SMED30003401

Overview
NameSMED30003401
Smed IDSMED30003401
Length (bp)2043
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30003401 (SMED30003401) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30003401 (SMED30003401) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30003401 (SMED30003401) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30003401 (SMED30003401) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003401

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30003401h1SMcG0011680 dd_Smed_v4_12152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30003401 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.005650:14042..16121 -9959
Homology
BLAST of SMED30003401 vs. Ensembl Human
Match: HTR1A (5-hydroxytryptamine receptor 1A [Source:HGNC Symbol;Acc:HGNC:5286])

HSP 1 Score: 179.874 bits (455), Expect = 2.553e-49
Identity = 126/395 (31.90%), Postives = 199/395 (50.38%), Query Frame = -2
Query:  630 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWS--KHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKV-----------RFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFC--GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1769
            +GN+ V+ A+   + LQ V N  + SLA +D+ VS+ VLP+A + Q++  W L  + C L+++ D+  CTSSIL+LC I++DRY AIT P+ Y  +R+ + A  +I   W++   ++IP + GW   +  S    C I+   GY ++S F +F IP L+++        V Y R   ++        RI+        + ++  +   P    KKSV        N    S N      +R  + S        N   R   D  +  E + V    VG+S +  PL  +            R NE + + + + A  +E KT KTL +++G F +CW+PFF V LV PFC   C +     A + WLGY NS+ NP IYA++NK++  AF+K++
Sbjct:   52 LGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLML--------VLYGRIFRAA------RFRIRKTVKKVEKTGADTRHGASPAPQPKKSV--------NGESGSRN------WRLGVESKAGGALCANGAVR-QGDDGAALEVIEVHR--VGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of SMED30003401 vs. Ensembl Human
Match: DRD3 (dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:3024])

HSP 1 Score: 144.05 bits (362), Expect = 9.043e-37
Identity = 116/400 (29.00%), Postives = 198/400 (49.50%), Query Frame = -2
Query:  630 IFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKH-WPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLAR---CMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMP---KKMNFLQRILADSNSITETVTVQLVC---------VGHSLQFPPLK-KKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCG-CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1775
            I  GN +V +AV+  + LQT TN  V+SLA +D+ V+  V+P  +  ++    W  + + C ++++ D+ +CT+SILNLC ISIDRY A+  P+ Y     +   R    MI AVW+LA +V+ P +FG++     T  C I+ +  + ++S+  SF +PF + + VY RI+ V  +R+              +    +  NS  N    G+P+++         SP+    E+      + Y+    ++ +  P   ++   L+R     NS++ T+  +L           +  SL+  PL+ + V   E                  + +A+V+G F +CW+PFF  +++   C  C ++P   +  TWLGYVNS  NP IY  +N E+  AF K++
Sbjct:   43 IVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPT-VCSIS-NPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRR--------------RKRILTRQNSQCNSVRPGFPQQT--------LSPDPAHLEL------KRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKK--------------ATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKIL 398          
BLAST of SMED30003401 vs. Ensembl Human
Match: DRD3 (dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:3024])

HSP 1 Score: 144.05 bits (362), Expect = 9.043e-37
Identity = 116/400 (29.00%), Postives = 198/400 (49.50%), Query Frame = -2
Query:  630 IFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKH-WPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLAR---CMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMP---KKMNFLQRILADSNSITETVTVQLVC---------VGHSLQFPPLK-KKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCG-CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1775
            I  GN +V +AV+  + LQT TN  V+SLA +D+ V+  V+P  +  ++    W  + + C ++++ D+ +CT+SILNLC ISIDRY A+  P+ Y     +   R    MI AVW+LA +V+ P +FG++     T  C I+ +  + ++S+  SF +PF + + VY RI+ V  +R+              +    +  NS  N    G+P+++         SP+    E+      + Y+    ++ +  P   ++   L+R     NS++ T+  +L           +  SL+  PL+ + V   E                  + +A+V+G F +CW+PFF  +++   C  C ++P   +  TWLGYVNS  NP IY  +N E+  AF K++
Sbjct:   43 IVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPT-VCSIS-NPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRR--------------RKRILTRQNSQCNSVRPGFPQQT--------LSPDPAHLEL------KRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKK--------------ATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKIL 398          
BLAST of SMED30003401 vs. Ensembl Human
Match: DRD3 (dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:3024])

HSP 1 Score: 144.05 bits (362), Expect = 9.043e-37
Identity = 116/400 (29.00%), Postives = 198/400 (49.50%), Query Frame = -2
Query:  630 IFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKH-WPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLAR---CMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMP---KKMNFLQRILADSNSITETVTVQLVC---------VGHSLQFPPLK-KKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCG-CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1775
            I  GN +V +AV+  + LQT TN  V+SLA +D+ V+  V+P  +  ++    W  + + C ++++ D+ +CT+SILNLC ISIDRY A+  P+ Y     +   R    MI AVW+LA +V+ P +FG++     T  C I+ +  + ++S+  SF +PF + + VY RI+ V  +R+              +    +  NS  N    G+P+++         SP+    E+      + Y+    ++ +  P   ++   L+R     NS++ T+  +L           +  SL+  PL+ + V   E                  + +A+V+G F +CW+PFF  +++   C  C ++P   +  TWLGYVNS  NP IY  +N E+  AF K++
Sbjct:   43 IVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPT-VCSIS-NPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRR--------------RKRILTRQNSQCNSVRPGFPQQT--------LSPDPAHLEL------KRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKK--------------ATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKIL 398          
BLAST of SMED30003401 vs. Ensembl Human
Match: HTR7 (5-hydroxytryptamine receptor 7 [Source:HGNC Symbol;Acc:HGNC:5302])

HSP 1 Score: 118.627 bits (296), Expect = 7.757e-28
Identity = 55/146 (37.67%), Postives = 96/146 (65.75%), Query Frame = -2
Query: 1332 GNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMK-HWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFS 1766
            GN +V+++V   K+L+  +N  ++SLA +D+ V++ V+P   VT ++   W      C ++++ D+  CT+SI+ LC ISIDRY+ IT+PL Y  R++ K    MIL+VW+L+ S+T+P +FGW+++++    C I+   GY ++S
Sbjct:   98 GNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYS 243          

HSP 2 Score: 70.0922 bits (170), Expect = 4.716e-12
Identity = 34/77 (44.16%), Postives = 47/77 (61.04%), Query Frame = -2
Query:  630 TAKTLALVVGCFSICWIPFFCVYLVEPF-----CGCIINPHFVAFV-TWLGYVNSIFNPFIYAFYNKEYALAFRKLV 842
             A TL ++VG F++CW+PFF +    PF     C CI  P +V     WLGY NS+ NPFIYAF+N++    +R L+
Sbjct:  325 AATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCI--PLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLL 399          
BLAST of SMED30003401 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 159.844 bits (403), Expect = 1.468e-42
Identity = 120/387 (31.01%), Postives = 203/387 (52.45%), Query Frame = -2
Query:  627 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMK-HWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWS--KHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPP--LKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCG-CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVC 1769
            +GN++V++AV + + L+ V N +++SLA SD+ V+IFV+PL +VT +    W L    C+ + ++DI LCTSSILNLC I++DRY AI  P+ YA +R+ K    +I+ VWIL++ +++P I GW+  +       C ++  + + +FSA  SF +P L+++        V Y +  +S+ +      RI+++     +++  I N    +   K S+   K  +  S+  S  + E+                      ++AD  +   T+        HS   P   L+K+ + +             KE + AKT+A+++  FS CW+PFF  Y++ PFC  C ++       TWLGY+NS  NPF+Y   N E+  AF+K++C
Sbjct:   73 VGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQENMMEDSCGLSTEKAFVVFSAAGSFFLPLLVMV--------VVYVKIFISARQ------RIRTN--RGRSALMRIQNAEGDDDYRKMSI---KRASVESARTSSRVGEKTPL-------------------VIADGQTTVTTLA------AHSNPNPTAVLRKREKIS-----------VAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKILC 404          
BLAST of SMED30003401 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 156.377 bits (394), Expect = 3.858e-41
Identity = 118/391 (30.18%), Postives = 205/391 (52.43%), Query Frame = -2
Query:  627 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMK-HWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWS--KHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAK------TLALVVGCFSICWIPFFCVYLVEPFCG-CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVC 1769
            +GN++V++AV + + L+ V N +++SLA SD+ V+IFV+PL +VT +    W L    C+ + ++DI LCTSSILNLC I++DRY AI  P+ YA +R+ K    +I+ VWIL++ +++P I GW+  +       C ++  + + +FSA  SF +P L+++        V Y +  +S+ +      RI+++     +++  I N    +   K S+   K  +  S+  S  + E+         +      +  L     D  S+ +  T + +   ++       K V+ +E +         R++   AK      T+A+++  FS CW+PFF  Y++ PFC  C ++       TWLGY+NS  NPF+Y   N E+  AF+K++C
Sbjct:   73 VGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQENMMEDSCGLSTEKAFVVFSAAGSFFLPLLVMV--------VVYVKIFISARQ------RIRTN--RGRSALMRIQNAEGDDDYRKMSI---KRASVESARTSSRVGEKTPL-----VIADGQTTVTTLAAHSTDGGSLPKDETTKHMKYHNNGSCKVKVKDVKEDEGNPNPTAVLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKILC 439          
BLAST of SMED30003401 vs. Ensembl Celegans
Match: ser-4 (SERotonin/octopamine receptor family; Serotonin receptor [Source:UniProtKB/TrEMBL;Acc:G5EGH0])

HSP 1 Score: 137.887 bits (346), Expect = 9.915e-35
Identity = 117/397 (29.47%), Postives = 190/397 (47.86%), Query Frame = -2
Query:  630 FIGNSMVILAVMTTKRLQTVTNLYVI-SLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGW-----SKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMN-------FLQRILADSNSITETVTVQLVCVGHS-LQFPP--LKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCGCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1772
            FIGN  VILA++  + L+     Y+I SLA +D+ V + V PL     +   W L  + C  W+S D+ +CT+SIL+L  I++DRY +IT  + Y   R+ K    M+  +W  +L +++    GW     S  +  +  C I+    Y++FS   +F IP + II VY +I   A KR           F R + D  +      +  ++      +K   C L         V ++ ++ N       + IK P + N         +R +  +N     VT Q   +     +  P  +K++ R  E+++ KRER A+       +TLA++ G F  CW PFF V +  P CGC I+P       WLGY+NS  NP IY  +++++  AF++++
Sbjct:   66 FIGNLFVILAIIMERDLRGRPQYYLIFSLAVADLLVGMIVTPLGAWFTVTGTWNLGVVVCDFWISVDVLVCTASILHLVAIALDRYWSITD-ICYVQNRTPKRITLMLAVIWFTSLLISLAPFAGWKDEGFSDRVLKSHVCLISQQISYQVFSTATAFYIPLIAIICVYWKIMRAAKKR-----------FKR-ERDRRTVIRPPPDAIDEKKAMMPKKSKKCPL------PPAVVISDIQANGGTGGKTNSIKNPPRHNESSSSASEEERTMTQTNHAPGDVTTQETKIDEENGRSKPGIVKRRRRTKESNEMKRERKAW-------RTLAIITGTFVACWTPFFLVSIYRPICGCQISPVLEQVTLWLGYLNSALNPIIYTVFSQDFRAAFKRII 436          
BLAST of SMED30003401 vs. Ensembl Celegans
Match: ser-4 (SERotonin/octopamine receptor family; Serotonin receptor [Source:UniProtKB/TrEMBL;Acc:G5EGH0])

HSP 1 Score: 137.887 bits (346), Expect = 9.915e-35
Identity = 117/397 (29.47%), Postives = 190/397 (47.86%), Query Frame = -2
Query:  630 FIGNSMVILAVMTTKRLQTVTNLYVI-SLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGW-----SKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMN-------FLQRILADSNSITETVTVQLVCVGHS-LQFPP--LKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCGCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1772
            FIGN  VILA++  + L+     Y+I SLA +D+ V + V PL     +   W L  + C  W+S D+ +CT+SIL+L  I++DRY +IT  + Y   R+ K    M+  +W  +L +++    GW     S  +  +  C I+    Y++FS   +F IP + II VY +I   A KR           F R + D  +      +  ++      +K   C L         V ++ ++ N       + IK P + N         +R +  +N     VT Q   +     +  P  +K++ R  E+++ KRER A+       +TLA++ G F  CW PFF V +  P CGC I+P       WLGY+NS  NP IY  +++++  AF++++
Sbjct:   66 FIGNLFVILAIIMERDLRGRPQYYLIFSLAVADLLVGMIVTPLGAWFTVTGTWNLGVVVCDFWISVDVLVCTASILHLVAIALDRYWSITD-ICYVQNRTPKRITLMLAVIWFTSLLISLAPFAGWKDEGFSDRVLKSHVCLISQQISYQVFSTATAFYIPLIAIICVYWKIMRAAKKR-----------FKR-ERDRRTVIRPPPDAIDEKKAMMPKKSKKCPL------PPAVVISDIQANGGTGGKTNSIKNPPRHNESSSSASEEERTMTQTNHAPGDVTTQETKIDEENGRSKPGIVKRRRRTKESNEMKRERKAW-------RTLAIITGTFVACWTPFFLVSIYRPICGCQISPVLEQVTLWLGYLNSALNPIIYTVFSQDFRAAFKRII 436          
BLAST of SMED30003401 vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 125.946 bits (315), Expect = 7.130e-31
Identity = 107/383 (27.94%), Postives = 177/383 (46.21%), Query Frame = -2
Query:  654 IFIGNSMVILAVMTTKRLQTV-TNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAXXXXX--XXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQF----PPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLAL--VVGCFSICWIPFFCVYLVEPFCGCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEY 1775
            I  GN +V++ V   ++L+    N  ++SLA +D+ V + V+PL +  +I+  W +  + C++WL+ D+   T+SIL++C IS+DRY ++T PL Y   R+       I   WI++L + +P IFGW     + G C ++   GY L+S+  SF   +  LII++  I    + + R+ L   E        + D      +I +  N+ Y             +  Y   E S  I ++           K+    + + ++      I+E +  Q V V  +L      PP     R  E  K   +R    K  +   TL L  ++  F + W+PFF +Y++  F G    P    F  WLGY NS  NP IY  +N+E+
Sbjct:   35 IIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPE-RAEGECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQRLKETE--------RRDHTLNMLTIRSSTNERY-------------NMEYELEENSDPIEDEKE---------KVVTNRDMINKVCWQLRKISEELPRQGVKVSIALDTNHNSPPASDLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAF-GHEAPPLVFKFFFWLGYCNSGINPVIYTVFNREF 385          
BLAST of SMED30003401 vs. Ensembl Fly
Match: TyrR (gene:FBgn0038542 transcript:FBtr0344474)

HSP 1 Score: 149.058 bits (375), Expect = 1.634e-37
Identity = 73/149 (48.99%), Postives = 106/149 (71.14%), Query Frame = -2
Query: 1329 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYA-TRRSKKLARCMILAVWILALSVTIPGIFGW-SKHISSTGYCFITFHRGYRLFSA 1769
            IGN++VILA++TT+RL+T+TN +V+SLA +D+ V IFV+P A+   ++  W L  + C +W+S D+ LCT+SIL+LC IS+DRY+A+T+PL Y+  RRSK+LA  MIL VW+LAL++T P + GW          C    + GY +FSA
Sbjct:  132 IGNTLVILAILTTRRLRTITNCFVMSLAVADLLVGIFVMPPAVAVHLIGSWQLGWVLCDIWISLDVLLCTASILSLCAISVDRYLAVTRPLTYSRKRRSKRLALIMILIVWLLALAITCPPMLGWYEPGRRDLRECRYNQNEGYVIFSA 280          

HSP 2 Score: 74.3294 bits (181), Expect = 1.972e-13
Identity = 35/73 (47.95%), Postives = 47/73 (64.38%), Query Frame = -2
Query:  627 TAKTLALVVGCFSICWIPFFCVYLVEPFCGCIINPHFVA-FVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVC 842
            T +TL++VVG F  CW+PFF  YL+ PF         +A  +TWLG+ NS  NPFIYAFY+ ++  AF +L C
Sbjct:  538 TTQTLSIVVGGFIACWLPFFINYLITPFLAEHQASQMLAKALTWLGWFNSAINPFIYAFYSVDFRAAFWRLTC 610          
BLAST of SMED30003401 vs. Ensembl Fly
Match: TyrR (gene:FBgn0038542 transcript:FBtr0083532)

HSP 1 Score: 149.058 bits (375), Expect = 1.634e-37
Identity = 73/149 (48.99%), Postives = 106/149 (71.14%), Query Frame = -2
Query: 1329 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYA-TRRSKKLARCMILAVWILALSVTIPGIFGW-SKHISSTGYCFITFHRGYRLFSA 1769
            IGN++VILA++TT+RL+T+TN +V+SLA +D+ V IFV+P A+   ++  W L  + C +W+S D+ LCT+SIL+LC IS+DRY+A+T+PL Y+  RRSK+LA  MIL VW+LAL++T P + GW          C    + GY +FSA
Sbjct:  132 IGNTLVILAILTTRRLRTITNCFVMSLAVADLLVGIFVMPPAVAVHLIGSWQLGWVLCDIWISLDVLLCTASILSLCAISVDRYLAVTRPLTYSRKRRSKRLALIMILIVWLLALAITCPPMLGWYEPGRRDLRECRYNQNEGYVIFSA 280          

HSP 2 Score: 74.3294 bits (181), Expect = 1.972e-13
Identity = 35/73 (47.95%), Postives = 47/73 (64.38%), Query Frame = -2
Query:  627 TAKTLALVVGCFSICWIPFFCVYLVEPFCGCIINPHFVA-FVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVC 842
            T +TL++VVG F  CW+PFF  YL+ PF         +A  +TWLG+ NS  NPFIYAFY+ ++  AF +L C
Sbjct:  538 TTQTLSIVVGGFIACWLPFFINYLITPFLAEHQASQMLAKALTWLGWFNSAINPFIYAFYSVDFRAAFWRLTC 610          
BLAST of SMED30003401 vs. Ensembl Fly
Match: TyrR (gene:FBgn0038542 transcript:FBtr0346161)

HSP 1 Score: 149.058 bits (375), Expect = 1.634e-37
Identity = 73/149 (48.99%), Postives = 106/149 (71.14%), Query Frame = -2
Query: 1329 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYA-TRRSKKLARCMILAVWILALSVTIPGIFGW-SKHISSTGYCFITFHRGYRLFSA 1769
            IGN++VILA++TT+RL+T+TN +V+SLA +D+ V IFV+P A+   ++  W L  + C +W+S D+ LCT+SIL+LC IS+DRY+A+T+PL Y+  RRSK+LA  MIL VW+LAL++T P + GW          C    + GY +FSA
Sbjct:  132 IGNTLVILAILTTRRLRTITNCFVMSLAVADLLVGIFVMPPAVAVHLIGSWQLGWVLCDIWISLDVLLCTASILSLCAISVDRYLAVTRPLTYSRKRRSKRLALIMILIVWLLALAITCPPMLGWYEPGRRDLRECRYNQNEGYVIFSA 280          

HSP 2 Score: 74.3294 bits (181), Expect = 1.972e-13
Identity = 35/73 (47.95%), Postives = 47/73 (64.38%), Query Frame = -2
Query:  627 TAKTLALVVGCFSICWIPFFCVYLVEPFCGCIINPHFVA-FVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVC 842
            T +TL++VVG F  CW+PFF  YL+ PF         +A  +TWLG+ NS  NPFIYAFY+ ++  AF +L C
Sbjct:  538 TTQTLSIVVGGFIACWLPFFINYLITPFLAEHQASQMLAKALTWLGWFNSAINPFIYAFYSVDFRAAFWRLTC 610          
BLAST of SMED30003401 vs. Ensembl Fly
Match: TyrRII (gene:FBgn0038541 transcript:FBtr0344630)

HSP 1 Score: 140.969 bits (354), Expect = 6.358e-35
Identity = 74/151 (49.01%), Postives = 103/151 (68.21%), Query Frame = -2
Query: 1329 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYA-TRRSKKLARCMILAVWILALSVTIPGIFGW---SKHISSTGYCFITFHRGYRLFSA 1769
            +GN++VILAV+TT+RL+TVTN +V++LA +D  V   V+P ++V  I   W    + C +W+S DI LC+ SIL+LC IS+DRY+A+TQPL Y+  RRSK+LA  MIL VWI ALS+T P   GW    +H +    C    ++GY +FSA
Sbjct:   90 VGNTLVILAVLTTRRLRTVTNCFVMNLAITDWLVGTCVMPPSVVLYITGTWRFGWILCDIWISLDILLCSGSILSLCAISLDRYLAVTQPLTYSKKRRSKRLALLMILVVWITALSITCPPYLGWYEVGRHQAEFVDCRYNQNKGYVVFSA 240          

HSP 2 Score: 71.633 bits (174), Expect = 1.252e-12
Identity = 35/74 (47.30%), Postives = 46/74 (62.16%), Query Frame = -2
Query:  627 TAKTLALVVGCFSICWIPFFCVYLVEPFCG--CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVC 842
            TAKTL +V+G    CW+PFF  YL+ PF     ++      F TW+G+VN   NPFIYAFYN ++  AF +L C
Sbjct:  496 TAKTLTIVMGGLIACWLPFFVYYLLIPFLPRPAVLEDLMFGF-TWIGWVNCAINPFIYAFYNPDFRTAFWRLTC 568          
BLAST of SMED30003401 vs. Ensembl Fly
Match: TyrRII (gene:FBgn0038541 transcript:FBtr0083512)

HSP 1 Score: 140.969 bits (354), Expect = 6.358e-35
Identity = 74/151 (49.01%), Postives = 103/151 (68.21%), Query Frame = -2
Query: 1329 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYA-TRRSKKLARCMILAVWILALSVTIPGIFGW---SKHISSTGYCFITFHRGYRLFSA 1769
            +GN++VILAV+TT+RL+TVTN +V++LA +D  V   V+P ++V  I   W    + C +W+S DI LC+ SIL+LC IS+DRY+A+TQPL Y+  RRSK+LA  MIL VWI ALS+T P   GW    +H +    C    ++GY +FSA
Sbjct:   90 VGNTLVILAVLTTRRLRTVTNCFVMNLAITDWLVGTCVMPPSVVLYITGTWRFGWILCDIWISLDILLCSGSILSLCAISLDRYLAVTQPLTYSKKRRSKRLALLMILVVWITALSITCPPYLGWYEVGRHQAEFVDCRYNQNKGYVVFSA 240          

HSP 2 Score: 71.633 bits (174), Expect = 1.252e-12
Identity = 35/74 (47.30%), Postives = 46/74 (62.16%), Query Frame = -2
Query:  627 TAKTLALVVGCFSICWIPFFCVYLVEPFCG--CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVC 842
            TAKTL +V+G    CW+PFF  YL+ PF     ++      F TW+G+VN   NPFIYAFYN ++  AF +L C
Sbjct:  496 TAKTLTIVMGGLIACWLPFFVYYLLIPFLPRPAVLEDLMFGF-TWIGWVNCAINPFIYAFYNPDFRTAFWRLTC 568          
BLAST of SMED30003401 vs. Ensembl Zebrafish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 156.377 bits (394), Expect = 2.742e-41
Identity = 124/388 (31.96%), Postives = 193/388 (49.74%), Query Frame = -2
Query:  630 GNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVA--YKRKLLSSPEPS--KCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNEN----DXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCGCIINPHFVA-FVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1766
            GN+ V+ A+   + LQ V N  + SLA +D+ VS+ VLP+A + Q++  W L  + C +++S DI  CTSSIL+LC I++DRY AIT P+ Y  +R+ K A  +I   W +  S++IP +       S    C I+    Y ++S FC+F IP ++++ +Y RIF  A    RK +  PE    KC     + F   +  +S    + +    E K                            +N  IK  +    L+ I   SNS             ++L  P     V   EN    + + + + A  +E KT KTL +++G F +CW+PFF   LV PFC   + P ++   + WLGY NS+ NP IYA++NK++  AF+K++
Sbjct:   52 GNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLDKWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAALLITVTWFVGFSISIPPMLIMK---SQPKTCMISHDPWYTIYSTFCAFYIPLILMLVLYGRIFKAARFRIRKTVRKPEKKRVKCLTVSPALFKRANGELS----KNWKSAVEPKPAAC------------------------VNGAIKHAEDGESLEIIEVHSNS------------KNNLPLPNTPNSVPLFENKHEKNTEAKRKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFCPTCVMPLWLQDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 396          
BLAST of SMED30003401 vs. Ensembl Zebrafish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 156.377 bits (394), Expect = 2.742e-41
Identity = 124/388 (31.96%), Postives = 193/388 (49.74%), Query Frame = -2
Query:  630 GNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVA--YKRKLLSSPEPS--KCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNEN----DXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCGCIINPHFVA-FVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1766
            GN+ V+ A+   + LQ V N  + SLA +D+ VS+ VLP+A + Q++  W L  + C +++S DI  CTSSIL+LC I++DRY AIT P+ Y  +R+ K A  +I   W +  S++IP +       S    C I+    Y ++S FC+F IP ++++ +Y RIF  A    RK +  PE    KC     + F   +  +S    + +    E K                            +N  IK  +    L+ I   SNS             ++L  P     V   EN    + + + + A  +E KT KTL +++G F +CW+PFF   LV PFC   + P ++   + WLGY NS+ NP IYA++NK++  AF+K++
Sbjct:   52 GNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLDKWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAALLITVTWFVGFSISIPPMLIMK---SQPKTCMISHDPWYTIYSTFCAFYIPLILMLVLYGRIFKAARFRIRKTVRKPEKKRVKCLTVSPALFKRANGELS----KNWKSAVEPKPAAC------------------------VNGAIKHAEDGESLEIIEVHSNS------------KNNLPLPNTPNSVPLFENKHEKNTEAKRKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFCPTCVMPLWLQDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 396          
BLAST of SMED30003401 vs. Ensembl Zebrafish
Match: FP236542.1 (alpha-2B adrenergic receptor-like [Source:NCBI gene;Acc:100330650])

HSP 1 Score: 148.673 bits (374), Expect = 2.509e-38
Identity = 118/414 (28.50%), Postives = 201/414 (48.55%), Query Frame = -2
Query:  627 TIFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTG----YCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQG--YPEKSE----------------KKSVCLLKSPNYNSSEVSVNIV------EQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCG--CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVC 1778
            TIF GN MVI+AV+T + L+   NL+++SLA +D+ V+  V+P ++  ++M  W    L C++ L+ D+  CTSSI++LC IS+DRY++I++P++Y T+R+ +  +  I+ VW+++  ++ P +    K   + G     C +   + Y L+S   SF  P LI+I VY+RI+ +A K       EP K  + +  +  +  +   + AN     P KSE                +   C       +SS   V +V        N     + +V K P +    + I+A S   ++    +     ++ +   + ++ RF                      LA+V+G F ICW PFF  Y ++  C   C +      F  W+GY NS  NP IY  +N+++  AF+K++C
Sbjct:   32 TIF-GNIMVIIAVLTCRSLRGPQNLFLVSLAAADILVATLVIPFSLAKELMGCWYFESLWCEIILALDVLFCTSSIIHLCAISLDRYLSISRPVQYGTQRTPRKIKGAIVVVWLISAIISFPPLVSMDKPQQAKGDPRTTCELNEDKWYILYSTIGSFFAPCLIMILVYVRIYQIAKKHTRCPPGEPRK-DSAVGRELQNGKDGGVDSANNPNIAPSKSEAVKQPPVITESAQKTKRSRRCKENKEESSSSGSDVEVVGGHDANGTNSNMAPLETVNKTPAQSQSYRNIIATSKG-SQLANAKATGTPNTRRKAMIVREKRFTF-------------------VLAVVIGVFIICWFPFFFSYSLQAICPDMCKVPEGLFTFFFWIGYCNSALNPLIYTIFNRDFRKAFKKILC 423          
BLAST of SMED30003401 vs. Ensembl Zebrafish
Match: FP236542.1 (alpha-2B adrenergic receptor-like [Source:NCBI gene;Acc:100330650])

HSP 1 Score: 148.673 bits (374), Expect = 2.509e-38
Identity = 118/414 (28.50%), Postives = 201/414 (48.55%), Query Frame = -2
Query:  627 TIFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTG----YCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQG--YPEKSE----------------KKSVCLLKSPNYNSSEVSVNIV------EQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCG--CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVC 1778
            TIF GN MVI+AV+T + L+   NL+++SLA +D+ V+  V+P ++  ++M  W    L C++ L+ D+  CTSSI++LC IS+DRY++I++P++Y T+R+ +  +  I+ VW+++  ++ P +    K   + G     C +   + Y L+S   SF  P LI+I VY+RI+ +A K       EP K  + +  +  +  +   + AN     P KSE                +   C       +SS   V +V        N     + +V K P +    + I+A S   ++    +     ++ +   + ++ RF                      LA+V+G F ICW PFF  Y ++  C   C +      F  W+GY NS  NP IY  +N+++  AF+K++C
Sbjct:   32 TIF-GNIMVIIAVLTCRSLRGPQNLFLVSLAAADILVATLVIPFSLAKELMGCWYFESLWCEIILALDVLFCTSSIIHLCAISLDRYLSISRPVQYGTQRTPRKIKGAIVVVWLISAIISFPPLVSMDKPQQAKGDPRTTCELNEDKWYILYSTIGSFFAPCLIMILVYVRIYQIAKKHTRCPPGEPRK-DSAVGRELQNGKDGGVDSANNPNIAPSKSEAVKQPPVITESAQKTKRSRRCKENKEESSSSGSDVEVVGGHDANGTNSNMAPLETVNKTPAQSQSYRNIIATSKG-SQLANAKATGTPNTRRKAMIVREKRFTF-------------------VLAVVIGVFIICWFPFFFSYSLQAICPDMCKVPEGLFTFFFWIGYCNSALNPLIYTIFNRDFRKAFKKILC 423          
BLAST of SMED30003401 vs. Ensembl Zebrafish
Match: CR450836.2 (5-hydroxytryptamine (serotonin) receptor 7b [Source:NCBI gene;Acc:565304])

HSP 1 Score: 123.25 bits (308), Expect = 7.488e-30
Identity = 56/147 (38.10%), Postives = 98/147 (66.67%), Query Frame = -2
Query: 1332 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKH-WPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFS 1769
            +GN++V++AV   K+L+  +N  ++SLA +D+ V++ V+P AIVT +    W    + C +++  D+  CT+SI+ LC IS+DRY+ IT+PL Y  R++ +L   MI+ VW+++ S+T+P   GW+ ++++ G C I+   GY L+S
Sbjct:   72 MGNTLVVIAVCVVKKLRQPSNYLLVSLAIADLSVAVAVMPFAIVTDLTGGVWLFGEVFCNIFIGMDVMCCTASIMTLCVISVDRYLGITRPLTYPARQNGQLMAKMIVGVWLVSASITLPPFCGWAHNVNTAGVCLISQDVGYTLYS 218          

HSP 2 Score: 67.0106 bits (162), Expect = 2.381e-11
Identity = 33/74 (44.59%), Postives = 47/74 (63.51%), Query Frame = -2
Query:  630 AKTLALVVGCFSICWIPFFCVYLVEPF-CGCIIN--PHFVAFVT-WLGYVNSIFNPFIYAFYNKEYALAFRKLV 839
            A TL +++G FS CW+PFF      PF CG + N  P ++  V  WLGY NS+ NPFIYAF+N++    ++ L+
Sbjct:  297 ATTLGVIMGVFSFCWLPFFLFTTARPFICGLLCNCAPVWLERVLLWLGYTNSLMNPFIYAFFNRDLRSTYKDLL 370          
BLAST of SMED30003401 vs. Ensembl Xenopus
Match: ENSXETT00000046867.1 (5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled [Source:NCBI gene;Acc:100488829])

HSP 1 Score: 177.948 bits (450), Expect = 7.882e-49
Identity = 128/431 (29.70%), Postives = 217/431 (50.35%), Query Frame = -2
Query:  630 TMNYTENNNQTNEISSFNQXXXXXXXXXXXXXIEGTIFI----GNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWS--KHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSV------CLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCGCIINPHFV-AFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1883
             +N T +++ T E  +  +  + +    +     GT+ +    GN+ VI A+   + LQTV N  + SLA +D+ VS+ VLP+A   Q++  W L  + C +++S D+  CTSSIL+LC I++DRY AIT P+ Y  +R+ + A  +I   WI+  S++IP + GW   +  S    C I+   GY ++S F +F IP ++++ +Y +IF  A  R  +          ++     S S +++   + G P K+ K++V      C+  +  +      + I+E +++     S + +P                            H +   P  +K   N+     + + A  +E KT KTL +++G F  CW+PFF V LV PFC     PH +   + WLGY NS+ NP IYA++NK++  AF+K++
Sbjct:    3 ALNNTTSSDHTPETGNVTEEEVALSYQIVTSLFLGTLILCAIFGNACVIAAIALERCLQTVANYLIGSLAVTDLMVSVLVLPMAAHNQVLNKWTLGQVTCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISITWIVGFSISIPPMLGWRTPEDRSDPNACKISEDPGYTIYSTFGAFYIPLILMLVLYGKIFKAARFR--IRKTVKKAEKKKVADTCLSVSPAVAERKSNGEPSKNWKRTVEPKPSACVNGAIRHGEDGAVLEIIEVHHY-VNSKSHLDLPNH-------------------------AHDMAVAPCSEK--RNDRATDAKRKVALARERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCETCHMPHLLFDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 403          
BLAST of SMED30003401 vs. Ensembl Xenopus
Match: ADRA2B (adrenoceptor alpha 2B [Source:NCBI gene;Acc:100485811])

HSP 1 Score: 148.288 bits (373), Expect = 3.264e-38
Identity = 121/400 (30.25%), Postives = 205/400 (51.25%), Query Frame = -2
Query:  603 TIFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIF--GWSKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEP--SKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYF--RFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCG--CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVCVSK*TFHW 1778
            TIF GN +VI+AV+T++ L+   NL+++SLA +D+ V+  ++P ++  ++M +W      C+++L+ D+  CTSSI++LC IS+DRY +++Q ++Y ++R+ K  +C+IL VW LA  +++P +   G SK  ++   C +     Y L S+ CSF  P LI+I VY+RI+ +A +R   +S +    K    + S  + +S + S+   Q     S++K+   L   +     +S    E+N     F +    +  K  N  +  + D+ +  + V +       S      KKK   N   +                 LA+V+G F +CW PFF  Y +   C   C I      F  W+GY NS  NP IY  +N+++  AFR+++C      HW
Sbjct:   31 TIF-GNVLVIIAVLTSRSLKAPQNLFLVSLAAADILVATLIIPFSLANELMGYWYFGKTWCEMYLALDVLFCTSSIVHLCAISLDRYWSVSQAIEYNSKRTPKRIKCIILIVWTLAALISLPPLIYKGKSKDQNAKPECKLNEEPWYILSSSICSFFAPCLIMILVYLRIYLIAKRRNRKNSTDKKLKKMAPGLFSRTNKHSLNSSHTQTQCGIISSQEKTGLALDDLHCGVPVLSSTREERNGHSESFGLQPQGENLKHTNGCEPAVMDTVATVKGVMLMPKGAKDS-DLSSAKKKSYINREKRFTF-------------VLAVVIGVFVLCWFPFFFTYSLGAICTELCYIPDSVFQFFFWIGYCNSSLNPVIYTIFNQDFRKAFRRILCS-----HW 410          
BLAST of SMED30003401 vs. Ensembl Xenopus
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 118.242 bits (295), Expect = 2.763e-28
Identity = 61/146 (41.78%), Postives = 89/146 (60.96%), Query Frame = -2
Query: 1332 GNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFI-TFHRGYRLFS 1766
             N+ VI  V  T++L T  N  + SLAF+D+ VSI VLP+AIV  +   W L  + C +WLSSDI  CT+SIL+LC I++DRY AIT  ++Y  +R+ K A  MI  VW+ ++S+++P +F           C + T H  Y ++S
Sbjct:   35 SNAFVITTVYQTRKLHTPANYLIASLAFTDLLVSILVLPIAIVYTVTGKWTLGQIICDMWLSSDITCCTASILHLCVIALDRYWAITDAVEYTKKRTPKRAVVMIALVWVFSISISMPPLFWRQSKAEEIAVCAVNTDHILYTVYS 180          

HSP 2 Score: 74.7146 bits (182), Expect = 1.084e-13
Identity = 31/71 (43.66%), Postives = 45/71 (63.38%), Query Frame = -2
Query:  630 KTLALVVGCFSICWIPFFCVYLVEPFC--GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 836
            KTL +++G + +CW+PFF + LV P C   C  +P    F  WLGY+NS+ NP IY   N+++  AF KL+
Sbjct:  281 KTLGVILGAYIVCWLPFFIISLVMPICKDACWFHPAIFDFFNWLGYLNSLINPIIYTMSNEDFKQAFHKLI 351          
BLAST of SMED30003401 vs. Ensembl Xenopus
Match: krcc1 (lysine-rich coiled-coil 1 [Source:Xenbase;Acc:XB-GENE-1016025])

HSP 1 Score: 119.398 bits (298), Expect = 3.972e-28
Identity = 109/416 (26.20%), Postives = 183/416 (43.99%), Query Frame = -2
Query:  579 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSK-KLARCMILAVWILALSVTIPGIFGW----SKHISSTGYCFIT-FHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIAN-QGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPK--KMNFLQRILADSNSITETVTVQLVCVGHSLQ--------FPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFC--GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVCVSK*TFHWQWKFYQCF 1769
            +GN++V+LA +    L+T  N ++++LA SD FV    +PL +   +   W      CKLWL  D  LCTSS+ N+  IS DR++++T+ + Y  ++S  + A   +  VWILA  +  P I  W       I   G CF   F+  Y L +A         I +  +    ++  +++            + + D    + S +N  N +  PEK+   S+   K             + Q   RF  +   K  K  +   ++R+     +     TV  +    S +         P L+KK+R         +R    ++ K AK+LA++V  F +CW P+  + ++   C   C+ N  + A   WL +VNS  NP +Y   +  +  AFRK++C  K       KF+ C+
Sbjct:   42 LGNALVMLAFVVDSSLRTQNNYFLLNLAISDFFVGALCIPLYVPYVLTGRWGFGRSVCKLWLVLDYLLCTSSVFNIVLISYDRFISVTRAVSYRAQQSNSRHAVLKMTMVWILAFLLYGPAIITWEYIAGGSIIPDGECFAEFFYNWYFLMTASTLEFFTPFISVTYFNVSIYMNIQKR-----------TKARLDLLQEAQSHTNTDNIKAPPEKARSSSLKCWK-------------LHQKMARFGGSDHQKTIKLTESEMMERVRGMKRNSLNGSTVTAMGKSRSARRSFNESSSTPSLEKKMRVVSQG--IAQRFRLSRDKKVAKSLAVIVCAFGLCWAPYTLLMIIRAACRGHCVPNYWYEASF-WLLWVNSAVNPILYPLCHNSFKRAFRKILCPQKLKLKANGKFHYCW 430          
BLAST of SMED30003401 vs. Ensembl Xenopus
Match: exd2 (exonuclease 3'-5' domain containing 2 [Source:Xenbase;Acc:XB-GENE-5752408])

HSP 1 Score: 117.857 bits (294), Expect = 1.309e-27
Identity = 55/146 (37.67%), Postives = 96/146 (65.75%), Query Frame = -2
Query: 1332 GNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMK-HWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFS 1766
            GN +V+++V   K+L+  +N  ++SLA +D+ V+I V+P   VT ++   W    + C ++++ D+  CT+SI+ LC ISIDRY+ IT+PL Y  R++ +    MIL VW+L+ S+T+P +FGW+++++    C I+   GY ++S
Sbjct:   95 GNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAIAVMPFVSVTDLIGGEWIFGHVFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGRCMAKMILCVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYS 240          

HSP 2 Score: 70.0922 bits (170), Expect = 4.148e-12
Identity = 34/77 (44.16%), Postives = 47/77 (61.04%), Query Frame = -2
Query:  630 TAKTLALVVGCFSICWIPFFCVYLVEPF-----CGCIINPHFVAFV-TWLGYVNSIFNPFIYAFYNKEYALAFRKLV 842
             A TL ++VG F+ICW+PFF +    PF     C CI  P ++     WLGY NS+ NPFIYAF+N++    +R L+
Sbjct:  323 AATTLGIIVGAFTICWLPFFLLSTARPFICGTECSCI--PLWLERTFLWLGYANSLINPFIYAFFNRDLRTTYRNLL 397          
BLAST of SMED30003401 vs. Ensembl Mouse
Match: Drd3 (dopamine receptor D3 [Source:MGI Symbol;Acc:MGI:94925])

HSP 1 Score: 144.821 bits (364), Expect = 7.247e-37
Identity = 119/424 (28.07%), Postives = 208/424 (49.06%), Query Frame = -2
Query:  630 IFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKH-WPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLAR---CMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKR---KLLSS------------PEPSKCFN-------RIKSDFHS-YSNSISNIANQGYPEKSEKKSVCLLK--SPNYNSSEVSVNIVEQNYFRFQINSVIKMP--KKMNFLQRILADSNSITETVTVQLVC---------VGHSLQFPPLK-KKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFC-GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1775
            I  GN +V  AV+  + LQT TN  V+SLA +D+ V+  V+P  +  ++    W  + + C ++++ D+ +CT+SILNLC ISIDRY A+  P+ Y     +   R    MI AVW+LA +V+ P +FG++        C I+ +  + ++S+  SF +PF + + VY RI+ V  +R   ++L+             P+ S C          I++ F S  +  + +I ++ YP+K +   +  L+  SP     E+      + Y+    ++ ++ P  +    + ++    NS++ T+  +L           +  SL+  PL+ + V   E                  + + +V+G F +CW+PFF  +++   C  C ++P      TWLGYVNS  NP IY  +N E+  AF K++
Sbjct:   43 IIFGNGLVCAAVLRERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNT-TGDPSICSIS-NPDFVIYSSVVSFYVPFGVTVLVYARIYMVLRQRRRKRILTRQNSQCISIRPGFPQQSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKPYPQKCQDPLLSHLQPLSPGQTHGEL------KRYYSICQDTALRHPNFEGGGGMSQVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKK--------------ATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYVNSALNPVIYTTFNIEFRKAFLKIL 444          
BLAST of SMED30003401 vs. Ensembl Mouse
Match: Drd3 (dopamine receptor D3 [Source:MGI Symbol;Acc:MGI:94925])

HSP 1 Score: 145.206 bits (365), Expect = 8.371e-37
Identity = 119/424 (28.07%), Postives = 208/424 (49.06%), Query Frame = -2
Query:  630 IFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKH-WPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLAR---CMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKR---KLLSS------------PEPSKCFN-------RIKSDFHS-YSNSISNIANQGYPEKSEKKSVCLLK--SPNYNSSEVSVNIVEQNYFRFQINSVIKMP--KKMNFLQRILADSNSITETVTVQLVC---------VGHSLQFPPLK-KKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFC-GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1775
            I  GN +V  AV+  + LQT TN  V+SLA +D+ V+  V+P  +  ++    W  + + C ++++ D+ +CT+SILNLC ISIDRY A+  P+ Y     +   R    MI AVW+LA +V+ P +FG++        C I+ +  + ++S+  SF +PF + + VY RI+ V  +R   ++L+             P+ S C          I++ F S  +  + +I ++ YP+K +   +  L+  SP     E+      + Y+    ++ ++ P  +    + ++    NS++ T+  +L           +  SL+  PL+ + V   E                  + + +V+G F +CW+PFF  +++   C  C ++P      TWLGYVNS  NP IY  +N E+  AF K++
Sbjct:   75 IIFGNGLVCAAVLRERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNT-TGDPSICSIS-NPDFVIYSSVVSFYVPFGVTVLVYARIYMVLRQRRRKRILTRQNSQCISIRPGFPQQSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKPYPQKCQDPLLSHLQPLSPGQTHGEL------KRYYSICQDTALRHPNFEGGGGMSQVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKK--------------ATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYVNSALNPVIYTTFNIEFRKAFLKIL 476          
BLAST of SMED30003401 vs. Ensembl Mouse
Match: Htr7 (5-hydroxytryptamine (serotonin) receptor 7 [Source:MGI Symbol;Acc:MGI:99841])

HSP 1 Score: 117.087 bits (292), Expect = 4.206e-28
Identity = 55/146 (37.67%), Postives = 96/146 (65.75%), Query Frame = -2
Query: 1332 GNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMK-HWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFS 1766
            GN +V+++V   K+L+  +N  ++SLA +D+ V++ V+P   VT ++   W      C ++++ D+  CT+SI+ LC ISIDRY+ IT+PL Y  R++ K    MIL+VW+L+ S+T+P +FGW+++++    C I+   GY ++S
Sbjct:  101 GNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYS 246          
BLAST of SMED30003401 vs. Ensembl Mouse
Match: Htr1a (5-hydroxytryptamine (serotonin) receptor 1A [Source:MGI Symbol;Acc:MGI:96273])

HSP 1 Score: 118.242 bits (295), Expect = 6.082e-28
Identity = 55/148 (37.16%), Postives = 91/148 (61.49%), Query Frame = -2
Query: 1332 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWS--KHISSTGYCFITFHRGYRLFS 1769
            +GN+ V+ A+   + LQ V N  + SLA +D+ VS+ VLP+A + Q++  W L  + C L+++ D+  CTSSIL+LC I++DRY AIT P+ Y  +R+ + A  +I   W++   ++IP + GW   +  S+   C I+   GY ++S
Sbjct:   52 LGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSNPNECTISKDHGYTIYS 199          

HSP 2 Score: 81.6481 bits (200), Expect = 6.873e-16
Identity = 41/93 (44.09%), Postives = 60/93 (64.52%), Query Frame = -2
Query:  630 RFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFC--GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 902
            R NE   + + + A  +E KT KTL +++G F +CW+PFF V LV PFC   C +     A + WLGY NS+ NP IYA++NK++  AF+K++
Sbjct:  323 RKNERTAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of SMED30003401 vs. Ensembl Mouse
Match: Htr7 (5-hydroxytryptamine (serotonin) receptor 7 [Source:MGI Symbol;Acc:MGI:99841])

HSP 1 Score: 118.627 bits (296), Expect = 6.451e-28
Identity = 55/146 (37.67%), Postives = 96/146 (65.75%), Query Frame = -2
Query: 1332 GNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMK-HWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFS 1766
            GN +V+++V   K+L+  +N  ++SLA +D+ V++ V+P   VT ++   W      C ++++ D+  CT+SI+ LC ISIDRY+ IT+PL Y  R++ K    MIL+VW+L+ S+T+P +FGW+++++    C I+   GY ++S
Sbjct:  101 GNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYS 246          

HSP 2 Score: 70.4774 bits (171), Expect = 2.643e-12
Identity = 34/77 (44.16%), Postives = 47/77 (61.04%), Query Frame = -2
Query:  630 TAKTLALVVGCFSICWIPFFCVYLVEPF-----CGCIINPHFVAFV-TWLGYVNSIFNPFIYAFYNKEYALAFRKLV 842
             A TL ++VG F++CW+PFF +    PF     C CI  P +V     WLGY NS+ NPFIYAF+N++    +R L+
Sbjct:  328 AATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCI--PLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLL 402          
BLAST of SMED30003401 vs. UniProt/SwissProt
Match: sp|Q25188|OAR_HELVI (Octopamine receptor OS=Heliothis virescens OX=7102 PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 4.560e-55
Identity = 136/415 (32.77%), Postives = 212/415 (51.08%), Query Frame = -2
Query:  624 TIFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKH---ISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKS--------DFHSYSNSISNIANQGYPE-------KSEKKSVCLLKSPNYNSSEV--SVNIVEQNYFRFQI----NSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKT-----AKTLALVVGCFSICWIPFFCVYLVEPFCG-CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVCV 1778
            +  +GN +VIL+V T K L+ V N +++SLA +D+ V+I VLPL +   I+  W      CK+WL+ DI  CTSSILNLC I++DRY AIT P+ YA +R+ +    MI  VW+L+L ++ P + GW+           C +T   G+ +FS+        L+I+ V     ++A K++L    + +K  + I S        D H   +S+S+ AN    +        +EKK      +P         S +   QN     I    NSV  M +  N   R  +  ++  ET    L+ V  ++      KK + N+     +     ++   T     A+TL +++G F +CW+PFF +YLV PFC  C ++  F+ F+TWLGY NS  NP IY  +N ++  AF+KL+C+
Sbjct:   65 STIVGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVAILVLPLNVAYSILGQWVFGIYVCKMWLTCDIMCCTSSILNLCAIALDRYWAITDPINYAQKRTLERVLLMIGVVWVLSLIISSPPLLGWNDWPDVFEPDTPCRLTSQPGFVIFSS-SGSFYIPLVIMTVVYFEIYLATKKRLRDRAKATK-ISTISSGQNKYNNKDDHHDQDSVSSEANHNEHQGVTRLVSDNEKKKRTRKLTPKKKPKRKYWSKDDKSQNKLIIPILSNENSVTDMGE--NLENRNTSSESNSKETHEDDLIEVNETVPVKTHHKKPKPNQQSAVYQFIEEKQRISLTRERRAARTLGIIMGVFVVCWLPFFVIYLVIPFCASCCLSNKFINFITWLGYCNSALNPLIYTIFNMDFRRAFKKLLCM 475          
BLAST of SMED30003401 vs. UniProt/SwissProt
Match: sp|Q17232|OAR_BOMMO (Octopamine receptor OS=Bombyx mori OX=7091 PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 8.824e-52
Identity = 132/419 (31.50%), Postives = 217/419 (51.79%), Query Frame = -2
Query:  630 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWS---KHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKM----------NFLQRILADSNSIT------------------ETVTVQLVCVGHSLQFPPLKKKVRFNENDX-------XXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFC-GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1769
            +GN +VIL+V T K L+ V N +++SLA +D+ V+I VLPL +   I+  W      CK+WL+ DI  CTSSILNLC I++DRY AIT P+ YA +R+ +    MI  VWIL+L ++ P + GW+   +       C +T   G+ +FS+        L+I+ V     ++A K++L    + +K  + I S  + Y    S        + +++ SV    +PN +     +    +   R +  +  K PK+             +  IL++ NS+T                  ET    ++ +  +    P+K + R  +N         ++++R +  +E + A+TL +++G F +CW+PFF +YLV PFC  C ++  F+ F+TWLGYVNS  NP IY  +N ++  AF+KL+
Sbjct:   70 VGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVAILVLPLNVAYSILGQWVFGIYVCKMWLTCDIMCCTSSILNLCAIALDRYWAITDPINYAQKRTLERVLFMIGIVWILSLVISSPPLLGWNDWPEVFEPDTPCRLTSQPGFVIFSS-SGSFYIPLVIMTVVYFEIYLATKKRLRDRAKATK-ISTISSGRNKYETKES--------DPNDQDSVSSDANPNEHQGGTRLVAENEKKHRTRKLTPKKKPKRRYWSKDDKSHNKLIIPILSNENSVTDIGENLENRNTSSESNSKETHEDNMIEITEA---APVKIQKRPKQNQTNAVYQFIEEKQRISLTRERRAARTLGIIMGVFVVCWLPFFVIYLVIPFCVSCCLSNKFINFITWLGYVNSALNPLIYTIFNMDFRRAFKKLL 475          
BLAST of SMED30003401 vs. UniProt/SwissProt
Match: sp|Q9N298|5HT1A_PANTR (5-hydroxytryptamine receptor 1A OS=Pan troglodytes OX=9598 GN=HTR1A PE=3 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 5.714e-49
Identity = 126/395 (31.90%), Postives = 200/395 (50.63%), Query Frame = -2
Query:  630 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWS--KHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKV-----------RFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFC--GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1769
            +GN+ V+ A+   + LQ V N  + SLA +D+ VS+ VLP+A + Q++  W L  + C L+++ D+  CTSSIL+LC I++DRY AIT P+ Y  +R+ + A  +I   W++   ++IP + GW   +  S    C I+   GY ++S F +F IP L+++        V Y R   ++        RI+        + ++  +   P +  KKSV        N    S N      +R  + S        N   R   D  +  E + V    VG+S +  PL  +            R NE + + + + A  +E KT KTL +++G F +CW+PFF V LV PFC   C +     A + WLGY NS+ NP IYA++NK++  AF+K++
Sbjct:   52 LGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLML--------VLYGRIFRAA------RFRIRKTVKKVEKTGADTRHGASPAQQPKKSV--------NGESGSRN------WRLGVESKAGGALCANGAVR-QGDDGAALEVIEVHR--VGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of SMED30003401 vs. UniProt/SwissProt
Match: sp|P08908|5HT1A_HUMAN (5-hydroxytryptamine receptor 1A OS=Homo sapiens OX=9606 GN=HTR1A PE=1 SV=3)

HSP 1 Score: 179.874 bits (455), Expect = 1.226e-48
Identity = 126/395 (31.90%), Postives = 199/395 (50.38%), Query Frame = -2
Query:  630 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWS--KHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKV-----------RFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFC--GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1769
            +GN+ V+ A+   + LQ V N  + SLA +D+ VS+ VLP+A + Q++  W L  + C L+++ D+  CTSSIL+LC I++DRY AIT P+ Y  +R+ + A  +I   W++   ++IP + GW   +  S    C I+   GY ++S F +F IP L+++        V Y R   ++        RI+        + ++  +   P    KKSV        N    S N      +R  + S        N   R   D  +  E + V    VG+S +  PL  +            R NE + + + + A  +E KT KTL +++G F +CW+PFF V LV PFC   C +     A + WLGY NS+ NP IYA++NK++  AF+K++
Sbjct:   52 LGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLML--------VLYGRIFRAA------RFRIRKTVKKVEKTGADTRHGASPAPQPKKSV--------NGESGSRN------WRLGVESKAGGALCANGAVR-QGDDGAALEVIEVHR--VGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of SMED30003401 vs. UniProt/SwissProt
Match: sp|Q9N297|5HT1A_GORGO (5-hydroxytryptamine receptor 1A OS=Gorilla gorilla gorilla OX=9595 GN=HTR1A PE=3 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.369e-48
Identity = 126/395 (31.90%), Postives = 199/395 (50.38%), Query Frame = -2
Query:  630 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWS--KHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKV-----------RFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFC--GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1769
            +GN+ V+ A+   + LQ V N  + SLA +D+ VS+ VLP+A + Q++  W L  + C L+++ D+  CTSSIL+LC I++DRY AIT P+ Y  +R+ + A  +I   W++   ++IP + GW   +  S    C I+   GY ++S F +F IP L+++        V Y R   ++        RI+        + ++  +   P    KKSV        N    S N      +R  + S        N   R   D  +  E + V    VG+S +  PL  +            R NE + + + + A  +E KT KTL +++G F +CW+PFF V LV PFC   C +     A + WLGY NS+ NP IYA++NK++  AF+K++
Sbjct:   52 LGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLML--------VLYGRIFRAA------RFRIRKTVKKVEKTGADTRHGASPAPQPKKSV--------NGESGSRN------WRLGVESKAGGALCANGAVR-QGDDGAALEVIEVHR--VGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of SMED30003401 vs. TrEMBL
Match: A0A193KU59 (GCR011 OS=Schmidtea mediterranea OX=79327 GN=gcr011 PE=2 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 2.477e-69
Identity = 163/395 (41.27%), Postives = 240/395 (60.76%), Query Frame = -2
Query:  618 IFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVA-YKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVI-KMP-KKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCGC-IINPH-----FVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVCVSK 1775
            IF GNS++++AV+TT+ LQTVTN YV+SLA +D+ VS  VLPL I  ++   W L    C+ W+S DI LCT+SILNLCCISIDRYMAIT+PL YAT+RS KLA CMIL  WIL++ +++P + GWS H  +   C I+ H G+R++S+  SF IP +++IFVY+RIF +A Y++ LL+S + S+     K+  +S S    +        +  ++++ L  +P +  +              ++NS + + P  +   LQ ++  S ++     +   C   S     L +  +  E        AAF +EHKTAK +A+V+GCF +CW+PFF +Y++E  C   I+ P+      V  VTWLGY+NS  NPF+YAFYNKEYA  F+K++   K
Sbjct:   20 IFCGNSLILIAVLTTRHLQTVTNFYVVSLALADLLVSGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILSVIISVPPVIGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQSSRNIKSNKNSSNSLSYKSLDFQTSNPSSQQRRQALDLESNPKHAQA-------------LKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLS---SGLSQSQKGKET-------AAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTFKKILSCKK 391          
BLAST of SMED30003401 vs. TrEMBL
Match: A0A0L8GS86 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22028857mg PE=3 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 1.717e-59
Identity = 154/387 (39.79%), Postives = 215/387 (55.56%), Query Frame = -2
Query:  633 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISS-TGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILA------DSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFC-GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKL 1769
            IGN ++ILAV   +RL+TVTN +V+SLA +D+ VSI VLPL I  ++   W  + L C LW+S D+ LCT+SILNLCCIS+DRY AIT+PL Y+TRRSK+LA  M+   W LA  +T P I GW +        C +T   GY ++SA  SF IP  +++FVY RI+ VA KR+            R++  + S+ +S     +    E           SP   ++  + +I   + F+ +  S    P K N   +  +      +S+S T      ++    +L     +K+   N N     ER+ + KE KTAKTLA+VVGCF ICW+PFF VY+++ FC  C I P   + +TWLGY NS  NP IYA YN  +  AF  L
Sbjct:  107 IGNVLIILAVWKYRRLRTVTNCFVVSLASADLLVSILVLPLNITVEVTGQWLFSGLLCDLWVSCDVLLCTASILNLCCISLDRYFAITKPLLYSTRRSKRLAIFMVGVAWGLAAIITCPPILGWKEEGRDLANGCALTRDPGYIIYSASGSFFIPLFVMLFVYARIYHVARKRE-----------KRLRPYWRSFFSSRQKRCDSDNSEN---------MSPTTEAT-TTKHIRSNSSFKAEHKSETS-PSKNNISNKTFSVGHSERNSSSWTNIFRKDIILEKQTLMLSLFRKQTELNRNK---VERSFYMKERKTAKTLAIVVGCFIICWLPFFLVYVIDVFCTTCNITPTLFSIITWLGYFNSTLNPLIYAMYNTTFRTAFWNL 468          
BLAST of SMED30003401 vs. TrEMBL
Match: A0A336M3E9 (CSON011043 protein OS=Culicoides sonorensis OX=179676 GN=CSON011043 PE=3 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 6.040e-58
Identity = 151/402 (37.56%), Postives = 232/402 (57.71%), Query Frame = -2
Query:  627 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYA-TRRSKKLARCMILAVWILALSVTIPGIFGW---SKHISSTGY-CFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRK-LLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKS--PNYNSSEVSVNIVEQNYFRFQINSV----------IKMPKKMNFLQRILADSNSITETVTVQLVCVGHS--LQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFC-GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVC 1769
            IGN++VIL+VMTT+RL+TVTN +V+SLA +D  V + V+P A+   I+  W L  + C +W+S D+ LCT+SIL+LC IS+DRY+A+TQP+ Y+  RRSK+LA  MIL VWI+AL++T P  FGW    K  SS  + C    ++GY +FSA  SF IP  ++++VY +IF+V   R+  +S  E S+    I+ + ++ S + ++ A+     KS   +     S     NS      +V+ N  R  I S+          +K    + F Q  L+ ++S   T   ++   G+   ++   L+++ +                   TA+TL++VVG F ICW+PFF  YL+ PF     I+   ++F+TWLG++NS  NPFIYAFYN ++ +AF +L C
Sbjct:   98 IGNTLVILSVMTTRRLRTVTNCFVMSLAMADWLVGVTVMPPAVFLYIVGTWRLGWILCDIWISLDVLLCTASILSLCAISVDRYLAVTQPITYSKKRRSKRLACFMILIVWIIALAITCPPYFGWYDSKKRFSSDMFNCHYNQNKGYVVFSAMGSFFIPMTVMLYVYSKIFYVLMSRQNRMSKTEVSERTYEIEPENYT-SEAETSAASPRLLAKSSNSTSNFASSQLEKDNSHHTLYELVDLNKSRPSIRSLPNSTKYSCNPLKPYHSVQFTQSQLSINDSCLSTSRFKIHSHGNRIPIRISSLRRETK-------------------TAQTLSMVVGGFVICWLPFFICYLLMPFVKAGTISEDLMSFLTWLGWLNSAINPFIYAFYNTDFRIAFWRLTC 479          
BLAST of SMED30003401 vs. TrEMBL
Match: A0A1B0CD97 (Tyramine receptor OS=Lutzomyia longipalpis OX=7200 PE=3 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 2.372e-57
Identity = 149/392 (38.01%), Postives = 229/392 (58.42%), Query Frame = -2
Query:  633 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYA-TRRSKKLARCMILAVWILALSVTIPGIFGW-SKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXF-WVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKM---PKKMNFLQRI--LADSNSITETVTVQLVCVG---HSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCG--CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKL 1769
            IGN++VIL+V+TT+RL+TVTN +V+SLA +D  V +FV+P A+   +M  W L  + C +W+S D+ LCT+SIL+LC ISIDRY+A+TQPL Y+  RRSK+LA  MIL VW+LAL++T P I GW  +   S+  C    ++GY +FSA  SF IP +++I+VY+RI   VA +   ++  E  K + +   +   Y +   + + Q  P     +S   L   +  +   S   ++++  +   N + ++     +   L+R   L      TET + Q        H+  F  + K++R ++         + ++E+KT +TL++VVG F  CW+PFF  YL+ PF      INP  V F+TWLG+ NS  NPFIYAFY+ ++  AF +L
Sbjct:  104 IGNTLVILSVITTRRLRTVTNCFVMSLAVADWLVGLFVMPPAVAVHLMGSWELGRVLCDIWISLDVLLCTASILSLCAISIDRYLAVTQPLNYSRRRRSKRLALLMILVVWVLALAITCPPILGWYEQGRGSSVECRYNQNQGYVVFSAMGSFFIPMIVMIYVYMRISCVVASRHDHMAEIEVPKKYQKNNPEAEIYLD--HDTSEQEPPSPKRSQSFGQLSKRDLFTKTNSAEDIDRSTTKQSRNGLYELVDCSSRTPSLKRYAGLPPKQPTTETWSNQFSANSKDVHTSGF-AISKQIRVHQKS-MSNRILSLKRENKTTQTLSIVVGGFIACWLPFFICYLITPFLSERIKINPILVGFLTWLGWFNSAVNPFIYAFYSVDFRTAFWRL 491          
BLAST of SMED30003401 vs. TrEMBL
Match: A0A1Z2RSG6 (Tyramine receptor OS=Nilaparvata lugens OX=108931 GN=TyR2 PE=2 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 9.083e-57
Identity = 147/396 (37.12%), Postives = 227/396 (57.32%), Query Frame = -2
Query:  618 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYA-TRRSKKLARCMILAVWILALSVTIPGIFG---WSKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIA---NQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFC--GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV---CVSK 1769
            +GN+++I+AV+TT+RL+TVTN +V+SLA +D  V IFV+P+A+   IM  W +  + C +W+S D+ LCT+SIL+LC ISIDRY AITQPL Y   RRSK+LA  MIL VW+ A+++T P IFG   W +H + T  C  + ++ Y + SA  SF +P  ++I+VY RI W   +R +               +  + +N  ++ A   N  +     K+ V               N+ E +  R + + V++  + M  L   +     +T T  +     G S++     +++RF ++       ++F++E KTA+TL++VVG F  CW+PFF  Y+V PF   G I N   + F+TWLG++NS  NPFIYAFY+ ++ LAF +L    C S+
Sbjct:   25 VGNTLIIVAVVTTRRLRTVTNCFVMSLAVADWLVGIFVMPVAVAYHIMGSWEMGRILCDVWISLDVGLCTASILSLCAISIDRYFAITQPLNYTRRRRSKRLALIMILVVWVAAVAITCPPIFGWYDWERHKNKT--CIYSQNKSYVVVSAMLSFFVPLTVMIYVYARISWEIAQRHV---------------NLDAMNNGAAHSAATHNNHHIRTYSKRCVA--------------NLEESDQERSESDDVVRAGRLMPPLTMPV-----VTPTGVISANSSGRSVES---SRRLRFGDS---ATRVSSFKRESKTAQTLSIVVGGFIACWLPFFVAYIVNPFLDNGTIGN-WLMTFLTWLGWLNSAINPFIYAFYSPDFRLAFWRLTLRHCTSR 377          
BLAST of SMED30003401 vs. Ensembl Cavefish
Match: htr7a (5-hydroxytryptamine receptor 7-like [Source:NCBI gene;Acc:103024740])

HSP 1 Score: 154.836 bits (390), Expect = 3.418e-40
Identity = 110/388 (28.35%), Postives = 193/388 (49.74%), Query Frame = -2
Query:  630 GNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMK-HWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNI----VEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPF-CG--CIINPHFVA-FVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1766
            GN +V+++V   K+L+  +N  ++SLA +D+ V++ V+P   +T ++   W      C ++++ D+  CT+SI+ LC ISIDRY+ IT+PL Y  R++      M+L+VW+L+ S+T+P +FGW+++++    C I+   GY ++S      + F I + V + +++  Y+   LS+ +                     I     PEK+ +  V   +    + SEVS  +    V     R ++    ++P+    L R +   +S  +++++              K++ +                    A TL +VVG FS CW+PFF +    PF CG  C   P +V   + WLGY NS+ NPFIYAF+N++    +R L+
Sbjct:  131 GNVLVLVSVCFVKKLRQPSNYLIVSLALADLSVALAVMPFVSITDLIGGRWIFGQFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGWCMAKMVLSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYS----TAVAFYIPMTVMLIMYYRIYRAAKLSAAK-------------------HTITGFPRPEKNRQDEVDEDEEDPGDGSEVSTGVDCVTVAMKLHR-EVEECARLPR----LLRGIGGGSSDRKSISI-------------FKREQK-------------------AAATLGVVVGAFSFCWLPFFLLSTTRPFVCGTECSCVPLWVERTLLWLGYANSLINPFIYAFFNRDLRTTYRSLL 458          
BLAST of SMED30003401 vs. Ensembl Cavefish
Match: adra2b (adrenoceptor alpha 2B [Source:NCBI gene;Acc:266751])

HSP 1 Score: 148.288 bits (373), Expect = 2.110e-38
Identity = 111/391 (28.39%), Postives = 191/391 (48.85%), Query Frame = -2
Query:  627 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTG----YCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQ----LVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCG--CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVC 1769
            +GN +VI+AV+T++ L+   NL+++SLA +D+ V+  ++P ++  ++M  W    + C+++L+ D+  CTSSI++LC IS+DRY++I++ + Y  +R+ +  +C IL VW+++  ++ P +   +K   +       C +   R Y L+S   SF  P LI+I VY+RI+ +A +R      EP K    I +       +     N   P           K P+ N+ E S +  +      Q     +MP     +      S  I    T+Q    ++      +    K K     N  +++      K       LA+V+G F +CW PFF  Y ++  C   C +      F  W+GY NS  NP IY  +NK++  AF+K++C
Sbjct:   36 VGNILVIIAVLTSRSLRGPQNLFLVSLAAADILVATLIIPFSLANELMGFWYFKSVWCEIYLALDVLFCTSSIVHLCAISLDRYLSISRAVTYGAQRTPRRIKCAILIVWLISAVISFPPLLSMNKKKGTDEAGCPQCELNNERWYILYSTIGSFFAPCLIMILVYMRIYQIAKQRTRCPPGEPRK---EIPASAKQQPATTPTTNNLLPPPSLGTALTPPDKKPDNNNGESSTSDSDTE----QGGVGTEMP-----MTPSGEPSAGIHSPATIQKYRDMIATAKGTRLASRKSKQDGTPNSARRKAMVNREKRFTFV--LAVVIGVFVVCWFPFFFSYSLQAVCPRTCNLPEPLFKFFFWIGYCNSCLNPVIYTIFNKDFRRAFKKILC 412          
BLAST of SMED30003401 vs. Ensembl Cavefish
Match: adra2a (adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750])

HSP 1 Score: 143.28 bits (360), Expect = 7.260e-37
Identity = 111/385 (28.83%), Postives = 181/385 (47.01%), Query Frame = -2
Query:  627 GNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIP--GIFGWSKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVV--GCFSICWIPFFCVYLVEPFC-GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVC 1766
            GN + ++AV T++ L+   NL+++SLA +D+ V+  V+P ++  ++M +W   P+ CK++L+ D+  CT+SI +LC IS+DRY +IT+ ++Y  +R+ +  +C+IL VW++A  ++ P   I    + I+    C I   + Y + S   SF +P +I++ VYIRI+ +A  R      +  K  +  K + H +     + AN    +K +K  V  +     +SS+  V                               +N               S   P      R N N   K  R   R+  +   T  L V  G F ICW PFF  Y +   C  C +N     F  W GY NS  NP IY  +N ++  AF+K++C
Sbjct:   29 GNLLAVIAVFTSRALKAPQNLFLVSLASADILVATLVMPFSLANELMGYWYFGPVWCKIYLALDVLFCTASIAHLCAISLDRYWSITRAVEYNLKRTPRRIKCVILVVWVIAAVISFPPLTIMKEDEPINDPPSCQINKDKWYIISSCIGSFFLPCIIMVLVYIRIYQIAKSRTRTPPGDRRKRDDEKKENGHCHERLNGDAANGN--DKDDKGDVNAVDMEESSSSDHKV-------------------------------TNPCASKKKRAKGKTKLSQIKPGDDINKRENANRGTKSSRWKGRQNREKRFTFVLAVVIGVFMICWFPFFFTYTLRALCESCCVNETLFKFFFWFGYCNSSLNPIIYTIFNNDFRRAFKKILC 380          
BLAST of SMED30003401 vs. Ensembl Cavefish
Match: ENSAMXT00000035837.1 (D(4) dopamine receptor-like [Source:NCBI gene;Acc:103025686])

HSP 1 Score: 139.043 bits (349), Expect = 4.919e-35
Identity = 119/398 (29.90%), Postives = 194/398 (48.74%), Query Frame = -2
Query:  627 IFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMK-HWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLL-------------KSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFC-GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVC 1775
            I +GN +V L+V+T + L+T TN +++SLA +D+ +++ VLPL + ++ +   W L+   C   ++ D+ LCT+SILNLC IS+DRY+A+  PLKY   +       +I A W+L+L V  P IFG ++  +   +        + ++S+       F+    + +  +W+    K  SS       NR     HS S  +   A Q    ++ +K V L+              SP   +S V+++  EQ   +  +     M  +M          +S+++   V+      SL+   L+K    +   +  +      +E K  K L +VVG F  CW PFF V++ +  C  C I P  ++ VTWLGYVNS  NP IY  +N E+   F KL+C
Sbjct:   51 IILGNVLVCLSVLTERSLKTATNYFIVSLAVADLLLAVLVLPLYVYSEFLGGKWTLSMYICDALMTMDVMLCTASILNLCAISVDRYIAVVVPLKYNRNQFSVRQLALITATWVLSLGVASPVIFGLNQVPNRNTHVCKLEDNNFVIYSS---VCSFFVPCPVMLLLYYWMFRGLKRWSSGRSRSRLNRPSGGRHSLSLRL-GAALQREKGRAREKVVYLMPEGLSPTSLSATPASPLSPTSPVTLSTDEQPEGQSPMADTDPMTTQM----------DSVSDAENVEKATEDGSLRENGLEKNHGSHRVRRHSKSSRVSGRERKAMKVLPVVVGVFLACWTPFFVVHVTKALCESCDIGPTLISVVTWLGYVNSAVNPIIYTAFNAEFRNVFHKLLC 434          
BLAST of SMED30003401 vs. Ensembl Cavefish
Match: ENSAMXT00000006138.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:27993956:27999385:-1 gene:ENSAMXG00000005992.2 transcript:ENSAMXT00000006138.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.939 bits (302), Expect = 4.394e-29
Identity = 60/148 (40.54%), Postives = 95/148 (64.19%), Query Frame = -2
Query: 1332 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWS--KHISSTGYCFITFHRGYRLFS 1769
            +GN+ VI A+   + LQT+ N  + SLA +D+ VS+ VLP+A + Q+++ W L  +AC L+++ D+  CTSSIL+LC I++DRY AIT P+ Y TRR+   A  +I   W++  S++IP + GW   +  ++   C I+   GY +FS
Sbjct:   49 VGNACVIAAIALERSLQTINNYLIGSLAVTDLLVSVLVLPMAALYQVLQRWTLGQVACDLFIALDVLCCTSSILHLCAIALDRYWAITDPVAYMTRRTLCRAATLISLTWLVGFSISIPPMLGWRTPEDRANPLECTISQDPGYTIFS 196          

HSP 2 Score: 87.4261 bits (215), Expect = 5.477e-18
Identity = 37/73 (50.68%), Postives = 52/73 (71.23%), Query Frame = -2
Query:  630 TAKTLALVVGCFSICWIPFFCVYLVEPFCG--CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 842
            T KTL +++G F +CW+PFF V LV PFCG  C + P   A + WLGY NS+ NP IYA++N+++  AFRK++
Sbjct:  328 TVKTLGIIMGTFILCWLPFFIVALVLPFCGSSCPMPPWLGAVINWLGYANSLLNPVIYAYFNRDFQNAFRKML 400          
BLAST of SMED30003401 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.398 bits (298), Expect = 2.134e-29
Identity = 58/147 (39.46%), Postives = 90/147 (61.22%), Query Frame = -2
Query: 1332 GNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWS--KHISSTGYCFITFHRGYRLFS 1766
            GNS VI A+   + LQ V N  + SLA +D+ VSI VLP+A + Q++  W L  + C ++++ D+  CTSSIL+LC I++DRY AIT P+ Y  +R+ + A  MI   W++  S++IP + GW   +  +    C I+   GY ++S
Sbjct:   53 GNSCVIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQVLDRWTLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIPPMLGWRTPEDRADPNACKISQDHGYTIYS 199          

HSP 2 Score: 59.3066 bits (142), Expect = 1.205e-9
Identity = 24/50 (48.00%), Postives = 35/50 (70.00%), Query Frame = -2
Query:  630 LVEPFCG--CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 773
            L+ PFCG  C + P   A + WLGY NS+ NP IYA++NK++  AF+K++
Sbjct:  332 LISPFCGERCHLPPGVFAVINWLGYSNSLLNPIIYAYFNKDFQNAFKKII 381          
BLAST of SMED30003401 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001357.1 (pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 gene:ENSPMAG00000001226.1 transcript:ENSPMAT00000001357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.842 bits (268), Expect = 1.106e-25
Identity = 57/147 (38.78%), Postives = 91/147 (61.90%), Query Frame = -2
Query: 1332 GNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGW--SKHISSTGYCFITFHRGYRLFS 1766
            GN+ V+ A+   + LQTV N  + SLA +D+ VS+ VLP+A + Q++  W L    C  +++ D+  CTSSIL+LC I++DRY AIT P+ Y  +R+ + A  MI   W++  S++IP + GW  ++  +    C I+ H GY ++S
Sbjct:   19 GNAFVLAAIYLERSLQTVANYLIGSLAVTDLLVSVLVLPVAALYQVLGRWTLGQAVCDAFIALDVLCCTSSILHLCAIALDRYWAITDPVDYVNKRTPRRAALMIAITWVVGFSISIPPMLGWRQAEDRADPDACNISQHLGYTIYS 165          
BLAST of SMED30003401 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008360.1 (pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1 gene:ENSPMAG00000007563.1 transcript:ENSPMAT00000008360.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.383 bits (272), Expect = 1.412e-25
Identity = 48/126 (38.10%), Postives = 86/126 (68.25%), Query Frame = -2
Query: 1401 TIFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFG 1778
            TIF GNS+V +AV T+K L+   NL+++SLA +D+ V+  V+P ++  ++M +W      C+++L+ D+  CTSSI++LC IS+DRY ++TQ ++Y  +R+ +  +  I+ VW++A  ++ P + G
Sbjct:   47 TIF-GNSLVAIAVFTSKSLKAAQNLFLVSLAAADILVATLVMPFSLANELMGYWVFGSFWCEMYLALDVLFCTSSIVHLCAISLDRYWSVTQAVRYNMKRTPRRVKRAIVIVWVIAALISFPPLVG 171          

HSP 2 Score: 58.9214 bits (141), Expect = 2.343e-9
Identity = 27/73 (36.99%), Postives = 39/73 (53.42%), Query Frame = -2
Query:  618 LALVVGCFSICWIPFFCVYLVEPFCGCIINP--HFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVCVSK 830
            LA+V+G F  CW PFF  Y +   C     P  +   F  W GY NS  NP IY  +N+++  AF+ ++C  +
Sbjct:  395 LAVVMGVFVACWFPFFFSYSLTKICEASCKPPEYLFKFFFWCGYCNSSLNPLIYTVFNQDFRRAFKNILCRRR 467          
BLAST of SMED30003401 vs. Ensembl Sea Lamprey
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 105.145 bits (261), Expect = 2.349e-24
Identity = 54/145 (37.24%), Postives = 85/145 (58.62%), Query Frame = -2
Query: 1332 NSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITF-HRGYRLFS 1763
            N++VI A+  T++L+   N  + SLA +D+ V+  V+P+A    +   W L    C LWLS D+  CT+SIL+LC I++DR+ AIT   +YA +R+   A  MI A W+LA  +++P +F W +   +   C I   H  Y ++S
Sbjct:   65 NALVIAAISATRKLRQPANYLIGSLAVADLLVAALVMPVAAAYVVTGEWALGGALCDLWLSLDVTCCTASILHLCAIALDRFWAITDAAEYAHKRTPGRAALMIAASWLLAACISVPPLF-WRRRDPAKPRCIIEHDHVLYTIYS 208          

HSP 2 Score: 83.1889 bits (204), Expect = 3.622e-17
Identity = 35/72 (48.61%), Postives = 48/72 (66.67%), Query Frame = -2
Query:  630 TAKTLALVVGCFSICWIPFFCVYLVEPFC-GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 842
             AKTL L++G F +CW+PFF   LV   C  C ++P     +TWLGY+NS+ NP IY  +N+++  AFRKLV
Sbjct:  350 AAKTLGLILGAFVVCWLPFFIKELVVNLCKSCAVSPEVADLLTWLGYMNSLINPLIYTMFNEDFKSAFRKLV 421          
BLAST of SMED30003401 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000271.1 (pep scaffold:Pmarinus_7.0:GL476504:17018:19617:1 gene:ENSPMAG00000000243.1 transcript:ENSPMAT00000000271.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.064 bits (253), Expect = 5.464e-24
Identity = 48/126 (38.10%), Postives = 83/126 (65.87%), Query Frame = -2
Query: 1392 GNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVT-IPGIFGWSK 1766
            GN+ V+L  +  +RL+TVT ++++SLA +D+ V+  V+P +I+ ++   W    L CK+W+S D+  CT+SI+ LC IS+DRY ++T P  Y TR S K    M +++W+ +L ++ +P   GW++
Sbjct:   40 GNAAVLLCPLVERRLRTVTYMFIMSLATADLLVACLVMPFSIIYEVTGVWIFGELFCKVWISFDVMFCTASIVTLCFISLDRYCSVTTPNHYPTRMSGKRCIAMTVSIWVYSLLISFLPVTQGWNE 165          

HSP 2 Score: 48.521 bits (114), Expect = 2.875e-6
Identity = 23/71 (32.39%), Postives = 40/71 (56.34%), Query Frame = -2
Query:  633 KTLALVVGCFSICWIPFFCVYLVEPFCGCIINPHFVAF---VTWLGYVNSIFNPFIYAFYNKEYALAFRKL 836
            +T+++++  F +CW+P+F   +     G   +   V     +TWLGY NS  NP +YAF N+++  A + L
Sbjct:  246 RTMSIIISAFVMCWLPYFVFNVAMNAYGSKHDRVVVTMFKIMTWLGYCNSAINPVLYAFLNRDFQHALKTL 316          
BLAST of SMED30003401 vs. Ensembl Nematostella
Match: EDO36610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI87])

HSP 1 Score: 93.9745 bits (232), Expect = 4.147e-21
Identity = 51/128 (39.84%), Postives = 75/128 (58.59%), Query Frame = -2
Query: 1392 FIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAI-VTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSK 1772
            F GN MV+LAV+   R++T+TN +V+SLA SD+ V+   LP  I  T     W L   AC  W+  DI  C +SI NL  IS+DR++AI  P +Y    +     C+I AVWIL++ + +  +  W++
Sbjct:   13 FYGNFMVVLAVVLFHRMRTITNYFVVSLAVSDLLVATLSLPFRIHQTTHNTAWCLGLEACVAWIVVDIICCGASIWNLAMISVDRFIAIVMPFRYHALMTPMTGVCLIGAVWILSMGMGMLSLINWTE 140          

HSP 2 Score: 54.299 bits (129), Expect = 6.245e-8
Identity = 32/85 (37.65%), Postives = 44/85 (51.76%), Query Frame = -2
Query:  633 TAKTLALVVGCFSICWIPFFCVYLVEPFCGCIINPHFVA---------------FVTWLGYVNSIFNPFIYAFYNKEYALAFRKL 842
             AK LA+VVGCF +CW PFF + LV  +      PH ++               FV  L  +NS  NP IYA +N+++  AF K+
Sbjct:  217 AAKILAIVVGCFVVCWFPFFVLTLVSLW-----EPHALSKETISKDTARGITLTFVYVLPVLNSTLNPIIYALFNRDFRRAFGKI 296          
BLAST of SMED30003401 vs. Ensembl Nematostella
Match: EDO37207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGH3])

HSP 1 Score: 87.4261 bits (215), Expect = 6.666e-19
Identity = 41/127 (32.28%), Postives = 76/127 (59.84%), Query Frame = -2
Query: 1389 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKH 1769
            +GN +++LA+  T+ LQ++T++++ +LA +D  +++  +P  + + I   W   P  CKL   ++   C +S+L+L  +SIDRY AI  PLKY    + ++A  ++  VW+ +L      IFGW ++
Sbjct:    3 LGNILILLAIKRTRSLQSITSVFIANLAVADFLLAVIGMPFTMTSSITYDWIFGPFWCKLNGMANSVFCIASMLSLAAVSIDRYFAIITPLKYPMLMTPRMAFMLVAWVWLQSLLCGFLPIFGWCRY 129          

HSP 2 Score: 48.9062 bits (115), Expect = 3.303e-6
Identity = 26/75 (34.67%), Postives = 37/75 (49.33%), Query Frame = -2
Query:  618 TAKTLALVVGCFSICWIPFFCVYLVEPFCGCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVCVSK 842
             AKTL +V+G F  CW P F       F  C     F A  TWL  +NS  NP +Y   N+ +  +F +++C  +
Sbjct:  225 AAKTLLIVMGTFLFCWSPHFIGMTCLLFPSCQWPDWFFATTTWLAMMNSGCNPILYGVLNRRFRRSFIEIICCGR 299          
BLAST of SMED30003401 vs. Ensembl Nematostella
Match: EDO35211 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM55])

HSP 1 Score: 85.5001 bits (210), Expect = 3.442e-18
Identity = 50/121 (41.32%), Postives = 72/121 (59.50%), Query Frame = -2
Query: 1419 GTIFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVT 1781
            GTIF GNS+V  A    + L+TVTN +V+SLA +D+ V    +PL     + +  P       LWL  DI   T+SI+NL  IS+DR+ AIT P +Y+ + +KK A   I+ VW+ A +V+
Sbjct:   14 GTIF-GNSLVCAAFYLFRDLRTVTNYFVVSLAIADLLVGFVSMPLWFTYLVFQWPPQNSEIYALWLCFDIATATASIMNLAVISVDRFYAITLPFQYSQKITKKRACLAIVFVWLYAFAVS 133          

HSP 2 Score: 54.6842 bits (130), Expect = 4.464e-8
Identity = 30/76 (39.47%), Postives = 44/76 (57.89%), Query Frame = -2
Query:  627 TAKTLALVVGCFSICWIPFFCVYLVE---PFCGCIINPHFVA-FVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVC 842
             AKTLA+V+G F +CW P+    L+E   P C    + + +A  V WL Y NS  NP IY   N+ +  AF++++C
Sbjct:  230 AAKTLAIVMGAFLLCWAPYIIALLLEVSCPRCVPFQDKYTLAKAVKWLVYSNSALNPIIYTALNRAFRDAFKRVLC 305          
BLAST of SMED30003401 vs. Ensembl Nematostella
Match: EDO28321 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6T3])

HSP 1 Score: 84.3445 bits (207), Expect = 7.561e-18
Identity = 48/129 (37.21%), Postives = 73/129 (56.59%), Query Frame = -2
Query: 1389 FIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAI-VTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKH 1772
            F GN MV+LAV+  +R++T+TN +V+SLA SD+ V++  LP  I  T     W L+  AC  W+  DI    +SI NL  ISIDR++AI  P +Y    +      +I +VW L+  + +     W+ +
Sbjct:   22 FYGNFMVVLAVVMFRRMRTITNYFVVSLAVSDLLVAMLSLPFRIHQTTHNTAWCLSLEACVAWIVVDIICAGASIWNLAIISIDRFIAIVLPFRYHALMTPISGFGLIASVWGLSFVMAVLSFINWTDY 150          

HSP 2 Score: 55.4546 bits (132), Expect = 2.869e-8
Identity = 30/80 (37.50%), Postives = 46/80 (57.50%), Query Frame = -2
Query:  633 TAKTLALVVGCFSICWIPFFCVYLVEPFCGCIINPHFVA----------FVTWLGYVNSIFNPFIYAFYNKEYALAFRKL 842
             AK LA+VVGCF +CW P+F + LV  +   +++   ++          FV  L  +NS  NPFIYA +NK++  +F K+
Sbjct:  229 AAKVLAIVVGCFVVCWFPYFVLVLVSLWDPILLSRETISPEQAKGITQTFVYVLPVLNSTLNPFIYALFNKDFRRSFAKI 308          
BLAST of SMED30003401 vs. Ensembl Nematostella
Match: EDO36608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI85])

HSP 1 Score: 83.5741 bits (205), Expect = 1.395e-17
Identity = 48/129 (37.21%), Postives = 72/129 (55.81%), Query Frame = -2
Query: 1389 FIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAI-VTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKH 1772
            F GN MV+LAV+  +R++T+TN +V+SLA SD+ V+   LP  I  T     W L+  AC  W+  DI    +SI NL  ISIDR++AI  P +Y    +      +I +VW L+  + +     W+ +
Sbjct:   22 FYGNFMVVLAVVMFRRMRTITNYFVVSLAVSDLLVATLSLPFRIHQTTHNTAWCLSLEACVAWIVVDIICAGASIWNLAIISIDRFIAIVLPFRYHALMTPISGFGLIASVWGLSFVMAVLSFINWTDY 150          

HSP 2 Score: 55.4546 bits (132), Expect = 2.744e-8
Identity = 30/80 (37.50%), Postives = 46/80 (57.50%), Query Frame = -2
Query:  633 TAKTLALVVGCFSICWIPFFCVYLVEPFCGCIINPHFVA----------FVTWLGYVNSIFNPFIYAFYNKEYALAFRKL 842
             AK LA+VVGCF +CW P+F + LV  +   +++   ++          FV  L  +NS  NPFIYA +NK++  +F K+
Sbjct:  229 AAKVLAIVVGCFVVCWFPYFVLVLVSLWDPILLSRETISPEQAKGITQTFVYVLPVLNSTLNPFIYALFNKDFRRSFAKI 308          
BLAST of SMED30003401 vs. Ensembl Medaka
Match: ENSORLT00000005282.2 (pep primary_assembly:ASM223467v1:9:8571029:8576106:1 gene:ENSORLG00000004220.2 transcript:ENSORLT00000005282.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.407 bits (446), Expect = 2.009e-48
Identity = 130/397 (32.75%), Postives = 201/397 (50.63%), Query Frame = -2
Query:  606 GNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGW--SKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKR------KLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFC--GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVCVSK*TFH 1766
            GN+ V+ A+   + LQ V N  + SLA +D+ VS+ VLP+A + Q++  W L    C L++S D+  CTSSIL+LC I++DRY AIT P+ Y  +R+   A  +I A W++  S++IP + GW  ++  ++   C I+   GY ++S F +F IP ++++ +Y RIF  A  R      K+ ++    KC     + FH  SN  S        + S+  S C+  +  +     S+ I+E          VI   K    L      S+   E +                      NE +   + + A  +E KT KTL +++G F  CW+PFF V LV PFC   C +     A + WLGY NS+ NP IYA++NK++  AF+K++   K  FH
Sbjct:   59 GNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQEICDLFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPMRAVLLICATWLIGFSISIPPMLGWRSAEDRANPDACMISQDPGYTIYSTFGAFYIPLILMLVLYGRIFRAARFRIRKTVKKIETAKVSDKCLAVSPAFFHKKSNGQSGGRGWKRCDGSKPSSPCVNGAVMHGDEGESLEIIE----------VISNSKTHLPLPNTPQSSSHGYENM----------------------NERNSGAKRKLALSRERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCPESCFMPDWLGAVINWLGYSNSLLNPIIYAYFNKDFQNAFKKII---KCKFH 420          
BLAST of SMED30003401 vs. Ensembl Medaka
Match: ADRA2C (adrenoceptor alpha 2C [Source:HGNC Symbol;Acc:HGNC:283])

HSP 1 Score: 142.124 bits (357), Expect = 3.536e-36
Identity = 109/391 (27.88%), Postives = 197/391 (50.38%), Query Frame = -2
Query:  627 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKH--ISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKR-KLLSSPEPS-KCFNRIKSDFHSYSNSISNIANQGY----PEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFC--GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVC 1769
            +GN +V++AV+T++ L+   NL+++SLA +D+ V+  V+P ++  ++M +W    + C ++L+ D+  CTSSI++LC IS+DRY ++TQ ++Y  +R+ +  +C IL VW+++  ++ P +    ++  ISS   C +     Y L S+  SF  P LI+I VYIRI+ VA  R + +S  +P      + ++     S+ +   A  G+    P  S++      ++   +  E S +  + +  + Q +   +  +K +F +     S    +++ +              KK  +  E                    LA+V+G F +CW PFF  Y +   C   C I      F  W+GY NS  NP IY  +N+++  AF+K++C
Sbjct:   51 VGNILVVIAVLTSRALKAPQNLFLVSLATADILVATLVMPFSLANELMGYWYFGKVWCGIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRIKCTILIVWLVSAFISSPPLVSIDRNNDISSQPQCELNDETWYILSSSIASFFAPCLIMILVYIRIYQVAKTRTRSMSEKKPKPDGVTQTENGLSKVSSPLHGEAENGHCHCPPTPSQRTVTTGPQTQEVDVEESSSSEGKGHNPQRQDSQRARKARKSSFSKHSAHISRVSNKSMDLFASRRKRRRSSFARKKVSQAREKRFTF--------------VLAVVMGVFVMCWFPFFFSYSLYGVCRDSCRIPDPLFKFFFWIGYCNSSLNPAIYTIFNRDFRHAFQKILC 427          
BLAST of SMED30003401 vs. Ensembl Medaka
Match: htr7c (5-hydroxytryptamine (serotonin) receptor 7c [Source:ZFIN;Acc:ZDB-GENE-060526-5])

HSP 1 Score: 123.25 bits (308), Expect = 1.196e-29
Identity = 68/221 (30.77%), Postives = 123/221 (55.66%), Query Frame = -2
Query: 1332 PIRFEFGHYITITTG*SQSELSLSINFFTMNYTENNNQT--------NEISSFNQXXXXXXXXXXXXXIEGTIFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMK-HWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFS 1967
            P+R      + + +      +S++++   + YT   N T         ++  F +    I+   + I    T+ +GN++V++AV   K+L+  +N  ++SLA +D+ V+I V+P  IVT +    W    + C +++  D+  CT+SI+ LC IS+DRY+ IT+PL Y  R++ +L   MIL VW+++ S+T+P   GW+K++   G C I+   GY ++S
Sbjct:   30 PLRLSQDSTVVMFSTSRTEPISMALSVLLLYYTLGKNSTTMWNKSCGEQLLDFGRPEKIIIGVMLAIITAVTV-MGNTLVVIAVCVVKKLRQPSNYLLVSLAVADLSVAIVVMPFVIVTDLTGGKWLFGEVFCNIFIGMDVMCCTASIMTLCVISVDRYLGITRPLTYPARQNGQLMAKMILGVWLVSASITLPPFCGWAKNVHKAGVCLISQDFGYTIYS 249          

HSP 2 Score: 69.707 bits (169), Expect = 4.225e-12
Identity = 33/75 (44.00%), Postives = 48/75 (64.00%), Query Frame = -2
Query:  630 TAKTLALVVGCFSICWIPFFCVYLVEPF-CG--CIINPHFVA-FVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 842
             A TL ++VG F++CW+PFF +    PF CG  C   P ++   + WLGY NS+ NPFIYAF+N++    +R L+
Sbjct:  335 AATTLGVIVGVFAVCWLPFFILSTARPFICGVECSCVPIWLERTLLWLGYANSLMNPFIYAFFNRDLRSTYRDLL 409          
BLAST of SMED30003401 vs. Ensembl Medaka
Match: ENSORLT00000018283.2 (pep primary_assembly:ASM223467v1:22:9799933:9805173:-1 gene:ENSORLG00000014581.2 transcript:ENSORLT00000018283.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.005 bits (284), Expect = 6.512e-27
Identity = 52/122 (42.62%), Postives = 83/122 (68.03%), Query Frame = -2
Query: 1404 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIF 1769
            + N+ VI  +  T++L T  N  + SLA +D+ VSI V+P++I+  + K W L  + C +WLSSDI  CT+SIL+LC I++DRY AIT  L+Y  RR+ + A  M+  VW++++S+++P +F
Sbjct:   50 LSNAFVITTIFLTRKLHTPANFLIGSLAVTDLLVSILVMPISILYTVSKTWSLGQIVCDIWLSSDITFCTASILHLCVIALDRYWAITDALEYPKRRTMRRAAMMVGVVWVISISISMPPLF 171          

HSP 2 Score: 72.0182 bits (175), Expect = 4.974e-13
Identity = 32/70 (45.71%), Postives = 44/70 (62.86%), Query Frame = -2
Query:  630 KTLALVVGCFSICWIPFFCVYLVEPFCG-CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 836
            KTL +++G F +CW+PFF   LV   C  C  +P      TWLGY+NS+ NP IY  +N E+  AF+KL+
Sbjct:  303 KTLGIILGAFIVCWLPFFVGTLVLAICKECWFHPILFDLFTWLGYLNSLINPVIYTAFNDEFKQAFQKLI 372          
BLAST of SMED30003401 vs. Ensembl Medaka
Match: ENSORLT00000025615.2 (muscarinic acetylcholine receptor M4 [Source:NCBI gene;Acc:101174568])

HSP 1 Score: 114.775 bits (286), Expect = 9.766e-27
Identity = 56/141 (39.72%), Postives = 84/141 (59.57%), Query Frame = -2
Query: 1356 GNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGW----SKHISSTGYCFITF 1766
            GN +V+L++   + LQTV N ++ SLA +D+ + +F + L  V  I+ +WPL P+ C LWL+ D  +  +S++NL  IS DRY  +T+PL Y TRR+ K+A  MI A WIL+  +  P I  W     +     G C+I F
Sbjct:   47 GNILVMLSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTVYIIVGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLSYPTRRTTKMAGLMIAAAWILSFILWAPAILFWQFIVGQRTVPPGECYIQF 187          
BLAST of SMED30003401 vs. Planmine SMEST
Match: SMESG000070778.1 (SMESG000070778.1)

HSP 1 Score: 749.584 bits (1934), Expect = 0.000e+0
Identity = 420/421 (99.76%), Postives = 421/421 (100.00%), Query Frame = -2
Query:  618 MNYTENNNQTNEISSFNQXXXXXXXXXXXXXIEGTIFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCGCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVCVSK 1880
            MNYTENNNQTNEISSFNQIIIDILSGTILIGIEGTIFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAFCSFIIPFLIIIFVYIRIFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDKKKRERAAFRKEHKTAKTLALVVGCFS+CWIPFFCVYLVEPFCGCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVCVSK
Sbjct:    1 MNYTENNNQTNEISSFNQIIIDILSGTILIGIEGTIFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAFCSFIIPFLIIIFVYIRIFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDKKKRERAAFRKEHKTAKTLALVVGCFSVCWIPFFCVYLVEPFCGCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVCVSK 421          
BLAST of SMED30003401 vs. Planmine SMEST
Match: SMESG000025945.1 (SMESG000025945.1)

HSP 1 Score: 241.121 bits (614), Expect = 9.935e-73
Identity = 163/395 (41.27%), Postives = 240/395 (60.76%), Query Frame = -2
Query:  618 IFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVA-YKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVI-KMP-KKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCGC-IINPH-----FVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLVCVSK 1775
            IF GNS++++AV+TT+ LQTVTN YV+SLA +D+ VS  VLPL I  ++   W L    C+ W+S DI LCT+SILNLCCISIDRYMAIT+PL YAT+RS KLA CMIL  WIL++ +++P + GWS H  +   C I+ H G+R++S+  SF IP +++IFVY+RIF +A Y++ LL+S + S+     K+  +S S    +        +  ++++ L  +P +  +              ++NS + + P  +   LQ ++  S ++     +   C   S     L +  +  E        AAF +EHKTAK +A+V+GCF +CW+PFF +Y++E  C   I+ P+      V  VTWLGY+NS  NPF+YAFYNKEYA  F+K++   K
Sbjct:   20 IFCGNSLILIAVLTTRHLQTVTNFYVVSLAIADLLVSGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILSVIISVPPVIGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQSSRNIKSNKNSSNSLSYKSLDFQTSNPSSQQRRQALDLESNPKHAQA-------------LKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLS---SGLSQSQKGKET-------AAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTFKKILSCKK 391          
BLAST of SMED30003401 vs. Planmine SMEST
Match: SMESG000031003.1 (SMESG000031003.1)

HSP 1 Score: 149.828 bits (377), Expect = 9.804e-39
Identity = 128/392 (32.65%), Postives = 204/392 (52.04%), Query Frame = -2
Query:  630 GTIFIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPL-KYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLK-SPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCGCI-INPHFVAF-----VTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1781
            GTI +GN ++I+AV   ++L T +N  V SLA SD  V++ V+P AI+TQI  +W  +   C  ++  DI LCT+SILNLCCISIDRY  I QPL +Y T  + +    MI  +WIL+  ++IP + GW K     G+C  +    Y+ ++   +F IP ++++ +Y RI+ VA  +K+  +   ++ F  +K    + +     I  Q     S   ++ L+K S N N+    V   E +++++ IN  I    K   LQ+  +D + +T +     +    + Q   L KK+                 E K  KTL +++GCF+ CW PFF + L+ P      IN  ++         WLGY NS  NP IYA +NK++   F++++
Sbjct:   50 GTI-VGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGT--NFRPVFLMICIIWILSGLISIPPVTGW-KEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQVA--KKIAKNNNVNQTFMGMK---FTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSK---LQQRKSDESDMTNSDYWNSIKSKKARQ-KYLSKKI---------------ISESKAIKTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWLGYFNSFLNPIIYAKFNKDFRQPFKEIL 413          
BLAST of SMED30003401 vs. Planmine SMEST
Match: SMESG000059571.1 (SMESG000059571.1)

HSP 1 Score: 135.576 bits (340), Expect = 4.855e-34
Identity = 110/399 (27.57%), Postives = 190/399 (47.62%), Query Frame = -2
Query:  630 IGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSK-------HISSTGYCFITFHRGYRLFSAXXXXXXXXXXXXXXXXXXFWVA-----YKRKLLSSPEPSKCFNRIKSDFH----SYSNSISNIANQGYPEKSEK-KSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDXXXXXXXXXXXXXKTAKTLALVVGCFSICWIPFFCVYLVEPFCG--CIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 1769
            +GN +V+LAV+  K L+ ++N  ++S+A +D+ V+IFV+ L+ V +I   W L    C  W+ +D+  C++SI +L  I++DRY  +T+ ++Y   R+       IL++W+++L + +P  F + +        +   G C I     Y L S   +F  P + ++ +Y +IF +A      KR+          +  I   FH    +  +  S   +Q     S K K  C L        + + NI   +     INS IK    +N +      S S   T+ V ++    +      + KV      K                T+ ++  CF +CW+PFF + LV PFCG  CI++P   + + WLGY+N + NPFIY  +++E+  AF+ ++
Sbjct:   43 VGNILVVLAVLLEKNLRNLSNYLILSMAITDLVVAIFVMNLSAVYEISNRWFLGIAWCDFWIFTDVMSCSASIFHLVTIALDRYWTVTR-IEYKHNRTMSQLIFTILSIWMISLMIAVPSRFHFHRLETQMFQEVVIKGRCLINSGYFYTLLSTVIAFYAPMIFMMIIYWKIFQIAKRQIRRKRRFNYEVTFDSKYKSICRYFHCCHRTTESEFSTTGDQYLINSSVKSKYTCSLMENTVRDMKYADNISVNS-----INSEIKYQLNVNDVHIARMSSLSSLRTLKVSVMPYNLTKTIEEQRHKVEVKRERKAII-------------TVGIITCCFILCWMPFFTLTLVLPFCGAYCIVHPIISSVLLWLGYLNCLLNPFIYTIFSQEFRCAFKNIL 422          
BLAST of SMED30003401 vs. Planmine SMEST
Match: SMESG000017736.1 (SMESG000017736.1)

HSP 1 Score: 132.494 bits (332), Expect = 7.659e-33
Identity = 65/147 (44.22%), Postives = 97/147 (65.99%), Query Frame = -2
Query: 1329 GNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMK-HWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSA 1766
            GN +VILA+   K+LQT +N  ++SLAFSD FVS+ V+P+A+  Q+M+  WP + L C  ++  D+ LCTSSILNLC ISIDRY+ IT+P++Y  RR+  L    I   WI++  ++IP +  W K     G C +T + GY++++ 
Sbjct:   54 GNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVW-KEPFRPGTCQLTENLGYQIYAT 199          

HSP 2 Score: 60.4622 bits (145), Expect = 2.310e-9
Identity = 26/75 (34.67%), Postives = 45/75 (60.00%), Query Frame = -2
Query:  630 TLALVVGCFSICWIPFFCVYLVEPFC-------GCIINPHFVAFVTWLGYVNSIFNPFIYAFYNKEYALAFRKLV 833
            TL +++GCF++CW+PFF + +++P            + P       WLGY+NS  NP IYA +N+E+   F++++
Sbjct:  308 TLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 382          
The following BLAST results are available for this feature:
BLAST of SMED30003401 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HTR1A2.553e-4931.905-hydroxytryptamine receptor 1A [Source:HGNC Symbo... [more]
DRD39.043e-3729.00dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:... [more]
DRD39.043e-3729.00dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:... [more]
DRD39.043e-3729.00dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:... [more]
HTR77.757e-2837.675-hydroxytryptamine receptor 7 [Source:HGNC Symbol... [more]
back to top
BLAST of SMED30003401 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ser-21.468e-4231.01Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-23.858e-4130.18Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-49.915e-3529.47SERotonin/octopamine receptor family; Serotonin re... [more]
ser-49.915e-3529.47SERotonin/octopamine receptor family; Serotonin re... [more]
octr-17.130e-3127.94OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
back to top
BLAST of SMED30003401 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TyrR1.634e-3748.99gene:FBgn0038542 transcript:FBtr0344474[more]
TyrR1.634e-3748.99gene:FBgn0038542 transcript:FBtr0083532[more]
TyrR1.634e-3748.99gene:FBgn0038542 transcript:FBtr0346161[more]
TyrRII6.358e-3549.01gene:FBgn0038541 transcript:FBtr0344630[more]
TyrRII6.358e-3549.01gene:FBgn0038541 transcript:FBtr0083512[more]
back to top
BLAST of SMED30003401 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr1ab2.742e-4131.965-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
htr1ab2.742e-4131.965-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
FP236542.12.509e-3828.50alpha-2B adrenergic receptor-like [Source:NCBI gen... [more]
FP236542.12.509e-3828.50alpha-2B adrenergic receptor-like [Source:NCBI gen... [more]
CR450836.27.488e-3038.105-hydroxytryptamine (serotonin) receptor 7b [Sourc... [more]
back to top
BLAST of SMED30003401 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000046867.17.882e-4929.705-hydroxytryptamine (serotonin) receptor 1A, G pro... [more]
ADRA2B3.264e-3830.25adrenoceptor alpha 2B [Source:NCBI gene;Acc:100485... [more]
HTR1B2.763e-2841.785-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
krcc13.972e-2826.20lysine-rich coiled-coil 1 [Source:Xenbase;Acc:XB-G... [more]
exd21.309e-2737.67exonuclease 3'-5' domain containing 2 [Source:Xenb... [more]
back to top
BLAST of SMED30003401 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Drd37.247e-3728.07dopamine receptor D3 [Source:MGI Symbol;Acc:MGI:94... [more]
Drd38.371e-3728.07dopamine receptor D3 [Source:MGI Symbol;Acc:MGI:94... [more]
Htr74.206e-2837.675-hydroxytryptamine (serotonin) receptor 7 [Source... [more]
Htr1a6.082e-2837.165-hydroxytryptamine (serotonin) receptor 1A [Sourc... [more]
Htr76.451e-2837.675-hydroxytryptamine (serotonin) receptor 7 [Source... [more]
back to top
BLAST of SMED30003401 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25188|OAR_HELVI4.560e-5532.77Octopamine receptor OS=Heliothis virescens OX=7102... [more]
sp|Q17232|OAR_BOMMO8.824e-5231.50Octopamine receptor OS=Bombyx mori OX=7091 PE=2 SV... [more]
sp|Q9N298|5HT1A_PANTR5.714e-4931.905-hydroxytryptamine receptor 1A OS=Pan troglodytes... [more]
sp|P08908|5HT1A_HUMAN1.226e-4831.905-hydroxytryptamine receptor 1A OS=Homo sapiens OX... [more]
sp|Q9N297|5HT1A_GORGO1.369e-4831.905-hydroxytryptamine receptor 1A OS=Gorilla gorilla... [more]
back to top
BLAST of SMED30003401 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KU592.477e-6941.27GCR011 OS=Schmidtea mediterranea OX=79327 GN=gcr01... [more]
A0A0L8GS861.717e-5939.79G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A336M3E96.040e-5837.56CSON011043 protein OS=Culicoides sonorensis OX=179... [more]
A0A1B0CD972.372e-5738.01Tyramine receptor OS=Lutzomyia longipalpis OX=7200... [more]
A0A1Z2RSG69.083e-5737.12Tyramine receptor OS=Nilaparvata lugens OX=108931 ... [more]
back to top
BLAST of SMED30003401 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr7a3.418e-4028.355-hydroxytryptamine receptor 7-like [Source:NCBI g... [more]
adra2b2.110e-3828.39adrenoceptor alpha 2B [Source:NCBI gene;Acc:266751... [more]
adra2a7.260e-3728.83adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750... [more]
ENSAMXT00000035837.14.919e-3529.90D(4) dopamine receptor-like [Source:NCBI gene;Acc:... [more]
ENSAMXT00000006138.24.394e-2940.54pep primary_assembly:Astyanax_mexicanus-2.0:6:2799... [more]
back to top
BLAST of SMED30003401 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009127.12.134e-2939.46pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
ENSPMAT00000001357.11.106e-2538.78pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 g... [more]
ENSPMAT00000008360.11.412e-2538.10pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1... [more]
HTR1F2.349e-2437.245-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
ENSPMAT00000000271.15.464e-2438.10pep scaffold:Pmarinus_7.0:GL476504:17018:19617:1 g... [more]
back to top
BLAST of SMED30003401 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003401 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO366104.147e-2139.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372076.666e-1932.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352113.442e-1841.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283217.561e-1837.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366081.395e-1737.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30003401 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000005282.22.009e-4832.75pep primary_assembly:ASM223467v1:9:8571029:8576106... [more]
ADRA2C3.536e-3627.88adrenoceptor alpha 2C [Source:HGNC Symbol;Acc:HGNC... [more]
htr7c1.196e-2930.775-hydroxytryptamine (serotonin) receptor 7c [Sourc... [more]
ENSORLT00000018283.26.512e-2742.62pep primary_assembly:ASM223467v1:22:9799933:980517... [more]
ENSORLT00000025615.29.766e-2739.72muscarinic acetylcholine receptor M4 [Source:NCBI ... [more]
back to top
BLAST of SMED30003401 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070778.10.000e+099.76SMESG000070778.1[more]
SMESG000025945.19.935e-7341.27SMESG000025945.1[more]
SMESG000031003.19.804e-3932.65SMESG000031003.1[more]
SMESG000059571.14.855e-3427.57SMESG000059571.1[more]
SMESG000017736.17.659e-3344.22SMESG000017736.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003401 ID=SMED30003401|Name=SMED30003401|organism=Schmidtea mediterranea sexual|type=transcript|length=2043bp
TTTATTTTTATTATTATTTATTTTATTATTATTATTTTATTATTTATTTT
TATTTATTTATTTATTTATTATACTGTATCATTGAAATCTCAGTCATGAA
TAAATCATTGTTTTAGTTAAGTGGGTTCCAAATTTCTAAATTAAAAAAAA
TAATTTTCTTTTTACAATTTAAAAAGTGAGAGTATATTTTGTTTAAATAA
ATGTACTAAAAAATGTAGCAAAATCAGACATAGCTATCCACATTAACGGA
CGGTTTACCAAGCCACTTTAGATGATGGGCAATATATGATAAAGGATTTA
AGATATGAATCTGTAGACATTAAAAGTGACAAATAATAATTAAAATAATG
TAAAAATCATATATAAAAATAATCATTGCCACTGGAAAAGTAAATAGAAA
ATATATTTCAAATTTATATATTTTTCTATTTTCTTTCATTGAATGACTTT
GTAATTTATTTTCTTTCAATAAATTTCACATATTTTATTGTTATCTCTAA
ATATGGAGAATTTTTTTTATTTTTTTTGTTGAAAAACTTTAACGAAAATT
CACGAAATACAACCGATAAAACAAACAAAAAACACTGGTAAAATTTCCAT
TGCCAATGAAATGTTCATTTCGAAACACAGACCAATTTTCGAAACGCCAG
AGCATATTCTTTATTATAAAACGCATAAATGAACGGATTGAAAATGCTGT
TGACGTATCCCAACCAGGTGACAAATGCGACAAAATGAGGATTGATTATG
CAACCACAGAACGGTTCCACTAGATAAACACAGAAAAACGGAATCCAACA
AATCGAAAAACATCCGACGACCAATGCGAGAGTTTTCGCTGTTTTGTGTT
CTTTTCGAAAAGCCGCTCGTTCTCGTTTTTTCTTGTCGTTTTCATTGAAT
CTCACCTTCTTTTTCAACGGAGGAAATTGCAAACTGTGTCCCACACAGAC
CAGTTGGACGGTCACGGTTTCAGTAATTGAATTCGAATCTGCAAGAATTC
TTTGAAGGAAATTCATTTTCTTTGGCATTTTTATCACAGAGTTAATCTGA
AATCGAAAATAGTTTTGTTCGACAATATTCACTGAAACTTCACTCGAATT
GTAATTTGGGGATTTCAGCAAACAAACCGATTTCTTTTCTGATTTTTCCG
GATATCCTTGATTGGCAATATTGGAAATGCTGTTCGAATACGAATGGAAA
TCGGATTTGATTCGATTGAAACATTTTGACGGTTCCGGAGAACTGAGGAG
TTTTCTTTTGTAGGCCACCCAAAATATTCGAATGTAGACAAAAATTATTA
TAAGAAAAGGTATAATAAAAGAACAGAAGGCAGAAAATAATCTATAACCT
CTATGAAAGGTTATGAAACAATAGCCAGTAGAGGAAATGTGTTTTGACCA
ACCGAAAATTCCGGGAATTGTAACTGAAAGTGCTAAAATCCAAACCGCAA
GTATCATACAACGGGCCAGCTTTTTCGATCTTCGTGTGGCATACTTTAAT
GGTTGGGTGATTGCCATGTACCTATCAATTGATATGCAGCATAGATTTAA
AATGGAGGAAGTACATAAACATATATCACTGGACAGCCATAACTTACACG
CCAAAGGTGTCAGTGGCCAATGTTTCATGATTTGGGTTACAATTGCCAAT
GGTAAGACAAATATTGATACAAATACATCAGAGAATGCCAACGAAATCAC
ATAGAGATTCGTCACGGTTTGCAAACGTTTAGTTGTCATTACTGCTAGAA
TTACCATGCTATTTCCAATAAAAATCGTCCCTTCGATTCCAATCAGAATT
GTTCCGGATAAAATATCTATAATAATTTGATTAAAAGATGAAATCTCATT
AGTTTGATTATTGTTTTCTGTATAATTCATTGTAAAAAAATTGATAGAGA
GAGAGAGCTCTGATTGCGATCAGCCAGTTGTAATAGTTATATAATGACCA
AATTCGAATCTGATTGGACAATGAATTTATATGGAAATATTCGATTAATT
ATCGGTAAATTTGTTTACATTTTTCACCATTGATCTATTTTCA
back to top

protein sequence of SMED30003401-orf-1

>SMED30003401-orf-1 ID=SMED30003401-orf-1|Name=SMED30003401-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=422bp
MNYTENNNQTNEISSFNQIIIDILSGTILIGIEGTIFIGNSMVILAVMTT
KRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLS
SDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILA
LSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAFCSFIIPFLIIIFVYI
RIFWVAYKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKK
SVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVIKMPKKMNFLQRILADSN
SITETVTVQLVCVGHSLQFPPLKKKVRFNENDKKKRERAAFRKEHKTAKT
LALVVGCFSICWIPFFCVYLVEPFCGCIINPHFVAFVTWLGYVNSIFNPF
IYAFYNKEYALAFRKLVCVSK*
back to top

protein sequence of SMED30003401-orf-2

>SMED30003401-orf-2 ID=SMED30003401-orf-2|Name=SMED30003401-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=106bp
MCFDQPKIPGIVTESAKIQTASIIQRASFFDLRVAYFNGWVIAMYLSIDM
QHRFKMEEVHKHISLDSHNLHAKGVSGQCFMIWVTIANGKTNIDTNTSEN
ANEIT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway