ionotropic, NMDA2B (epsilon 2) [Source:MGI Symbol;Acc:MGI:95821])

HSP 1 Score: 325.865 bits (834), Expect = 1.632e-92
Identity = 248/862 (28.77%), Postives = 414/862 (48.03%), Query Frame = 3
            + P SI+  +C+ +  RK  +  V+         I  I   I       +  +    + I   K E +M      P++   A  M + +  Y+W     +++T  P Y +   +IR           EN F   ++ +V+  D      D SKI+N          L+K+ +    IIL +  K + + ++   EV N   + G  Y WI+       TD            +  EF       GL   +   +   L   ++ G+ I  +A + + ++   +        PK +C    NT    + K +Y++  + + + N+   GR + F E+G+    +  I     + K+    W +VG W++  +       +    WP M   P         L + TL E PFVI         TC  N +PCQ ++   I++N  D++  Y +              CC G  +D+LK++ K +KF  DL+ V+  N   G   +G WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ +  W ++F+  +     A+F++E+ SP G +R     RE     F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P +  P FRF T+PNG+TE NI+ ++ EM  YM  FN+  V +A+ +LK  ++DAF+YDA VL++    D+ CKL  +  G+++A TGYG+ + + S   + ++  IL     G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH F+   R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Mouse
Match: Grin2b (glutamate receptor, ionotropic, NMDA2B (epsilon 2) [Source:MGI Symbol;Acc:MGI:95821])

HSP 1 Score: 325.865 bits (834), Expect = 1.632e-92
Identity = 248/862 (28.77%), Postives = 414/862 (48.03%), Query Frame = 3
            + P SI+  +C+ +  RK  +  V+         I  I   I       +  +    + I   K E +M      P++   A  M + +  Y+W     +++T  P Y +   +IR           EN F   ++ +V+  D      D SKI+N          L+K+ +    IIL +  K + + ++   EV N   + G  Y WI+       TD            +  EF       GL   +   +   L   ++ G+ I  +A + + ++   +        PK +C    NT    + K +Y++  + + + N+   GR + F E+G+    +  I     + K+    W +VG W++  +       +    WP M   P         L + TL E PFVI         TC  N +PCQ ++   I++N  D++  Y +              CC G  +D+LK++ K +KF  DL+ V+  N   G   +G WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ +  W ++F+  +     A+F++E+ SP G +R     RE     F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P +  P FRF T+PNG+TE NI+ ++ EM  YM  FN+  V +A+ +LK  ++DAF+YDA VL++    D+ CKL  +  G+++A TGYG+ + + S   + ++  IL     G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH F+   R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. UniProt/SwissProt
Match: sp|Q5IS45|NMDE1_PANTR (Glutamate receptor ionotropic, NMDA 2A OS=Pan troglodytes OX=9598 GN=GRIN2A PE=2 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 7.269e-93
Identity = 229/784 (29.21%), Postives = 381/784 (48.60%), Query Frame = 3
            ++   A  M   ++ Y+W+    L++T  P Y E    ++   +N       +    D+  VI  D  T   D             +  L+KI +S   +IL +  K +  ++   A    LT   G D+ WI+     P     N   + KE              GL   +   +   LE  ++ G+ I  +A + +  K   +              K S     +  ++    +   + N+  +G+ + F E G+    +  +     + KD    W KVG W N+ +S      +    WP   +      P    L + TL E PFVI        +TC  N +PC+  VK+++   + +N K                    CC G  +D+LK+L + +KF  DL+ V+ +  H     + WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E+ SP G +R       P    F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P+++ P FRF T+PNG+TE NI+ ++P M QYM  FN+  V +A+ +LK  ++DAF+YDA VL++K   D+ CKL  +G   ++A TGYG+ L +GS   + I+  +L +   G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH F+  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. UniProt/SwissProt
Match: sp|P35436|NMDE1_MOUSE (Glutamate receptor ionotropic, NMDA 2A OS=Mus musculus OX=10090 GN=Grin2a PE=1 SV=2)

HSP 1 Score: 329.331 bits (843), Expect = 7.269e-93
Identity = 231/784 (29.46%), Postives = 382/784 (48.72%), Query Frame = 3
            ++   A  M   ++ Y+W+    L++T  P Y +    I+   +N       +    D+  VI  D  T   D             +  L+KI +S   +IL +  K +  ++   A    LT   G D+ WI+     P     N   + KE              GL   +   +   LE  ++ GL I  +A + +  K           +P+        TE     +     + + + N+  +G+ + F E G+    +  +     + KD    W KVG W N  +S  + +      WP   +      P    L + TL E PFVI        +TC  N +PC+  VK+++   + +N K                    CC G  +D+LK+L + +KF  DL+ V+ +  H     + WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E+ SP G +R       P    F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P+++ P FRF T+PNG+TE NI+ ++P M QYM  FN+  V +A+ +LK  ++DAF+YDA VL++K   D+ CKL  +G   ++A TGYG+ L +GS   + I+  +L +   G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH F+  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. UniProt/SwissProt
Match: sp|Q12879|NMDE1_HUMAN (Glutamate receptor ionotropic, NMDA 2A OS=Homo sapiens OX=9606 GN=GRIN2A PE=1 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 8.955e-93
Identity = 229/784 (29.21%), Postives = 381/784 (48.60%), Query Frame = 3
            ++   A  M   ++ Y+W+    L++T  P Y E    ++   +N       +    D+  VI  D  T   D             +  L+KI +S   +IL +  K +  ++   A    LT   G D+ WI+     P     N   + KE              GL   +   +   LE  ++ G+ I  +A + +  K   +              K S     +  ++    +   + N+  +G+ + F E G+    +  +     + KD    W KVG W N+ +S      +    WP   +      P    L + TL E PFVI        +TC  N +PC+  VK+++   + +N K                    CC G  +D+LK+L + +KF  DL+ V+ +  H     + WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E+ SP G +R       P    F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P+++ P FRF T+PNG+TE NI+ ++P M QYM  FN+  V +A+ +LK  ++DAF+YDA VL++K   D+ CKL  +G   ++A TGYG+ L +GS   + I+  +L +   G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH F+  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. UniProt/SwissProt
Match: sp|Q01097|NMDE2_MOUSE (Glutamate receptor ionotropic, NMDA 2B OS=Mus musculus OX=10090 GN=Grin2b PE=1 SV=3)

HSP 1 Score: 327.405 bits (838), Expect = 3.640e-92
Identity = 249/862 (28.89%), Postives = 415/862 (48.14%), Query Frame = 3
            + P SI+  +C+ +  RK  +  V+L        I  I   I       +  +    + I   K E +M      P++   A  M + +  Y+W     +++T  P Y +   +IR           EN F   ++ +V+  D      D SKI+N          L+K+ +    IIL +  K + + ++   EV N   + G  Y WI+       TD            +  EF       GL   +   +   L   ++ G+ I  +A + + ++   +        PK +C    NT    + K +Y++  + + + N+   GR + F E+G+    +  I     + K+    W +VG W++  +       +    WP M   P         L + TL E PFVI         TC  N +PCQ ++   I++N  D++  Y +              CC G  +D+LK++ K +KF  DL+ V+  N   G   +G WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ +  W ++F+  +     A+F++E+ SP G +R     RE     F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P +  P FRF T+PNG+TE NI+ ++ EM  YM  FN+  V +A+ +LK  ++DAF+YDA VL++    D+ CKL  +  G+++A TGYG+ + + S   + ++  IL     G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH F+   R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. UniProt/SwissProt
Match: sp|A7XY94|NMDE2_XENLA (Glutamate receptor ionotropic, NMDA 2B OS=Xenopus laevis OX=8355 GN=grin2b PE=1 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 5.615e-92
Identity = 255/937 (27.21%), Postives = 439/937 (46.85%), Query Frame = 3
            S P SI+  +C+ +  +K  V  V+         I  I   I +     +  +    + I   K EE  M     P++   A  M + +  Y+W     +++T  P Y + + ++R           EN F   ++ +VI+ D    L+D+ SKI+N          L+K+ +    +IL +  K + + ++  A    LT   G  + WI+       TD            +  EF       GL   +   +   L   ++ G+ I  +A + + ++  ++  +      K +C  +  +  ++   L     K+ + N+   GR + F E+G+    +  I      +K     W +VG +++  +       +    WP     P         L + TL E PFVI         TC  N +PC              + +I  E   +     N    CC G  +D+LK++ K +KF  DL+ V+  N   G   +G WNG+I  +V  ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ +  W ++F+  +     A+F++E+ SP G +R     RE     F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P +  P+FRF T+PNG+TE NI+ ++ EM  YM  FN+ SV +A+ +LK+ ++DAF+YDA VL++    D+ CKL  +  G+++A TGYG+ + + S   + ++  IL     G+++  +  W++G C  H E     + +L + N    F +L   M LS +  I EH FF  +R        +   G+ S   G + S  + +         + C + +    +E  + ALD     +    + +++L R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. TrEMBL
Match: A0A267FAS3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031588g1 PE=3 SV=1)

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 446/906 (49.23%), Postives = 611/906 (67.44%), Query Frame = 3
            + Y +    S+G+P  T+L N +G+L+ E+  + L LEP+  HVA+A  DFL+ +NW  A L++S   P +AE+ + ++  + + + + D + FK +IT+V+ + GI KL++V    ++   +  Y+  L ++ N+ +RI + +G   D  +LY AA+   L  +FG +YVW++SP  +  P  + K+     +EKE            +PGLFGF   P    + +  +    +W  A+ K    L N  R  ++T    L P F  +      + W+YGK + K  K +     G C           I F  NG +N TQF + NS+   K N + WF VGSW     ++        ID V WPG S  PP+GRP KY ++VATL E PF+ Y   + D  C E ++ C+V +S+    + ++ D I   T +D S      F CC+GL++DLL+ELMKDL FDVDLFEV       G    GWNGL++ L++ K+DMV+T+LKITPNR+E I+FSVP+Q TGI IL+ LREGAIS  AFLKPYD  SWC+I +FSVH+CG A+F++EWLSP GLDRGN+PPREH+FSLFRSLWLIWSMLFGAAVNADNPRGVASRFL +IWALFALVFLASYTANLAAFMI++E +Y+L G+NDWRL  P  H+P FRF T+P+GATEEN+KM+FP+MA+YM+N++K+++ E IKALK  EIDAF+YDA VL ++V  DKDCKL+ VG  Y+MTGYGVG P+GS+   +I+S IL Y+K G L+RW K+W +GAC++ G L N+N+ LGVKNFISAFILL+GGM+L  +LL+ EH F+RYMRPR++  DKYGCCGLVS+SMGQLLSFEQSVNQTVD++K+ KC+NP+CE+Q  +L+  L+ S+ R+++LE 
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. TrEMBL
Match: A0A267EW57 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014971g1 PE=3 SV=1)

HSP 1 Score: 839.721 bits (2168), Expect = 0.000e+0
Identity = 446/914 (48.80%), Postives = 611/914 (66.85%), Query Frame = 3
            + Y +    S+G+P  T+L N +G+L+         E+  + L LEP+  HVA+A  DFL+ +NW  A L++S   P +AE+ + ++  + + + + D + FK +IT+V+ + GI KL++V    ++   +  Y+  L ++ N+ +RI + +G   D  +LY AA+   L  +FG +YVW++SP  +  P  + K+     +EKE            +PGLFGF   P    + +  +    +W  A+ K    L N  R  ++T    L P F  +      + W+YGK + K  K +     G C           I F  NG +N TQF + NS+   K N + WF VGSW     ++        ID V WPG S  PP+GRP KY ++VATL E PF+ Y   + D  C E ++ C+V +S+    + ++ D I   T +D S      F CC+GL++DLL+ELMKDL FDVDLFEV       G    GWNGL++ L++ K+DMV+T+LKITPNR+E I+FSVP+Q TGI IL+ LREGAIS  AFLKPYD  SWC+I +FSVH+CG A+F++EWLSP GLDRGN+PPREH+FSLFRSLWLIWSMLFGAAVNADNPRGVASRFL +IWALFALVFLASYTANLAAFMI++E +Y+L G+NDWRL  P  H+P FRF T+P+GATEEN+KM+FP+MA+YM+N++K+++ E IKALK  EIDAF+YDA VL ++V  DKDCKL+ VG  Y+MTGYGVG P+GS+   +I+S IL Y+K G L+RW K+W +GAC++ G L N+N+ LGVKNFISAFILL+GGM+L  +LL+ EH F+RYMRPR++  DKYGCCGLVS+SMGQLLSFEQSVNQTVD++K+ KC+NP+CE+Q  +L+  L+ S+ R+++LE 
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. TrEMBL
Match: A0A267F5H5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034011g1 PE=3 SV=1)

HSP 1 Score: 828.935 bits (2140), Expect = 0.000e+0
Identity = 435/976 (44.57%), Postives = 639/976 (65.47%), Query Frame = 3
            +T+F+   +D       A TP  ++ ++C  L++ +      +L++      +H         Y++HL  S+G+P  T+L N + +L       + E+  M + LEP   HVA A+ DFL  Y W    ++ S + P +  + E ++ ++++  EMND N F+ ++TQV+ +DG+ +++D+ +      +  Y   L ++V+ +DRI   HG   D  +L +   + N     +F  DY+WI+SPS +  P +D K+  +        +  I+I+G+  L+      +   L + +     +W  A+ +   +  +++V A    TN  +L    P F C   SNT    W  GK +++ A+  S     G       I F   G LN T+F + NS+     + ++W  VG W     ++        + GVTWPG++++ PLGRP K++L+ ATL E PFV Y  P+    + CD  ++PC+V     +A+N +  D+ Y+ +  + S     T +CC+GLA+DLL+ELMKDL F+VDLFEV       G   + WNGL++ L++ ++DMVVTSLKITPNR+E I+FSVPF  TGI IL+ LREGAIS  AFLKPYD  SWC+I +FSVH+CG A+F++EWLSP GLD+GN+PPREH+FSLFRSLWLIWSMLFGAAVNADNPRGVASRFL +IWALFALVFLASYTANLAAFMI++E +Y+L G+NDWRL  P +H+P FRF T+P+GATEEN++M++P++A++M+N++K+++ E I+ LK  EIDAF+YDA VL ++V  D+DCKL+ VG  Y+MTGYG+GLP+GSK    IN  ILSY+ +G L+RW K+W++GAC++ G+L NTN+ LGVKNFISAFILL+GGM+   +LL+ EHCF+R +RP+++  D+YGCCGLVS+SMGQLLSFEQSVNQTVD++K+ KC+NP+CE+Q+ +L+  LD ++ ++++LE 
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. TrEMBL
Match: A0A267G7X7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034011g2 PE=3 SV=1)

HSP 1 Score: 827.395 bits (2136), Expect = 0.000e+0
Identity = 434/978 (44.38%), Postives = 636/978 (65.03%), Query Frame = 3
            +T+F+   +D       A TP  ++ ++C  L++ +      +L++      +H         Y++HL  S+G+P  T+L N + +L       + E+  M + LEP   HVA A+ DFL  Y W    ++ S + P +  + E ++ ++++  EMND N F+ ++TQV+ +DG+ +++D+ +      +  Y   L ++V+ +DRI   HG   D  +L +   + N     +F  DY+WI+SPS +  P +D K+  +        +  I+I+G+  L+      +   L + +     +W  A+ + F +R             N+D   + + P F C   SNT    W  GK +++ A+  S     G       I F   G LN T+F + NS+     + ++W  VG W     ++        + GVTWPG++++ PLGRP K++L+ ATL E PFV Y  P+    + CD  ++PC+V     +A+N +  D+ Y+ +  + S     T +CC+GLA+DLL+ELMKDL F+VDLFEV       G   + WNGL++ L++ ++DMVVTSLKITPNR+E I+FSVPF  TGI IL+ LREGAIS  AFLKPYD  SWC+I +FSVH+CG A+F++EWLSP GLD+GN+PPREH+FSLFRSLWLIWSMLFGAAVNADNPRGVASRFL +IWALFALVFLASYTANLAAFMI++E +Y+L G+NDWRL  P +H+P FRF T+P+GATEEN++M++P++A +M+N++K+++ E I+ LK  EIDAF+YDA VL ++V  D+DCKL+ VG  Y+MTGYG+GLP+GSK    IN  ILSY+ +G L+RW K+W++GAC++ G+L NTN+ LGVKNFISAFILL+GGM+   +LL+ EHCF+R +RP+++  D+YGCCGLVS+SMGQLLSFEQSVNQTVD++K+ KC+NP+CE+Q+ +L+  LD ++ ++++LE 
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. TrEMBL
Match: A0A3Q0KPC6 (Putative glutamate receptor, NMDA OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 434/1048 (41.41%), Postives = 634/1048 (60.50%), Query Frame = 3
            A  PL + N +C   +  +S     N+  +   +   ++ P+H  + R    +T+++G+P++TWLPN++G+ + +++ + + LEP   HVA A+ DF+  Y WN  +++ +T  P    L EE R++   R   +  N F+ +I     ++G+T L     I  M           +NI    LE I  ++ R+I+F+G   D + L Y A+  N TK      +FG DYVWI +PS M   T   N  ++  +  +  E      +PG+FG   +          +    +W  ++ +L          +K   +D  N       K +L K    KL   S+  SW++G+ +Y  M   + N++   I FL NG LN ++  I+NS+ +  D    W+KVG+W   +      +R+ IDGVTWPG SN PP GRP+K+KL+V T+ E+PFVIY K Q+  TCD N+IPC+++  S   ++I+ K+ I  +TL                                 V+ ++  +    CC+GL MDLL ELMKDL FDV+++EV        +P+ GWNG+I+ L+D+++DM VTSLKITPNR++ I+FSVPF ETGI + + LREGAI+PTAFLKPYD   WCVI +FSVH+ G A++IYEW SP+G++RG+   + HRFS FRSLWLIWSMLFGAAVNADNPRG+ASRF+A+IWALFALVFLASYTANLAAFMI+KED+++L G+NDWRL  P+N KP FRF TIP+GATEENIK++FPEM +YM+ +NK+ V + +KA+K+ ++DAF+YDANVLD+    D+ CKLR VG LYAMTGYG+G  + S+ L  +NS IL YQK GKLQRWKKFW +G+CKK   + NTNK LGVKNFISAFILL+ GM++  V L+ E+ F+ Y +P+++  ++    G +SL+        +   QT++M L  +KC NP+C+ + +   K ++L Q ++ +L+  + K     ++ NN   N FQN       ++ P    + V ++D +S S+
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Cavefish
Match: grin2ab (glutamate receptor, ionotropic, N-methyl D-aspartate 2A, b [Source:ZFIN;Acc:ZDB-GENE-070424-223])

HSP 1 Score: 325.479 bits (833), Expect = 9.698e-93
Identity = 226/733 (30.83%), Postives = 369/733 (50.34%), Query Frame = 3
            +S I+     +  R  L+ +V    RI    IL +  K +  ++   A+   LT   GA YVW++     P     N  E   E +        SGM  +  +    +P  LE  ++  + I++SA   +F ++  + D T        +C   S         L    M     N+ GR + F+++G+    +  +     +  D    W K+G W N+       +I+    WP  ++         + L + TL E PFVI     DD      TC  N++PC+                   + + D++   +    CC G  +D+LK++ +++KF  DL+ V+ +  H     + WNG++  +V  K+ M V SL I   R+E+IDFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E++SP G +R       P    F++ +++WL+W ++F  +V   NPRG  S+F+ S+WA FA++FLASYTANLAAFMI +E    + GL+D +  SPY+  P FRF T+PNG+TE NI+ ++P+M QYM  +++T V +A+ +LK  ++DAF+YDA VL++    D  CKL  +G   ++A TGYG+ L +GS   + ++  IL     G+++  +  W++G C  H E     + +L V N    F +L   M LS +    EH F+     R+R C    C G   L
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Cavefish
Match: ENSAMXT00000048483.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002300.1:137607:211127:1 gene:ENSAMXG00000040741.1 transcript:ENSAMXT00000048483.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 320.472 bits (820), Expect = 1.228e-90
Identity = 234/796 (29.40%), Postives = 385/796 (48.37%), Query Frame = 3
            ++  M     P++   A  M + +  Y+W     +++T  P Y +   +IR           EN F   ++ +V+  D      D +KI+N          L+K+ +    +IL +  K + +I++  A    LT   G  + WI+        D+           +  EF       G+   +   +   LE  ++ G+ + A A + +   R          L K  C      ++   G   ++L   M        GR + F E+G+    +  I     +  D    W +VG W N  +S    +      WP               L + TL E PFVI         TC  N +PC+ +L            KI ++T      DS +    CC G  +D+LK++ K +KF  DL+ V+  N   G   +G WNG++  +V   + M V SL I   R+E+IDFSVPF ETGI +++    G +SP+AFL+P+ +  W ++F+  +     A+F++E+ SP G +R     RE     F++ +++WL+W ++F  +V   NPRG  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P +  P FRF T+PNG+TE NI+ ++ EM  YM  F++ +V EA+++LKA ++DAF+YDA VL++    D+ CKL  +  G+++A TGYG+ + + S   ++++  IL     G+++  +  W++G C  H +    + +L V N    F +L   M LS +  I+EH F+  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Cavefish
Match: grin2aa (glutamate receptor, ionotropic, N-methyl D-aspartate 2A, a [Source:ZFIN;Acc:ZDB-GENE-070424-129])

HSP 1 Score: 309.686 bits (792), Expect = 1.345e-87
Identity = 198/624 (31.73%), Postives = 327/624 (52.40%), Query Frame = 3
            LE  ++ GL I  +A + +  +  ++              K S     +  KL   A+ K + N+  +GR + F E+G+    +  +     + KD    W K+G W N  ++      +    WP   N           L + TL E PFVI    +    TC  N++PC+      I  N  +    Y +              CC G  +D+LK++ +++KF  DL+ V+ +  H     + WNG++  +V  K+ M V SL I   R+E+IDFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E++SP G +R       P    F++ +++WL+W ++F  +V   NP+G  S+F+ S+WA FA++FLASYTANLAAFMI +E    + GL+D +  SPY++ P FRF T+PNG+TE NI+ ++P+M QYM  +++T V++A+ +LK  ++DAF+YDA ++   + +         G ++A TGYG+ L +GS   + ++  IL+    G+++  +  W++G C  H E     + +L V N    F +L   M LS +  + EH F+     R+R C    C G    L S+S G
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Cavefish
Match: grin2bb (glutamate receptor, ionotropic, N-methyl D-aspartate 2B, genome duplicate b [Source:ZFIN;Acc:ZDB-GENE-061207-27])

HSP 1 Score: 309.686 bits (792), Expect = 4.466e-87
Identity = 212/690 (30.72%), Postives = 340/690 (49.28%), Query Frame = 3
            +IL +  K + + ++  A    LT   G  Y WI+    +   D  N+                   P +F  G  +V + +    LE  ++  + I A A + +   R          L K  C    + +  K G   ++L   M        GR + F E+G+    +  I     +  D    W +VG W N  ++    +      WP               L + TL E PFVI         TC  N +PC+ +L +   QN      IY +              CC G  +D+LK++ K +KF  DL+ V+  N   G   +G WNG++  +V   + M V SL I   R+E+IDFSVPF ETGI +++    G +SP+AFL+P+ +  W ++F+  +     A+F++E+ SP G +R     RE     F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P +  P FRF T+PNG+TE NI+ ++ EM  YM +F++ +V+EA+ +LK  ++DAF+YDA VL++    D+ CKL  +G   ++A TGYG+ + + S   + ++  IL     G+++  +  W++G C  H E     + +L V N    F +L   M LS +  I+EH F+  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Cavefish
Match: grin2ca (glutamate receptor ionotropic, NMDA 2C-like [Source:NCBI gene;Acc:103025257])

HSP 1 Score: 306.99 bits (785), Expect = 2.610e-86
Identity = 187/541 (34.57%), Postives = 299/541 (55.27%), Query Frame = 3
            L VATL E PFVI         TC  N +PC+             +    +ET++ H+     T  CC G  +D+LK+L +++KF  DL+ V+  N   G    G WNG+I  +V  ++DM + SL I   R+E+IDFSVPF ETGI +++    G +SP+AFL+PY  A W ++F+  +      +F++E+ SP G +R  +    P    F++ +S+WL+W ++F  +V  +NP+G  S+ +  +WA FA++FLASYTANLAAFMI ++    + GL+D +   P    P FRF T+PNG+TE NI+ ++PEM  +M  +N+  V +A+ +LK  ++DAF+YDA VL++    D+ CKL  +  G+++A TGYG+ L +GS+  + I+  +L +   G  Q+ +  W++G C+   +    + KL + N    F +LL  M LS ++   EH  +  +R  VR  ++           Y C   V  +   G + S + + N T  +MLK  K    +  S   R++ +LD +   I+ 
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010716.1 (pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1 gene:ENSPMAG00000009705.1 transcript:ENSPMAT00000010716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 309.686 bits (792), Expect = 3.302e-91
Identity = 160/400 (40.00%), Postives = 255/400 (63.75%), Query Frame = 3
            CC G  +D+LK+L K +KF  DL+ V+  N   GS  +G WNG+I  +V+ ++ M V SL I   R+E++DFSVPF ETGI +++    G +SP+AFL+P+ +  W ++FI  +   G A+FI+E+ SP G +R     +E     F++ +S+WL+W+++F  +V  +NPRG  S+F+ S+WA FA++FLASYTANLAAFMI ++    + GL+D +  SP  H P FRF T+PNG+TE NI+ ++ +M  YM  F++ SV +A+ +LKA ++DAF+YDA VL++    D+ C+L  +  G+++  TGYG+ L + S+  + I+  +L +   G++   +  W++G C  HGE  +  + +L + N    F +LL  M LSF++ + EH F+   R  V+
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.627 bits (296), Expect = 2.759e-29
Identity = 101/359 (28.13%), Postives = 156/359 (43.45%), Query Frame = 3
            + +S  +HK+D+ V  L I   R + IDFS PF   GI IL +   G  +P   +FL P     W           CV+F+ +  S       YEW +PH  +  +    E+ F++  S W       GA +   +   P+ +++R +  IW  F L+ ++SYTANLAAF+  +            R+ SP +      + T I  GA  +   M F          +M  +M +     +    E I+ +   +    +   N+   +  T ++C L  +G L    GYG+G P GS     I   IL  Q+ GKL   K K+W    C +  E +N    LGV+N    FI+L  G+
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 122.094 bits (305), Expect = 4.565e-29
Identity = 99/394 (25.13%), Postives = 167/394 (42.39%), Query Frame = 3
            WNG++  LV  ++D+ +  L I+  R E+IDFS PF   GI I+IK     + G IS   FL P     W  I IF+       +F+    SP+   R +                                  PP E  F +F SLW              +PR ++ R +  +W  F L+ ++SYTANLAAF+  +     +E  +D         +    + T+ +G+T+E  +      + +M  +MK+     F +T+     +  K++   A++ ++   ++     K C    VG      GYG+  P+GS +   +N  +L   + G L + K  W    G C    G+  +    L + N    F +L+GG+ L+ ++ + E C+
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000889.1 (pep scaffold:Pmarinus_7.0:GL476542:184998:205948:1 gene:ENSPMAG00000000813.1 transcript:ENSPMAT00000000889.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.219 bits (256), Expect = 6.248e-25
Identity = 66/200 (33.00%), Postives = 106/200 (53.00%), Query Frame = 3
            L + TL E PFVI         TC  + + C+        Q IN         + D S D S     CC G  +D+L++L   ++F  DL+ V  +  H    +  WNG++  +   ++ M V SL I   R++++DFSVPF ETGI +++    G +SP+AFL+P+ +A W ++FI  +     A++++E+LSP G +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002503.1 (pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:ENSPMAG00000002286.1 transcript:ENSPMAT00000002503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 1.279e-13
Identity = 58/206 (28.16%), Postives = 94/206 (45.63%), Query Frame = 3
            YEW +PH  +  +    E+ F++  SLW       GA +   +   PR +++R +  IW  F L+ ++SYTANLAAF+  +            R+ SP        + T I  GA  +   M F          +M  +M + ++T++     E I   +A   D A + ++  ++H   T + C L  +G L    GYGVG+P G
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 233.032 bits (593), Expect = 1.238e-63
Identity = 196/775 (25.29%), Postives = 342/775 (44.13%), Query Frame = 3
            K  HE  + T+   P     A+     L+ + WN  +LL S          ++ R I      + ++++ K++ T V++  G   +              Y Q L+K   +  R+ILF     D S++YY A    +T   G  Y+WI++   +     +N+ +               G+  L G + +         ++   VI A+A+  L N  + +        P  +CR+   T+ W  G+ L+ A+   S+       I F  +G      + + N +    D +     VG + N  VS N  II     WPG  N  P G      L+V TL   PFV Y KP      C +  +             ++D D  +  + L+      N T++                    V L E   + S     GS    WNG++  ++  K+D++V +L I   R E I+FS PF+  G+ IL+K  E + S  +FL+P+    W ++ + SVH     +++ +  SP G          E   +L  ++W  W +L  + +    PR  ++R L  +WA FA++ +ASYTANLAAF++       + G++D  L +P      F + T+ N + +   +  ++   M  +M+ +N  +  E I+ +K  E+ AF++D+ VL ++ +  KDC L   G L+  +GYG+G+P+GS     I+  IL++ ++G ++  +  W+  A K + E  NT+   LG+++ +  FI+
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Nematostella
Match: EDO44842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUE9])

HSP 1 Score: 192.586 bits (488), Expect = 2.160e-54
Identity = 109/310 (35.16%), Postives = 179/310 (57.74%), Query Frame = 3
            GS ++G W GLI  +V   +DM ++S+ IT  R++ +DFS PF  TG  IL+  R G+     FLKP+  ++W +IF          + ++E  +P GL R         F + +S+WL++S  F   +NA  PR V+SR + S W+   L+  A YTANLAAFM+ ++  + ++G+ND R+ +P       +FTTI + + E+  K++FP +  +M+N+     SE ++A+K      IDAF++++  ++  VA D  C L  VG+L+  +G+    P+GS   +NI+  IL YQ+T   G+L+ +W+K
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Nematostella
Match: EDO34363 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPJ5])

HSP 1 Score: 149.058 bits (375), Expect = 6.497e-39
Identity = 105/389 (26.99%), Postives = 189/389 (48.59%), Query Frame = 3
            C +G  ++LL+ + + + F  + + +  H      P  G WNG++  ++  ++DM + +L IT +R+ +IDFS P+ E GIGIL +     G++    F+ P  S  W VI   I  V      +  +EW   +   R + IP  + R SL  S+   WS           P   ++R +A  +AL  L+   SYTA LAAF + ++    + G+ D ++ +P    P F+F T+ + +TE   +    E    + ++MK+ N   V + +  L + E   ++ D   L+H V++  +C LR++GR + ++GYG+ L + S   + I++ I+       L+  W K W+   C    E   +   L ++N    F+++  G  +  + L
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 124.405 bits (311), Expect = 6.488e-29
Identity = 100/375 (26.67%), Postives = 173/375 (46.13%), Query Frame = 3
            WNG+++ +++ ++D+ VTSL I+P R ++IDF+ P+ + G+ +LIK       +P A L+P+    W  I        GT I +  + WL    SP G            I PR        SL R+LW       G + +  +P   + R   +++    L+ +++YTANLAAF+  K            R TSP +       +    + T+    P    E      F  M QYM+ ++ T V+ + + ++    E  AF++D+ VL+        C  L   G ++   GYG GL + S   K +++ IL  +  G ++   + W+     C +  E A +  +L  ++    FI+L+ G+ +S V+L+ E
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Nematostella
Match: EDO31426 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXZ5])

HSP 1 Score: 118.627 bits (296), Expect = 4.253e-27
Identity = 95/385 (24.68%), Postives = 176/385 (45.71%), Query Frame = 3
             WN L+  +V  ++D+    + IT  R + ++++ P Q+  I I++      IS    AF++P+D++ W VIF  S      A+  Y W     SP+G D   I      F+L  S   ++S +F   ++    R  ++RF  ++++   L+ ++SYTANL A ++ +   + + G+ D +   P      F F T    + E  +K    P +    KN   + V ++ ++ L   ++DA++Y    + H  +     K ++VG+            +GS  + NI+S    Y      +  +K W +   +   ++    +++ + +F   F+ L G   LS ++L+ E   +R    +VR        D+ G C  GLVSLS
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Medaka
Match: ENSORLT00000011525.2 (glutamate receptor ionotropic, NMDA 2A [Source:NCBI gene;Acc:101164378])

HSP 1 Score: 339.347 bits (869), Expect = 4.705e-97
Identity = 245/802 (30.55%), Postives = 404/802 (50.37%), Query Frame = 3
            A+   A  M   +  Y+W+    ++++K P Y E    +       K   D +  + D+  V+  D +    N  S I           +L++I      +IL +  K +   +Y   E  +L  + GA Y+WI+S       D+        E+Y  +  I +S       + +  +P  LE+ ++ G+VI +SA T +  +        K  LP+      S       GKL   A+++ + ++   GR + F  +G+    +  +     +  +N   W K+G W N  +S      +    WP   N        +  L + TL E PFVI         TC  N++PC+  VKL+S                    ++       CC G  +D+LK++ +++KF  DL+ V+ +  H     + WNG++  +V  K+ M V SL I   R+E+IDFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E++SP G +R       P    F++ +++WL+W ++F  +V   NPRG  S+F+ S+WA FA++FLASYTANLAAFMI +E    + GL+D +  SPY++ P FRF T+PNG+TE NI+ ++P+M QYM  +++T V++A+ +LK  ++DAF+YDA VL++    D  CKL  +G   ++A TGYG+ L +GS   ++++  ILS    G+++  +  W++G C  H E     + +L V N    F +L   M LS +  ISEH F+     R+R C    C G   L
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Medaka
Match: ENSORLT00000040618.1 (glutamate receptor ionotropic, NMDA 2A [Source:NCBI gene;Acc:101164378])

HSP 1 Score: 339.732 bits (870), Expect = 4.731e-97
Identity = 245/802 (30.55%), Postives = 404/802 (50.37%), Query Frame = 3
            A+   A  M   +  Y+W+    ++++K P Y E    +       K   D +  + D+  V+  D +    N  S I           +L++I      +IL +  K +   +Y   E  +L  + GA Y+WI+S       D+        E+Y  +  I +S       + +  +P  LE+ ++ G+VI +SA T +  +        K  LP+      S       GKL   A+++ + ++   GR + F  +G+    +  +     +  +N   W K+G W N  +S      +    WP   N        +  L + TL E PFVI         TC  N++PC+  VKL+S                    ++       CC G  +D+LK++ +++KF  DL+ V+ +  H     + WNG++  +V  K+ M V SL I   R+E+IDFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E++SP G +R       P    F++ +++WL+W ++F  +V   NPRG  S+F+ S+WA FA++FLASYTANLAAFMI +E    + GL+D +  SPY++ P FRF T+PNG+TE NI+ ++P+M QYM  +++T V++A+ +LK  ++DAF+YDA VL++    D  CKL  +G   ++A TGYG+ L +GS   ++++  ILS    G+++  +  W++G C  H E     + +L V N    F +L   M LS +  ISEH F+     R+R C    C G   L
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Medaka
Match: grin2bb (glutamate receptor ionotropic, NMDA 2B-like [Source:NCBI gene;Acc:101163953])

HSP 1 Score: 318.546 bits (815), Expect = 5.414e-90
Identity = 249/870 (28.62%), Postives = 413/870 (47.47%), Query Frame = 3
            + P SI+N +C   Q+ ++ +  V+         I  I   I     + +  +      +   K + +M      P++   A  M + +  Y+W     +++T  P + +   +IR           EN F   ++ +V+  D      D SKI+N          ++K+      +IL +  K + + ++  A    LT   G  Y WI+        D+                     +P +F  G  +V + +    +E  ++  + + A+A + +   R          L K +C  L   +    G  L K + K + N+   GR + F E GH    +  I     + KD    W +VG W    ++    +      WP    +  L   A+ +   L + TL E PFVI         TC  N +PC  Q+KLS     N+     IY +              CC G  +D+LK++ K +KF  DL+ V+  N   G   +G WNG++  +V  K+ M V SL I   R+E+IDFSVPF ETGI +++    G +SP+AFL+P+ +  W ++F+  +     A+F++E+ SP G +R     RE     F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +   P    P FRF T+PNG+TE NI+ ++ +M  YM +F++ +V EA+ +LK  ++DAF+YDA VL++    D+ CKL  +  G+++A TGYG+ + + S   + ++  IL     G+++  +  W++G C  H E     + +L V N    F +L   MILS +  I EH F+  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Medaka
Match: grin2aa (glutamate ionotropic receptor NMDA type subunit 2A [Source:NCBI gene;Acc:101161811])

HSP 1 Score: 318.546 bits (815), Expect = 5.479e-90
Identity = 251/887 (28.30%), Postives = 427/887 (48.14%), Query Frame = 3
            + P SI+N +C+ +   K  ++ V+   G     I  I  +  +++   +P L         +  ++   T      ++   A  M + +  Y+W+    ++++K P Y E         N  K   D +    D+  +I  D + +             +   Q + K V S   ++L +  K +   +   A    LT   G  Y+WI+    +G P        E+  E +        SGM  +  + +  +P  LE  ++ GL I  SA   +  +  ++        P+         E  K  KL   A+ K + N+  +G+ + F E+G+    +  +     + K+    W K+G   N        + +    WP   N           L + TL E PFVI    +    TC  N++PC+                   + + D++ ++  T+   CC G  +D+LK++ K +KF  DL+ V+ +  H     + WNG++  +V  K+ M V SL I   R+E+IDFSVPF ETGI +++    G +SP+AFL+P+ ++ W ++F+  +     A+F++E++SP G +R       P    F++ +++WL+W ++F  +V   NP+G  S+F+ S+WA FA++FLASYTANLAAFMI +E    + GL+D +  +P+ + P FRF T+PNG+TE NI+ ++P M QYM  +++T V +A+ +LK  ++DAF+YDA VL++    D+ CKL  +G   ++A TGYG+ L +GS   + ++  IL+    G+++  +  W++G C  H E     + +L V N    F +L   M LS +  ISEH F+     R+R C    C G    L S+S G
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Medaka
Match: ENSORLT00000018671.2 (glutamate ionotropic receptor NMDA type subunit 2B [Source:NCBI gene;Acc:101173552])

HSP 1 Score: 314.309 bits (804), Expect = 1.769e-88
Identity = 185/534 (34.64%), Postives = 294/534 (55.06%), Query Frame = 3
            GR + F E+G+    +  I     + KD    W +VG W N  +S    +      + G +N+          L + TL E PFVI         TC  N +PC+ ++      N   +  IY +              CC G  +D+LK++ K +KF  DL+ V+  N   G   +G WNG++  +V   + M V SL I   R+E+IDFSVPF ETGI +++    G +SP+AFL+P+ +  W ++F+  +     A+FI+E+ SP G +R       P    F++ +++WL+W ++F  +V   NP+G  S+ + S+WA FA++FLASYTANLAAFMI +E    + GL+D +  SP +  P FRF T+PNG+TE NI+ ++PEM  YM  F++ +V+EA+++LKA ++DAF+YDA VL++    D+ CKL  +G   ++A TGYG+ + + S   ++++  IL     G+++  +  W++G C  H +    + +L V N    F +L   M LS +  I EH F+  +R
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Planmine SMEST
Match: SMESG000055022.1 (SMESG000055022.1)

HSP 1 Score: 1415.59 bits (3663), Expect = 0.000e+0
Identity = 697/697 (100.00%), Postives = 697/697 (100.00%), Query Frame = 3
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Planmine SMEST
Match: SMESG000055022.1 (SMESG000055022.1)

HSP 1 Score: 1271.53 bits (3289), Expect = 0.000e+0
Identity = 629/629 (100.00%), Postives = 629/629 (100.00%), Query Frame = 3
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Planmine SMEST
Match: SMESG000021416.1 (SMESG000021416.1)

HSP 1 Score: 827.78 bits (2137), Expect = 0.000e+0
Identity = 470/1020 (46.08%), Postives = 649/1020 (63.63%), Query Frame = 3
            P ++ + +C  L  R++ VN  ML++  GE+        I +IIH+ +SMG+PT TW P++ G+ K +++ + + LEPA  H+ +AM DF++ YNW     ++S K P++    +E++     R  MN+E  F+  I++ +   G  IT L      KN+  F+    + L+++  +NDR+ILFHG + +  +L  A + + + K      +FG++Y+W+ SP+ +  T  KN  EM  E  +  +   I G          +PG+F F      +  +        +WA +++KL    K R   N+ A    L P   C   +     K G  LY+ MK     IN   I FL NG +N T+  IFNS+  KK +   W KVG+W   +      + + IDGVTWPG   KPP GRP K++L+V T+ E+PFV + +  +   CD N++ C V+  +      N  +  Y+   V+ ++D     ACC+GL MD+L ELMKDL+F+VDLFEV       G    GWNGL+K L DH +DM VTS KITPNR+E IDFSVPF +TGI I++ LREG ISPTAFL+PYD  SWCVI +FSVH+CG A+FIYEWLSPHGLDRGN    EH+FS FRSLWLIWSMLFGAAVNADNPRG ASRFLA+IWALFALVFLASYTANLAAFMI+K+DFY+L G+ D  L +P   KP F F T+P+GATEENIK++FP M +YMK FN++SV E IKALK  EI+AF+YD+NVL+++   D++CKL+ VG L+AMTGYGVG P+ SK L  IN  IL+Y+  GK+QRWK++W++GACKK   L +TNK+LGVKNFISAFILLLGG+IL  +LL+ EH F++Y+RP + + DKYGCCGLVS+SMGQ+L+FEQSVNQTVDM+K+ KC N +CES+  + +   D  + R++ LE+ ++  K +  N K  N +Q           + +K   K+ +P+  +KS D     +YS    + VY+ T +K N
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Planmine SMEST
Match: SMESG000021416.1 (SMESG000021416.1)

HSP 1 Score: 827.009 bits (2135), Expect = 0.000e+0
Identity = 470/1020 (46.08%), Postives = 649/1020 (63.63%), Query Frame = 3
            P ++ + +C  L  R++ VN  ML++  GE+        I +IIH+ +SMG+PT TW P++ G+ K +++ + + LEPA  H+ +AM DF++ YNW     ++S K P++    +E++     R  MN+E  F+  I++ +   G  IT L      KN+  F+    + L+++  +NDR+ILFHG + +  +L  A + + + K      +FG++Y+W+ SP+ +  T  KN  EM  E  +  +   I G          +PG+F F      +  +        +WA +++KL    K R   N+ A    L P   C   +     K G  LY+ MK     IN   I FL NG +N T+  IFNS+  KK +   W KVG+W   +      + + IDGVTWPG   KPP GRP K++L+V T+ E+PFV + +  +   CD N++ C V+  +      N  +  Y+   V+ ++D     ACC+GL MD+L ELMKDL+F+VDLFEV       G    GWNGL+K L DH +DM VTS KITPNR+E IDFSVPF +TGI I++ LREG ISPTAFL+PYD  SWCVI +FSVH+CG A+FIYEWLSPHGLDRGN    EH+FS FRSLWLIWSMLFGAAVNADNPRG ASRFLA+IWALFALVFLASYTANLAAFMI+K+DFY+L G+ D  L +P   KP F F T+P+GATEENIK++FP M +YMK FN++SV E IKALK  EI+AF+YD+NVL+++   D++CKL+ VG L+AMTGYGVG P+ SK L  IN  IL+Y+  GK+QRWK++W++GACKK   L +TNK+LGVKNFISAFILLLGG+IL  +LL+ EH F++Y+RP + + DKYGCCGLVS+SMGQ+L+FEQSVNQTVDM+K+ KC N +CES+  + +   D  + R++ LE+ ++  K +  N K  N +Q           + +K   K+ +P+  +KS D     +YS    + VY+ T +K N
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Planmine SMEST
Match: SMESG000021416.1 (SMESG000021416.1)

HSP 1 Score: 826.624 bits (2134), Expect = 0.000e+0
Identity = 470/1020 (46.08%), Postives = 649/1020 (63.63%), Query Frame = 3
            P ++ + +C  L  R++ VN  ML++  GE+        I +IIH+ +SMG+PT TW P++ G+ K +++ + + LEPA  H+ +AM DF++ YNW     ++S K P++    +E++     R  MN+E  F+  I++ +   G  IT L      KN+  F+    + L+++  +NDR+ILFHG + +  +L  A + + + K      +FG++Y+W+ SP+ +  T  KN  EM  E  +  +   I G          +PG+F F      +  +        +WA +++KL    K R   N+ A    L P   C   +     K G  LY+ MK     IN   I FL NG +N T+  IFNS+  KK +   W KVG+W   +      + + IDGVTWPG   KPP GRP K++L+V T+ E+PFV + +  +   CD N++ C V+  +      N  +  Y+   V+ ++D     ACC+GL MD+L ELMKDL+F+VDLFEV       G    GWNGL+K L DH +DM VTS KITPNR+E IDFSVPF +TGI I++ LREG ISPTAFL+PYD  SWCVI +FSVH+CG A+FIYEWLSPHGLDRGN    EH+FS FRSLWLIWSMLFGAAVNADNPRG ASRFLA+IWALFALVFLASYTANLAAFMI+K+DFY+L G+ D  L +P   KP F F T+P+GATEENIK++FP M +YMK FN++SV E IKALK  EI+AF+YD+NVL+++   D++CKL+ VG L+AMTGYGVG P+ SK L  IN  IL+Y+  GK+QRWK++W++GACKK   L +TNK+LGVKNFISAFILLLGG+IL  +LL+ EH F++Y+RP + + DKYGCCGLVS+SMGQ+L+FEQSVNQTVDM+K+ KC N +CES+  + +   D  + R++ LE+ ++  K +  N K  N +Q           + +K   K+ +P+  +KS D     +YS    + VY+ T +K N
The following BLAST results are available for this feature:
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIN2A7.809e-9529.21glutamate ionotropic receptor NMDA type subunit 2A... [more]
GRIN2A4.720e-9429.21glutamate ionotropic receptor NMDA type subunit 2A... [more]
GRIN2A1.865e-9329.21glutamate ionotropic receptor NMDA type subunit 2A... [more]
GRIN2A1.865e-9329.21glutamate ionotropic receptor NMDA type subunit 2A... [more]
GRIN2B4.039e-9228.65glutamate ionotropic receptor NMDA type subunit 2B... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmr-22.622e-12836.32NMDA class glutamate Receptor [Source:UniProtKB/T... [more]
nmr-21.074e-11641.56NMDA class glutamate Receptor [Source:UniProtKB/T... [more]
nmr-11.786e-3927.96NMDA class glutamate Receptor; NMDA-type ionotropi... [more]
nmr-11.786e-3927.96NMDA class glutamate Receptor; NMDA-type ionotropi... [more]
glr-31.645e-3229.08GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nmdar22.609e-16633.76gene:FBgn0053513 transcript:FBtr0301844[more]
Nmdar23.809e-16633.55gene:FBgn0053513 transcript:FBtr0339592[more]
Nmdar24.772e-16633.76gene:FBgn0053513 transcript:FBtr0070288[more]
Nmdar25.224e-16633.91gene:FBgn0053513 transcript:FBtr0301843[more]
Nmdar21.441e-16534.30gene:FBgn0053513 transcript:FBtr0091453[more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX649405.21.005e-9428.99glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin2ab1.388e-9428.99glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin2ab1.388e-9428.99glutamate receptor, ionotropic, N-methyl D-asparta... [more]
GRIN2B1.182e-9229.65glutamate receptor ionotropic, NMDA 2B-like [Sourc... [more]
grin2aa2.042e-9232.43glutamate receptor, ionotropic, N-methyl D-asparta... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIN2B1.402e-9328.54glutamate receptor, ionotropic, N-methyl D-asparta... [more]
GRIN2B1.879e-9328.54glutamate receptor, ionotropic, N-methyl D-asparta... [more]
sdr42e12.005e-9328.03short chain dehydrogenase/reductase family 42E, me... [more]
GRIN2B2.845e-9328.26glutamate receptor, ionotropic, N-methyl D-asparta... [more]
GRIN2B2.719e-9228.26glutamate receptor, ionotropic, N-methyl D-asparta... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grin2a1.039e-9329.46glutamate receptor, ionotropic, NMDA2A (epsilon 1)... [more]
Grin2a1.039e-9329.46glutamate receptor, ionotropic, NMDA2A (epsilon 1)... [more]
Grin2a1.039e-9329.46glutamate receptor, ionotropic, NMDA2A (epsilon 1)... [more]
Grin2b1.632e-9228.77glutamate receptor, ionotropic, NMDA2B (epsilon 2)... [more]
Grin2b1.632e-9228.77glutamate receptor, ionotropic, NMDA2B (epsilon 2)... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5IS45|NMDE1_PANTR7.269e-9329.21Glutamate receptor ionotropic, NMDA 2A OS=Pan trog... [more]
sp|P35436|NMDE1_MOUSE7.269e-9329.46Glutamate receptor ionotropic, NMDA 2A OS=Mus musc... [more]
sp|Q12879|NMDE1_HUMAN8.955e-9329.21Glutamate receptor ionotropic, NMDA 2A OS=Homo sap... [more]
sp|Q01097|NMDE2_MOUSE3.640e-9228.89Glutamate receptor ionotropic, NMDA 2B OS=Mus musc... [more]
sp|A7XY94|NMDE2_XENLA5.615e-9227.21Glutamate receptor ionotropic, NMDA 2B OS=Xenopus ... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FAS30.000e+049.23Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EW570.000e+048.80Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F5H50.000e+044.57Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267G7X70.000e+044.38Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A3Q0KPC60.000e+041.41Putative glutamate receptor, NMDA OS=Schistosoma m... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grin2ab9.698e-9330.83glutamate receptor, ionotropic, N-methyl D-asparta... [more]
ENSAMXT00000048483.11.228e-9029.40pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
grin2aa1.345e-8731.73glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin2bb4.466e-8730.72glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin2ca2.610e-8634.57glutamate receptor ionotropic, NMDA 2C-like [Sourc... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010716.13.302e-9140.00pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1... [more]
ENSPMAT00000005084.12.759e-2928.13pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
gria1b4.565e-2925.13glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000000889.16.248e-2533.00pep scaffold:Pmarinus_7.0:GL476542:184998:205948:1... [more]
ENSPMAT00000002503.11.279e-1328.16pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:E... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO355451.238e-6325.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448422.160e-5435.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343636.497e-3926.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302036.488e-2926.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314264.253e-2724.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000011525.24.705e-9730.55glutamate receptor ionotropic, NMDA 2A [Source:NCB... [more]
ENSORLT00000040618.14.731e-9730.55glutamate receptor ionotropic, NMDA 2A [Source:NCB... [more]
grin2bb5.414e-9028.62glutamate receptor ionotropic, NMDA 2B-like [Sourc... [more]
grin2aa5.479e-9028.30glutamate ionotropic receptor NMDA type subunit 2A... [more]
ENSORLT00000018671.21.769e-8834.64glutamate ionotropic receptor NMDA type subunit 2B... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
back to top
The following sequences are available for this feature:

transcript sequence

>SMED30003404 ID=SMED30003404|Name=Glutamate receptor ionotropic, NMDA 2B|organism=Schmidtea mediterranea sexual|type=transcript|length=3276bp
back to top

protein sequence of SMED30003404-orf-1

>SMED30003404-orf-1 ID=SMED30003404-orf-1|Name=SMED30003404-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=999bp
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0004872receptor activity
GO:0005216ion channel activity
GO:0004970ionotropic glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
Vocabulary: Planarian Anatomy
Vocabulary: INTERPRO
Vocabulary: cellular component
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0060079excitatory postsynaptic potential
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 875..909
NoneNo IPR availableCOILSCoilCoilcoord: 84..104
NoneNo IPR availableGENE3DG3DSA: 515..739
e-value: 7.4E-88
score: 296.7
NoneNo IPR availableGENE3DG3DSA: 525..816
e-value: 7.4E-88
score: 296.7
NoneNo IPR availableGENE3DG3DSA: 52..339
e-value: 7.8E-19
score: 69.6
NoneNo IPR availableGENE3DG3DSA: 16..313
e-value: 7.8E-19
score: 69.6
NoneNo IPR availableGENE3DG3DSA: 438..789
e-value: 7.4E-88
score: 296.7
NoneNo IPR availablePANTHERPTHR18966:SF391NMDA RECEPTOR 2, ISOFORM Ccoord: 26..807
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 371..774
NoneNo IPR availableTMHMMTMhelixcoord: 796..815
NoneNo IPR availableTMHMMTMhelixcoord: 537..559
NoneNo IPR availableTMHMMTMhelixcoord: 610..632
NoneNo IPR availableTMHMMTMhelixcoord: 579..597
IPR001508Ionotropic glutamate receptor, metazoaPRINTSPR00177NMDARECEPTORcoord: 609..636
score: 53.57
coord: 796..820
score: 24.4
coord: 541..566
score: 23.08
coord: 578..602
score: 20.0
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainSMARTSM00918Lig_chan_Glu_bd_2coord: 424..485
e-value: 0.0038
score: 26.5
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainPFAMPF10613Lig_chan-Glu_bdcoord: 436..522
e-value: 5.4E-20
score: 71.7
IPR001320Ionotropic glutamate receptorSMARTSM00079GluR_14coord: 421..776
e-value: 3.3E-40
score: 149.6
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 539..807
e-value: 4.2E-28
score: 98.1
IPR001828Receptor, ligand binding regionPFAMPF01094ANF_receptorcoord: 21..320
e-value: 1.9E-9
score: 37.1
IPR028082Periplasmic binding protein-like ISUPERFAMILYSSF53822Periplasmic binding protein-like Icoord: 16..367