Doublecortin domain-containing protein

Overview
NameDoublecortin domain-containing protein
Smed IDSMED30003384
Length (bp)3919
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Doublecortin domain-containing protein (SMED30003384) t-SNE clustered cells

Violin plots show distribution of expression levels for Doublecortin domain-containing protein (SMED30003384) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Doublecortin domain-containing protein (SMED30003384) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Doublecortin domain-containing protein (SMED30003384) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003384

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30003384SMESG000033740.1 SmedASXL_018181SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30003384SMESG000033740.1 dd_Smed_v4_6712_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30003384SMESG000033740.1 dd_Smed_v4_6712_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003384SMESG000033740.1 dd_Smed_v4_6712_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003384SMESG000033740.1 dd_Smed_v4_6712_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30003384SMESG000033740.1 dd_Smed_v4_6712_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003384SMESG000033740.1 dd_Smed_v4_6712_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30003384SMESG000033740.1 dd_Smed_v4_6712_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003384SMESG000033740.1 Contig18704newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003384SMESG000033740.1 Contig18704uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30003384SMESG000033740.1 dd_Smed_v6_6712_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30003384SMESG000033740.1 dd_Smed_v6_6712_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Match: A0A267GGQ4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005916g1 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.717e-16
Identity = 44/112 (39.29%), Postives = 73/112 (65.18%), Query Frame = 1
Query:  130 LLTMTSRY--MIDIENRKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIEEKLTLPYNKPIKRIFTIKGREIDDPIMIKDQKYYVVSSLENFVNTRYGSIIKWAIIG 459
            L++  +R+   ID+ + +SK I VYRNGD++  A +VLL+P EQ  ++ + KA+EE++ LP N+ I++++ I GR I  P  I+ +KYYV +  E F++  YG  +   I+G
Sbjct:  197 LMSTQARFNAQIDVISTQSKSIRVYRNGDEFTPAIVVLLKPSEQASIDSVLKAVEERVVLPSNRAIRKLYDISGRRIWKPEYIEHEKYYVAAGHEPFLSRPYGQKLPVLIVG 308          
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Match: A0A1I8H2P7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 3.917e-16
Identity = 44/112 (39.29%), Postives = 73/112 (65.18%), Query Frame = 1
Query:  130 LLTMTSRY--MIDIENRKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIEEKLTLPYNKPIKRIFTIKGREIDDPIMIKDQKYYVVSSLENFVNTRYGSIIKWAIIG 459
            L++  +R+   ID+ + +SK I VYRNGD++  A +VLL+P EQ  ++ + KA+EE++ LP N+ I++++ I GR I  P  I+ +KYYV +  E F++  YG  +   I+G
Sbjct:  197 LMSTQARFNAQIDVISTQSKSIRVYRNGDEFTPAIVVLLKPSEQASIDSVLKAVEERVVLPSNRAIRKLYDISGRRIWKPEYIEHEKYYVAAGHEPFLSRPYGQKLPVLIVG 308          
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Match: A0A267H4M5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006614g1 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 6.931e-16
Identity = 44/112 (39.29%), Postives = 72/112 (64.29%), Query Frame = 1
Query:  130 LLTMTSRY--MIDIENRKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIEEKLTLPYNKPIKRIFTIKGREIDDPIMIKDQKYYVVSSLENFVNTRYGSIIKWAIIG 459
            L++   R+   ID+ + +SK I VYRNGD++  A +VLL+P EQ  ++ + KA+EE++ LP N+ I++++ I GR I  P  I+ +KYYV +  E F++  YG  +   I+G
Sbjct:  197 LMSTKPRFNAQIDVISTQSKSIRVYRNGDEFTPAIVVLLKPSEQASIDSVLKAVEERVVLPSNRAIRKLYDISGRRIWKPEYIEHEKYYVAAGHEPFLSRPYGQKLPVLIVG 308          
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Match: A0A267GGF9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005916g2 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 7.620e-16
Identity = 44/112 (39.29%), Postives = 72/112 (64.29%), Query Frame = 1
Query:  130 LLTMTSRY--MIDIENRKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIEEKLTLPYNKPIKRIFTIKGREIDDPIMIKDQKYYVVSSLENFVNTRYGSIIKWAIIG 459
            L++   R+   ID+ + +SK I VYRNGD++  A +VLL+P EQ  ++ + KA+EE++ LP N+ I++++ I GR I  P  I+ +KYYV +  E F++  YG  +   I+G
Sbjct:  197 LMSTKPRFNAQIDVISTQSKSIRVYRNGDEFTPAIVVLLKPSEQASIDSVLKAVEERVVLPSNRAIRKLYDISGRRIWKPEYIEHEKYYVAAGHEPFLSRPYGQKLPVLIVG 308          
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Match: A0A1I8GXZ4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 8.557e-16
Identity = 44/112 (39.29%), Postives = 72/112 (64.29%), Query Frame = 1
Query:  130 LLTMTSRY--MIDIENRKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIEEKLTLPYNKPIKRIFTIKGREIDDPIMIKDQKYYVVSSLENFVNTRYGSIIKWAIIG 459
            L++   R+   ID+ + +SK I VYRNGD++  A +VLL+P EQ  ++ + KA+EE++ LP N+ I++++ I GR I  P  I+ +KYYV +  E F++  YG  +   I+G
Sbjct:  197 LMSTKPRFNAQIDVISTQSKSIRVYRNGDEFTPAIVVLLKPSEQASIDSVLKAVEERVVLPSNRAIRKLYDISGRRIWKPEYIEHEKYYVAAGHEPFLSRPYGQKLPVLIVG 308          
BLAST of Doublecortin domain-containing protein vs. Planmine SMEST
Match: SMESG000033740.1 (SMESG000033740.1)

HSP 1 Score: 1707.58 bits (4421), Expect = 0.000e+0
Identity = 1014/1051 (96.48%), Postives = 1020/1051 (97.05%), Query Frame = 1
Query:  139 MTSRYMIDIENRKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIEEKLTLPYNKPIKRIFTIKGREIDDPIMIKDQKYYVVSSLENFVNTRYGSIIKWAIIGPVKWSKFADVFYEPPEQEDLSTGNKVIYRWKNPTQSSARFPSKMTKSMSAYPSDRKTTKPSRVMTLSMDQSKRPISEPSNDMKTAAENRNEDNGYFHXXXXXXXXXXXXETSPKIITSHGHRSMDQFLNDSLKMYXXXXXXXXXXXXSDLCSLENNEIKFEENPERDEDNSKEHEIISLTNITENQKENELEKEDCGDMKEDVQRHDSFEFNTNISMEKPFESIENSYKKSEILNKSDDNERDDISENDTNEANSMANIDKNNEIISYLSVEDEKIEEASKTKEVDFTDNIDLKNDDETPENSDLVKDYGKFGRNSDYNDSEKEHECSNKDYVTNLPEANYADEVDKCSENKLDYVKHQISENENYKDTSKEIAMETEDGNQMSLGDFIGNTKFSGILESQSNKDTDESDMELDKHSKNVEEXXXXXXXXXXXXXXXXXXXGDNTSNKEDSILSEPVKNNLNTSNNEKQYNLIEKDEKTSDILKGFIGNEDKSISSTSEDHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILNMNKDLXXXXXXXXXXXXXXXXXYDNXXXXXXXXXXXXIGKEMSDNEELGKEASNNEDLERETSDIDEKDDSVIIRETIKISREDINNVAKINDDPFDSSIKINSDEERLRENQMFNFPIQKTIESDIEKDGISXXXXXXXXXXXXXXXXXXXRRDDLDVSFNNSPKEQYDRINIQRKDSSEFDEDHRPFGQNLSDEKVLELDFNNDKLEQFNRIDTHQNEAPNCIENTESQLADAADHTIQQEIEGFKESAEKDQMEQYNRIDMTLDNSVHCIEEKRGSLTSVSDCGGSELEIGHKVSNITEVADENDSNDCQNIIGKGNSLISETSDNEKDSIDXXXXXXXXXXXXXXXKNINTDLYEDEFAKNKAATIIQESFRKHLERADRFPNSEHGDTENEIDSELKLEK 3291
            MTSRYMIDIENRKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIEEKLTLPYNKPIKRIFTIKG+EIDDPIMIKDQKYYVVSSLENF+NTRYGSIIKWAIIGPVKWSKFADVFYEPPEQEDLSTGNKVIYRWKNPTQSSARFPSKMTKSMSAYPSDRKTTKPSRVMTLSMDQSKRPISEPSNDMKTAAENRNEDNGYFHSSDDKNSSADNSETSPKIITSHGHRSMDQFLNDSLKMYQQKDGNDKNGNDSDLCSLENNEIK EENPERDEDNSKEHEIISLTNITENQKENELEKEDCGD+KEDVQRHDSFEFNT ISMEKP                 DD+ERDDISENDTN+ANSMANIDKNNEIISYLSVEDEKIEEASKTKEVDFTDNIDLKNDDETPENSDLVKDY KFGRNSDYNDSE EHECSNKDYVTNLPEANYADEVDKCSENKLDYVKHQISENENYKDTSKEIAMETEDGNQMSLGDFIGNTKFSGILESQSNKDTDESDMELDKHSKNVEENSDQQRLSKSSSLKDDNSDGDNTSNKEDSILSEPVKNN NTSNNEKQYNLIEKDEKTSDILKGFIGNEDKSISSTSEDHDENDDEVLSENENENENENENENENEKVENENSE ILNMNK LSKFKEKEIDSKSSSEVSYDNEELEKEMSDSEEIGKEMSDNEELGKEASNNEDLERETSDIDEKDDSVIIRETIKISREDINNVAKINDDPFDSSIKINSDEERLRENQMFNFPIQKTIES IEKDGISEKSNHDFEEENEESEHFQERRDDLDVSFNNSPKEQYDRINIQ KDSSEFDEDHRPFGQ+LSDEKVLELDFNNDKLEQFNRIDTHQNEAPNCIEN ESQLADAADHTIQQE EGFKES EKDQMEQYNRIDMTLDNSVHCIEEKRGSLTSVSDCGGSELEIGHKVSNITEVADEND NDCQN IGKGNSLISETSDNEKDSIDEELELSETNEEIYENKNINTDLYEDEFAKNKAATIIQESFRKHLERADRFPNSEHGDTENEIDSELKLEK
Sbjct:    1 MTSRYMIDIENRKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIEEKLTLPYNKPIKRIFTIKGKEIDDPIMIKDQKYYVVSSLENFINTRYGSIIKWAIIGPVKWSKFADVFYEPPEQEDLSTGNKVIYRWKNPTQSSARFPSKMTKSMSAYPSDRKTTKPSRVMTLSMDQSKRPISEPSNDMKTAAENRNEDNGYFHSSDDKNSSADNSETSPKIITSHGHRSMDQFLNDSLKMYQQKDGNDKNGNDSDLCSLENNEIKSEENPERDEDNSKEHEIISLTNITENQKENELEKEDCGDVKEDVQRHDSFEFNTKISMEKP-----------------DDDERDDISENDTNKANSMANIDKNNEIISYLSVEDEKIEEASKTKEVDFTDNIDLKNDDETPENSDLVKDYDKFGRNSDYNDSENEHECSNKDYVTNLPEANYADEVDKCSENKLDYVKHQISENENYKDTSKEIAMETEDGNQMSLGDFIGNTKFSGILESQSNKDTDESDMELDKHSKNVEENSDQQRLSKSSSLKDDNSDGDNTSNKEDSILSEPVKNNFNTSNNEKQYNLIEKDEKTSDILKGFIGNEDKSISSTSEDHDENDDEVLSENENENENENENENENEKVENENSEVILNMNKYLSKFKEKEIDSKSSSEVSYDNEELEKEMSDSEEIGKEMSDNEELGKEASNNEDLERETSDIDEKDDSVIIRETIKISREDINNVAKINDDPFDSSIKINSDEERLRENQMFNFPIQKTIESGIEKDGISEKSNHDFEEENEESEHFQERRDDLDVSFNNSPKEQYDRINIQLKDSSEFDEDHRPFGQSLSDEKVLELDFNNDKLEQFNRIDTHQNEAPNCIENIESQLADAADHTIQQENEGFKESNEKDQMEQYNRIDMTLDNSVHCIEEKRGSLTSVSDCGGSELEIGHKVSNITEVADENDPNDCQNTIGKGNSLISETSDNEKDSIDEELELSETNEEIYENKNINTDLYEDEFAKNKAATIIQESFRKHLERADRFPNSEHGDTENEIDSELKLEK 1034          
BLAST of Doublecortin domain-containing protein vs. Planmine SMEST
Match: SMESG000033740.1 (SMESG000033740.1)

HSP 1 Score: 1663.28 bits (4306), Expect = 0.000e+0
Identity = 996/1051 (94.77%), Postives = 1003/1051 (95.43%), Query Frame = 1
Query:  139 MTSRYMIDIENRKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIEEKLTLPYNKPIKRIFTIKGREIDDPIMIKDQKYYVVSSLENFVNTRYGSIIKWAIIGPVKWSKFADVFYEPPEQEDLSTGNKVIYRWKNPTQSSARFPSKMTKSMSAYPSDRKTTKPSRVMTLSMDQSKRPISEPSNDMKTAAENRNEDNGYFHXXXXXXXXXXXXETSPKIITSHGHRSMDQFLNDSLKMYXXXXXXXXXXXXSDLCSLENNEIKFEENPERDEDNSKEHEIISLTNITENQKENELEKEDCGDMKEDVQRHDSFEFNTNISMEKPFESIENSYKKSEILNKSDDNERDDISENDTNEANSMANIDKNNEIISYLSVEDEKIEEASKTKEVDFTDNIDLKNDDETPENSDLVKDYGKFGRNSDYNDSEKEHECSNKDYVTNLPEANYADEVDKCSENKLDYVKHQISENENYKDTSKEIAMETEDGNQMSLGDFIGNTKFSGILESQSNKDTDESDMELDKHSKNVEEXXXXXXXXXXXXXXXXXXXGDNTSNKEDSILSEPVKNNLNTSNNEKQYNLIEKDEKTSDILKGFIGNEDKSISSTSEDHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILNMNKDLXXXXXXXXXXXXXXXXXYDNXXXXXXXXXXXXIGKEMSDNEELGKEASNNEDLERETSDIDEKDDSVIIRETIKISREDINNVAKINDDPFDSSIKINSDEERLRENQMFNFPIQKTIESDIEKDGISXXXXXXXXXXXXXXXXXXXRRDDLDVSFNNSPKEQYDRINIQRKDSSEFDEDHRPFGQNLSDEKVLELDFNNDKLEQFNRIDTHQNEAPNCIENTESQLADAADHTIQQEIEGFKESAEKDQMEQYNRIDMTLDNSVHCIEEKRGSLTSVSDCGGSELEIGHKVSNITEVADENDSNDCQNIIGKGNSLISETSDNEKDSIDXXXXXXXXXXXXXXXKNINTDLYEDEFAKNKAATIIQESFRKHLERADRFPNSEHGDTENEIDSELKLEK 3291
            MTSRYMIDIENRKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIEEKLTLPYNKPIKRIFTIKG+EIDDPIMIKDQKYYVVSSLENF+NTRYGSIIKWAIIGPVKWSKFADVFYEPPEQEDLSTGNKVIYRWKNPTQSSARFPSKMTKSMSAYPSDRKTTKPSRVMTLSMDQSKRPISEPSNDMKTAAENRNEDNGYFHSSDDKNSSADNSETSPKIITSHGHRSMDQFLNDSLKMYQQKDGNDKNGNDSDLCSLENNEIK EENPERDEDN                 +NELEKEDCGD+KEDVQRHDSFEFNT ISMEKP                 DD+ERDDISENDTN+ANSMANIDKNNEIISYLSVEDEKIEEASKTKEVDFTDNIDLKNDDETPENSDLVKDY KFGRNSDYNDSE EHECSNKDYVTNLPEANYADEVDKCSENKLDYVKHQISENENYKDTSKEIAMETEDGNQMSLGDFIGNTKFSGILESQSNKDTDESDMELDKHSKNVEENSDQQRLSKSSSLKDDNSDGDNTSNKEDSILSEPVKNN NTSNNEKQYNLIEKDEKTSDILKGFIGNEDKSISSTSEDHDENDDEVLSENENENENENENENENEKVENENSE ILNMNK LSKFKEKEIDSKSSSEVSYDNEELEKEMSDSEEIGKEMSDNEELGKEASNNEDLERETSDIDEKDDSVIIRETIKISREDINNVAKINDDPFDSSIKINSDEERLRENQMFNFPIQKTIES IEKDGISEKSNHDFEEENEESEHFQERRDDLDVSFNNSPKEQYDRINIQ KDSSEFDEDHRPFGQ+LSDEKVLELDFNNDKLEQFNRIDTHQNEAPNCIEN ESQLADAADHTIQQE EGFKES EKDQMEQYNRIDMTLDNSVHCIEEKRGSLTSVSDCGGSELEIGHKVSNITEVADEND NDCQN IGKGNSLISETSDNEKDSIDEELELSETNEEIYENKNINTDLYEDEFAKNKAATIIQESFRKHLERADRFPNSEHGDTENEIDSELKLEK
Sbjct:    1 MTSRYMIDIENRKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIEEKLTLPYNKPIKRIFTIKGKEIDDPIMIKDQKYYVVSSLENFINTRYGSIIKWAIIGPVKWSKFADVFYEPPEQEDLSTGNKVIYRWKNPTQSSARFPSKMTKSMSAYPSDRKTTKPSRVMTLSMDQSKRPISEPSNDMKTAAENRNEDNGYFHSSDDKNSSADNSETSPKIITSHGHRSMDQFLNDSLKMYQQKDGNDKNGNDSDLCSLENNEIKSEENPERDEDN-----------------KNELEKEDCGDVKEDVQRHDSFEFNTKISMEKP-----------------DDDERDDISENDTNKANSMANIDKNNEIISYLSVEDEKIEEASKTKEVDFTDNIDLKNDDETPENSDLVKDYDKFGRNSDYNDSENEHECSNKDYVTNLPEANYADEVDKCSENKLDYVKHQISENENYKDTSKEIAMETEDGNQMSLGDFIGNTKFSGILESQSNKDTDESDMELDKHSKNVEENSDQQRLSKSSSLKDDNSDGDNTSNKEDSILSEPVKNNFNTSNNEKQYNLIEKDEKTSDILKGFIGNEDKSISSTSEDHDENDDEVLSENENENENENENENENEKVENENSEVILNMNKYLSKFKEKEIDSKSSSEVSYDNEELEKEMSDSEEIGKEMSDNEELGKEASNNEDLERETSDIDEKDDSVIIRETIKISREDINNVAKINDDPFDSSIKINSDEERLRENQMFNFPIQKTIESGIEKDGISEKSNHDFEEENEESEHFQERRDDLDVSFNNSPKEQYDRINIQLKDSSEFDEDHRPFGQSLSDEKVLELDFNNDKLEQFNRIDTHQNEAPNCIENIESQLADAADHTIQQENEGFKESNEKDQMEQYNRIDMTLDNSVHCIEEKRGSLTSVSDCGGSELEIGHKVSNITEVADENDPNDCQNTIGKGNSLISETSDNEKDSIDEELELSETNEEIYENKNINTDLYEDEFAKNKAATIIQESFRKHLERADRFPNSEHGDTENEIDSELKLEK 1017          
BLAST of Doublecortin domain-containing protein vs. Planmine SMEST
Match: SMESG000033740.1 (SMESG000033740.1)

HSP 1 Score: 1652.88 bits (4279), Expect = 0.000e+0
Identity = 991/1046 (94.74%), Postives = 998/1046 (95.41%), Query Frame = 1
Query:  154 MIDIENRKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIEEKLTLPYNKPIKRIFTIKGREIDDPIMIKDQKYYVVSSLENFVNTRYGSIIKWAIIGPVKWSKFADVFYEPPEQEDLSTGNKVIYRWKNPTQSSARFPSKMTKSMSAYPSDRKTTKPSRVMTLSMDQSKRPISEPSNDMKTAAENRNEDNGYFHXXXXXXXXXXXXETSPKIITSHGHRSMDQFLNDSLKMYXXXXXXXXXXXXSDLCSLENNEIKFEENPERDEDNSKEHEIISLTNITENQKENELEKEDCGDMKEDVQRHDSFEFNTNISMEKPFESIENSYKKSEILNKSDDNERDDISENDTNEANSMANIDKNNEIISYLSVEDEKIEEASKTKEVDFTDNIDLKNDDETPENSDLVKDYGKFGRNSDYNDSEKEHECSNKDYVTNLPEANYADEVDKCSENKLDYVKHQISENENYKDTSKEIAMETEDGNQMSLGDFIGNTKFSGILESQSNKDTDESDMELDKHSKNVEEXXXXXXXXXXXXXXXXXXXGDNTSNKEDSILSEPVKNNLNTSNNEKQYNLIEKDEKTSDILKGFIGNEDKSISSTSEDHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILNMNKDLXXXXXXXXXXXXXXXXXYDNXXXXXXXXXXXXIGKEMSDNEELGKEASNNEDLERETSDIDEKDDSVIIRETIKISREDINNVAKINDDPFDSSIKINSDEERLRENQMFNFPIQKTIESDIEKDGISXXXXXXXXXXXXXXXXXXXRRDDLDVSFNNSPKEQYDRINIQRKDSSEFDEDHRPFGQNLSDEKVLELDFNNDKLEQFNRIDTHQNEAPNCIENTESQLADAADHTIQQEIEGFKESAEKDQMEQYNRIDMTLDNSVHCIEEKRGSLTSVSDCGGSELEIGHKVSNITEVADENDSNDCQNIIGKGNSLISETSDNEKDSIDXXXXXXXXXXXXXXXKNINTDLYEDEFAKNKAATIIQESFRKHLERADRFPNSEHGDTENEIDSELKLEK 3291
            MIDIENRKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIEEKLTLPYNKPIKRIFTIKG+EIDDPIMIKDQKYYVVSSLENF+NTRYGSIIKWAIIGPVKWSKFADVFYEPPEQEDLSTGNKVIYRWKNPTQSSARFPSKMTKSMSAYPSDRKTTKPSRVMTLSMDQSKRPISEPSNDMKTAAENRNEDNGYFHSSDDKNSSADNSETSPKIITSHGHRSMDQFLNDSLKMYQQKDGNDKNGNDSDLCSLENNEIK EENPERDEDN                 +NELEKEDCGD+KEDVQRHDSFEFNT ISMEKP                 DD+ERDDISENDTN+ANSMANIDKNNEIISYLSVEDEKIEEASKTKEVDFTDNIDLKNDDETPENSDLVKDY KFGRNSDYNDSE EHECSNKDYVTNLPEANYADEVDKCSENKLDYVKHQISENENYKDTSKEIAMETEDGNQMSLGDFIGNTKFSGILESQSNKDTDESDMELDKHSKNVEENSDQQRLSKSSSLKDDNSDGDNTSNKEDSILSEPVKNN NTSNNEKQYNLIEKDEKTSDILKGFIGNEDKSISSTSEDHDENDDEVLSENENENENENENENENEKVENENSE ILNMNK LSKFKEKEIDSKSSSEVSYDNEELEKEMSDSEEIGKEMSDNEELGKEASNNEDLERETSDIDEKDDSVIIRETIKISREDINNVAKINDDPFDSSIKINSDEERLRENQMFNFPIQKTIES IEKDGISEKSNHDFEEENEESEHFQERRDDLDVSFNNSPKEQYDRINIQ KDSSEFDEDHRPFGQ+LSDEKVLELDFNNDKLEQFNRIDTHQNEAPNCIEN ESQLADAADHTIQQE EGFKES EKDQMEQYNRIDMTLDNSVHCIEEKRGSLTSVSDCGGSELEIGHKVSNITEVADEND NDCQN IGKGNSLISETSDNEKDSIDEELELSETNEEIYENKNINTDLYEDEFAKNKAATIIQESFRKHLERADRFPNSEHGDTENEIDSELKLEK
Sbjct:    1 MIDIENRKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIEEKLTLPYNKPIKRIFTIKGKEIDDPIMIKDQKYYVVSSLENFINTRYGSIIKWAIIGPVKWSKFADVFYEPPEQEDLSTGNKVIYRWKNPTQSSARFPSKMTKSMSAYPSDRKTTKPSRVMTLSMDQSKRPISEPSNDMKTAAENRNEDNGYFHSSDDKNSSADNSETSPKIITSHGHRSMDQFLNDSLKMYQQKDGNDKNGNDSDLCSLENNEIKSEENPERDEDN-----------------KNELEKEDCGDVKEDVQRHDSFEFNTKISMEKP-----------------DDDERDDISENDTNKANSMANIDKNNEIISYLSVEDEKIEEASKTKEVDFTDNIDLKNDDETPENSDLVKDYDKFGRNSDYNDSENEHECSNKDYVTNLPEANYADEVDKCSENKLDYVKHQISENENYKDTSKEIAMETEDGNQMSLGDFIGNTKFSGILESQSNKDTDESDMELDKHSKNVEENSDQQRLSKSSSLKDDNSDGDNTSNKEDSILSEPVKNNFNTSNNEKQYNLIEKDEKTSDILKGFIGNEDKSISSTSEDHDENDDEVLSENENENENENENENENEKVENENSEVILNMNKYLSKFKEKEIDSKSSSEVSYDNEELEKEMSDSEEIGKEMSDNEELGKEASNNEDLERETSDIDEKDDSVIIRETIKISREDINNVAKINDDPFDSSIKINSDEERLRENQMFNFPIQKTIESGIEKDGISEKSNHDFEEENEESEHFQERRDDLDVSFNNSPKEQYDRINIQLKDSSEFDEDHRPFGQSLSDEKVLELDFNNDKLEQFNRIDTHQNEAPNCIENIESQLADAADHTIQQENEGFKESNEKDQMEQYNRIDMTLDNSVHCIEEKRGSLTSVSDCGGSELEIGHKVSNITEVADENDPNDCQNTIGKGNSLISETSDNEKDSIDEELELSETNEEIYENKNINTDLYEDEFAKNKAATIIQESFRKHLERADRFPNSEHGDTENEIDSELKLEK 1012          
BLAST of Doublecortin domain-containing protein vs. Planmine SMEST
Match: SMESG000026635.1 (SMESG000026635.1)

HSP 1 Score: 139.813 bits (351), Expect = 5.285e-35
Identity = 70/162 (43.21%), Postives = 99/162 (61.11%), Query Frame = 1
Query:  139 MTSRYMIDIENRKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIEEKLTLPYNKPIKRIFTIKGREIDDPIMIKDQKYYVVSSLENFVNTRYGSIIKWAIIGPVKWSKFADVFYEPPEQED-----LSTGNKVI--YRWKNPTQSSARFPSKMTKSM 603
            M+SRY+ D++ R+SKIIH+YRNGD Y RA  V+LR  EQ  LERI KAIEEK+ LP N+PI+++F + G  +     I D  YYV +S ENF++ +YG    W ++GPV+ SK+ +V Y    +E+     LS  N V+   R   P   S +   K  +S+
Sbjct:    1 MSSRYLKDLDIRRSKIIHIYRNGDPYGRAIFVILRLPEQAALERIVKAIEEKVRLPLNRPIRKLFELTGTLVQSHTQIVDGNYYVAASSENFLDIKYGHPANWVLVGPVRTSKYENVHYVTRAEEEGKLNQLSASNNVLSTSRTNKPVTPSKKSGRKSIQSL 162          
BLAST of Doublecortin domain-containing protein vs. Planmine SMEST
Match: SMESG000059704.1 (SMESG000059704.1)

HSP 1 Score: 84.7297 bits (208), Expect = 8.707e-17
Identity = 38/103 (36.89%), Postives = 60/103 (58.25%), Query Frame = 1
Query:  172 RKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIEEKLTLPYNKPIKRIFTIKGREIDDPIMIKDQKYYVVSSLENFVNTRYGSIIKWAIIGPVKWSKF 480
            ++ K I ++RNGD+Y RA  V+L+  E + ++ + K + EK+ LP + PI+R+FT+ G  I DP  ++D K Y+    E FV   YG  +   I GP K  + 
Sbjct:  197 KRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICGPKKQERI 299          
The following BLAST results are available for this feature:
BLAST of Doublecortin domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GGQ43.717e-1639.29Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H2P73.917e-1639.29Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H4M56.931e-1639.29Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GGF97.620e-1639.29Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GXZ48.557e-1639.29Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033740.10.000e+096.48SMESG000033740.1[more]
SMESG000033740.10.000e+094.77SMESG000033740.1[more]
SMESG000033740.10.000e+094.74SMESG000033740.1[more]
SMESG000026635.15.285e-3543.21SMESG000026635.1[more]
SMESG000059704.18.707e-1736.89SMESG000059704.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003384 ID=SMED30003384|Name=Doublecortin domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3919bp
TTTTCTTTCCCGGGCATTCTTTTTATTAATCCTCTATATTGATTGCTCAT
TACGCCTTTCAGAAGATAAATTTTCAACAGCAGCTCTCATTGATAAATTT
GATTTCCAATCTCATTAACCGAAAAATATTTATTGACAATGACATCTCGA
TATATGATAGACATTGAAAACCGAAAATCAAAAATAATTCACGTATATCG
GAATGGGGACAAATATAACCGCGCGGCCTTGGTTCTTCTTCGTCCGATGG
AGCAGCAAAAACTGGAAAGAATATTTAAAGCAATTGAAGAAAAGTTAACA
TTGCCTTACAATAAACCTATAAAACGAATATTTACTATAAAAGGAAGAGA
AATCGACGATCCTATTATGATAAAAGATCAAAAGTACTATGTGGTAAGTT
CTTTGGAAAATTTTGTCAATACTCGCTATGGAAGCATTATTAAATGGGCA
ATTATTGGTCCTGTCAAATGGAGCAAATTCGCAGATGTGTTTTATGAACC
TCCTGAGCAAGAAGATCTTTCGACGGGCAACAAAGTTATTTACAGGTGGA
AAAATCCCACTCAAAGCAGTGCACGATTCCCATCTAAAATGACAAAAAGT
ATGTCTGCTTATCCATCCGACAGGAAAACAACAAAACCTTCAAGAGTAAT
GACGTTGTCAATGGATCAAAGTAAAAGGCCGATATCAGAGCCTTCAAATG
ACATGAAGACTGCAGCTGAAAATAGAAACGAAGACAACGGTTATTTTCAT
TCCTCCGATGACAAGAACAGCAGCGCAGATAATTCTGAGACTTCTCCGAA
AATTATCACTTCTCATGGTCACCGATCTATGGACCAATTTCTGAATGATA
GTTTGAAAATGTACCAGCAAAAAGATGGGAATGATAAAAATGGAAACGAC
AGTGATCTCTGTAGTTTAGAAAACAATGAAATTAAATTCGAAGAAAATCC
AGAACGTGATGAGGATAATAGTAAGGAACATGAAATTATTAGTCTGACTA
ATATTACTGAAAATCAAAAAGAAAATGAACTAGAAAAAGAAGATTGTGGA
GATATGAAGGAAGATGTTCAAAGACATGATTCCTTTGAATTCAACACAAA
CATCTCAATGGAAAAACCGTTTGAAAGTATCGAAAATTCTTATAAAAAAT
CTGAAATATTGAATAAAAGCGATGATAATGAACGTGATGATATTTCAGAA
AATGACACAAATGAGGCGAATTCAATGGCAAATATTGACAAAAACAATGA
AATAATTTCATATTTGTCTGTCGAGGATGAGAAAATTGAAGAAGCTTCAA
AAACCAAAGAAGTAGATTTTACAGATAATATTGATTTGAAAAACGATGAC
GAAACTCCTGAGAATTCGGATCTAGTAAAAGACTATGGAAAGTTTGGCAG
AAATAGTGATTACAATGATAGCGAGAAAGAGCATGAATGTTCAAATAAAG
ACTATGTTACCAATCTACCGGAAGCAAATTACGCTGATGAAGTAGACAAA
TGCAGTGAAAACAAATTGGATTACGTGAAACATCAAATATCAGAAAATGA
AAATTATAAAGATACATCAAAGGAAATTGCTATGGAAACAGAGGATGGAA
ATCAAATGTCCCTCGGTGACTTTATTGGGAATACAAAATTCTCTGGTATC
TTAGAAAGTCAATCAAACAAGGACACAGACGAATCTGACATGGAGCTAGA
TAAACATTCCAAAAATGTTGAAGAAAATAGTGACCAACAGCGACTATCAA
AATCATCAAGTTTAAAAGATGACAATAGCGATGGCGATAATACATCAAAT
AAAGAGGATTCAATTCTATCTGAACCTGTTAAGAACAATCTCAACACTTC
AAATAACGAAAAGCAGTATAATTTAATTGAAAAAGATGAGAAGACTTCTG
ATATATTAAAAGGTTTCATTGGGAATGAAGATAAATCTATTTCAAGTACA
AGTGAAGACCATGATGAAAATGATGATGAGGTTTTGAGTGAGAATGAGAA
TGAGAATGAGAATGAGAATGAGAATGAGAATGAGAATGAGAAAGTAGAAA
ATGAAAATTCCGAAGCGATTTTAAATATGAACAAAGATTTGAGTAAATTT
AAGGAAAAAGAAATTGATAGCAAATCTTCATCAGAAGTTTCATATGACAA
TGAAGAGTTAGAAAAAGAAATGAGTGACAGTGAAGAGATAGGAAAAGAAA
TGAGTGATAATGAAGAGTTAGGAAAGGAAGCAAGTAACAATGAAGATTTA
GAAAGAGAAACGAGTGACATTGATGAAAAGGATGATTCTGTCATTATCCG
AGAAACTATTAAAATTTCTAGAGAAGACATCAATAATGTTGCTAAAATTA
ACGATGATCCCTTTGATTCGAGTATTAAAATAAATTCTGACGAAGAAAGA
TTGCGGGAAAATCAAATGTTCAACTTTCCAATTCAGAAAACAATTGAGTC
AGATATAGAAAAAGATGGGATAAGTGAAAAATCAAATCATGATTTTGAAG
AGGAAAATGAGGAATCTGAACACTTTCAAGAAAGAAGAGATGATTTAGAT
GTTAGTTTCAATAACAGTCCTAAAGAACAATACGATAGAATAAATATTCA
ACGGAAAGATTCGTCTGAATTTGATGAAGATCATAGACCATTTGGTCAAA
ACCTATCCGATGAAAAGGTCCTAGAATTAGACTTTAATAATGATAAACTA
GAACAATTTAATAGAATTGATACCCATCAGAATGAAGCACCTAATTGCAT
AGAAAATACTGAAAGTCAATTAGCGGATGCAGCGGATCATACAATTCAAC
AAGAAATTGAAGGCTTCAAGGAGTCAGCTGAGAAAGATCAAATGGAACAA
TATAACAGAATAGATATGACATTAGATAACTCTGTACATTGCATAGAAGA
AAAGCGTGGATCATTGACAAGTGTGTCAGATTGTGGGGGTTCAGAATTAG
AGATTGGGCATAAAGTTAGCAATATTACAGAGGTTGCAGATGAAAATGAT
TCAAATGACTGTCAAAATATTATTGGAAAAGGAAATTCGTTGATATCTGA
AACTTCTGATAATGAAAAAGATAGTATTGATGAAGAGTTAGAATTAAGTG
AAACAAATGAAGAAATTTATGAAAATAAAAATATCAATACAGATTTATAT
GAGGATGAATTTGCGAAAAATAAAGCTGCCACTATAATTCAAGAGAGTTT
CCGGAAACATCTAGAAAGAGCAGATAGGTTTCCTAACTCAGAACATGGAG
ACACTGAAAACGAAATTGACTCAGAATTAAAGCTAGAAAAAACTGAAAGT
CACAACGAGAACGAACCGGTTTCTGATAATTCCAAAGAATTGGTAAGTAA
TCACGAAATAGATCCGGATGATGCCGCTGCCATTATTCAAAAGAGCTTCC
GAGAACATTTAACTAGAAAGGATTTGGTCAGAGATAGCAAACCTTCAGAC
AATATTGAACTAGAAAACCAGATTAGTGAATTTAAAATTGATAACAATGA
AAAGAATAACTCAGAAAGTTTAATTCAACTTACAAATCCAAAAGAAGAAC
AAGATTACGCTGCGAAAATGATTCAAAAAACTTTTCGTGGTCATTTAGTT
AGAAAAGAATTGGTTCATCATAATAAGCAATTAGACGCTGAAGAAGACCT
AGAATCAGAAGGTGAACAACACAGAAGTTATGATGTAAAAGATTCCGACG
ATGAAAATGATCCGGATATAAATTTTTCTTTATTGAAGGACGCAACCAAT
GACTTGAACACGGAAGAAATATTGGATGATCATTCTCAGTTAGACAATAC
GTATTCTGATGATGCCTTTGCTCTTAACAATAAATTTTAATGCAGTCTGT
GAAATGGTTTCGTTAATCTTATGCATCAGTCATATCAAATCCATTATGCC
TTTTTCATCACGAGCTGAC
back to top

protein sequence of SMED30003384-orf-1

>SMED30003384-orf-1 ID=SMED30003384-orf-1|Name=SMED30003384-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1234bp
MTSRYMIDIENRKSKIIHVYRNGDKYNRAALVLLRPMEQQKLERIFKAIE
EKLTLPYNKPIKRIFTIKGREIDDPIMIKDQKYYVVSSLENFVNTRYGSI
IKWAIIGPVKWSKFADVFYEPPEQEDLSTGNKVIYRWKNPTQSSARFPSK
MTKSMSAYPSDRKTTKPSRVMTLSMDQSKRPISEPSNDMKTAAENRNEDN
GYFHSSDDKNSSADNSETSPKIITSHGHRSMDQFLNDSLKMYQQKDGNDK
NGNDSDLCSLENNEIKFEENPERDEDNSKEHEIISLTNITENQKENELEK
EDCGDMKEDVQRHDSFEFNTNISMEKPFESIENSYKKSEILNKSDDNERD
DISENDTNEANSMANIDKNNEIISYLSVEDEKIEEASKTKEVDFTDNIDL
KNDDETPENSDLVKDYGKFGRNSDYNDSEKEHECSNKDYVTNLPEANYAD
EVDKCSENKLDYVKHQISENENYKDTSKEIAMETEDGNQMSLGDFIGNTK
FSGILESQSNKDTDESDMELDKHSKNVEENSDQQRLSKSSSLKDDNSDGD
NTSNKEDSILSEPVKNNLNTSNNEKQYNLIEKDEKTSDILKGFIGNEDKS
ISSTSEDHDENDDEVLSENENENENENENENENEKVENENSEAILNMNKD
LSKFKEKEIDSKSSSEVSYDNEELEKEMSDSEEIGKEMSDNEELGKEASN
NEDLERETSDIDEKDDSVIIRETIKISREDINNVAKINDDPFDSSIKINS
DEERLRENQMFNFPIQKTIESDIEKDGISEKSNHDFEEENEESEHFQERR
DDLDVSFNNSPKEQYDRINIQRKDSSEFDEDHRPFGQNLSDEKVLELDFN
NDKLEQFNRIDTHQNEAPNCIENTESQLADAADHTIQQEIEGFKESAEKD
QMEQYNRIDMTLDNSVHCIEEKRGSLTSVSDCGGSELEIGHKVSNITEVA
DENDSNDCQNIIGKGNSLISETSDNEKDSIDEELELSETNEEIYENKNIN
TDLYEDEFAKNKAATIIQESFRKHLERADRFPNSEHGDTENEIDSELKLE
KTESHNENEPVSDNSKELVSNHEIDPDDAAAIIQKSFREHLTRKDLVRDS
KPSDNIELENQISEFKIDNNEKNNSESLIQLTNPKEEQDYAAKMIQKTFR
GHLVRKELVHHNKQLDAEEDLESEGEQHRSYDVKDSDDENDPDINFSLLK
DATNDLNTEEILDDHSQLDNTYSDDAFALNNKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR003533Doublecortin_dom
IPR000048IQ_motif_EF-hand-BS
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding