Transmembrane protein 18

Overview
NameTransmembrane protein 18
Smed IDSMED30003376
Length (bp)513
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 18 (SMED30003376) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 18 (SMED30003376) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 18 (SMED30003376) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 18 (SMED30003376) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003376

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30003376SMESG000023757.1 SMESG000023756.1 dd_Smed_v4_10110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003376SMESG000023757.1 SMESG000023756.1 dd_Smed_v4_10110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 18 vs. Ensembl Human
Match: TMEM18 (transmembrane protein 18 [Source:HGNC Symbol;Acc:HGNC:25257])

HSP 1 Score: 63.1586 bits (152), Expect = 1.090e-12
Identity = 40/111 (36.04%), Postives = 62/111 (55.86%), Query Frame = 2
Query:  101 FLSIDWFKEKWILAILFGHITITICISLCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQ 433
            +L  DW  E W++ +   H    +   L  +   +    F+ +  +V+ A YINE A +NW+ FS   YFDS+GMFISI  S P+++N + I+ +W  K  N+M D+K  Q
Sbjct:    5 YLQTDW-TEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAPLLVNAMIIVVMWVWKTLNVMTDLKNAQ 114          
BLAST of Transmembrane protein 18 vs. Ensembl Human
Match: TMEM18 (transmembrane protein 18 [Source:HGNC Symbol;Acc:HGNC:25257])

HSP 1 Score: 62.003 bits (149), Expect = 3.313e-12
Identity = 41/117 (35.04%), Postives = 62/117 (52.99%), Query Frame = 2
Query:   83 HNFTDYFLSIDWFKEKWILAILFGHITITICISLCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQ 433
            H      L  DW  E W++ +   H    +   L  +   +    F+ +  +V+ A YINE A +NW+ FS   YFDS+GMFISI  S P+++N + I+ +W  K  N+M D+K  Q
Sbjct:   15 HLRASGLLQTDW-TEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAPLLVNAMIIVVMWVWKTLNVMTDLKNAQ 130          
BLAST of Transmembrane protein 18 vs. Ensembl Human
Match: TMEM18 (transmembrane protein 18 [Source:HGNC Symbol;Acc:HGNC:25257])

HSP 1 Score: 61.2326 bits (147), Expect = 6.631e-12
Identity = 39/107 (36.45%), Postives = 60/107 (56.07%), Query Frame = 2
Query:  113 DWFKEKWILAILFGHITITICISLCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQ 433
            DW  E W++ +   H    +   L  +   +    F+ +  +V+ A YINE A +NW+ FS   YFDS+GMFISI  S P+++N + I+ +W  K  N+M D+K  Q
Sbjct:   22 DW-TEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAPLLVNAMIIVVMWVWKTLNVMTDLKNAQ 127          
BLAST of Transmembrane protein 18 vs. Ensembl Fly
Match: Tmem18 (gene:FBgn0050051 transcript:FBtr0114521)

HSP 1 Score: 73.1738 bits (178), Expect = 1.201e-16
Identity = 48/132 (36.36%), Postives = 73/132 (55.30%), Query Frame = 2
Query:   71 INKIHNFTDYFLSIDWFKEKWILAILFGHITITICISLCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQLITKEKEKKNQ 466
            +N+I+ +  + LSIDW K+ W++ ++  HI  T    L R        LF+ +   V+    INEFA  NW  FS + YFDS G+FIS   S PI++N + ++G W      LM+ +K  QL  KE+ +K +
Sbjct:    8 VNEINGYWTFLLSIDW-KDPWLIGLILAHILTTTTALLSRNSSNFQVFLFLVLLLAVYFTESINEFAANNWSSFSRQQYFDSNGLFISTVFSIPILLNCMLLIGTWLYNSTQLMVTLKTAQL--KERARKER 136          
BLAST of Transmembrane protein 18 vs. Ensembl Zebrafish
Match: tmem18 (transmembrane protein 18 [Source:NCBI gene;Acc:449559])

HSP 1 Score: 72.4034 bits (176), Expect = 2.892e-16
Identity = 52/150 (34.67%), Postives = 83/150 (55.33%), Query Frame = 2
Query:   53 FSNLPVINKIHNFTDYFLSIDWFKEKWILAILFGHI-----TITIC----ISLCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQL---ITKEKEKKNQ 466
            FSN+    +I +   +  S+DW  E W++A+L  H+     T+  C    I +C          F+ M ++V++A Y+NE A +NW+ FS   YFDSKGMFIS+  S P+++N + I+ +W  + F+ M ++K  QL     +E  KK Q
Sbjct:   17 FSNV----RITSIWTFLQSVDW-SEPWLMALLAFHVFCFAFTLLSCKYYRIQICH---------FLLMVAMVYSAEYLNELAAMNWRSFSKFQYFDSKGMFISLVYSVPLLLNTVIIVAVWVWRTFSTMTELKILQLKRKAARENHKKTQ 152          
BLAST of Transmembrane protein 18 vs. Ensembl Xenopus
Match: tax1bp3 (Tax1 binding protein 3 [Source:Xenbase;Acc:XB-GENE-483851])

HSP 1 Score: 60.8474 bits (146), Expect = 7.740e-12
Identity = 40/109 (36.70%), Postives = 60/109 (55.05%), Query Frame = 2
Query:  107 SIDWFKEKWILAILFGHITITICISLCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQ 433
             IDW KE W++ +   HI   I   +  K   +    F+ M  +V  A YINEFA ++W+ +S + YFDS GMFIS+  S P++ N + I+  W  K   +M ++K  Q
Sbjct:   15 PIDW-KEPWLIGLAVFHILCLIVTYVSFKSYPLQICHFLLMVVLVSCAEYINEFAAMHWRSYSKQQYFDSSGMFISLAFSAPLLCNTIIIVVHWVYKTLCVMTELKTLQ 122          
BLAST of Transmembrane protein 18 vs. Ensembl Mouse
Match: Tmem18 (transmembrane protein 18 [Source:MGI Symbol;Acc:MGI:2387176])

HSP 1 Score: 58.151 bits (139), Expect = 7.134e-11
Identity = 31/72 (43.06%), Postives = 48/72 (66.67%), Query Frame = 2
Query:  218 FITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQ 433
            F+ +  +V++A YINE A +NW+ FS   YFDS+GMFIS+  S P++ N + I+ +W +K   +M D+K  Q
Sbjct:   56 FLCLVVLVYSAEYINEVAAVNWRLFSKYQYFDSRGMFISLVFSAPLLFNAMLIVIMWVRKTLTVMTDLKTLQ 127          
BLAST of Transmembrane protein 18 vs. UniProt/SwissProt
Match: sp|Q641M3|TMM18_DANRE (Transmembrane protein 18 OS=Danio rerio OX=7955 GN=tmem18 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.183e-15
Identity = 52/150 (34.67%), Postives = 83/150 (55.33%), Query Frame = 2
Query:   53 FSNLPVINKIHNFTDYFLSIDWFKEKWILAILFGHI-----TITIC----ISLCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQL---ITKEKEKKNQ 466
            FSN+    +I +   +  S+DW  E W++A+L  H+     T+  C    I +C          F+ M ++V++A Y+NE A +NW+ FS   YFDSKGMFIS+  S P+++N + I+ +W  + F+ M ++K  QL     +E  KK Q
Sbjct:   17 FSNV----RITSIWTFLQSVDW-SEPWLMALLAFHVFCFAFTLLSCKYYRIQICH---------FLLMVAMVYSAEYLNELAAMNWRSFSKFQYFDSKGMFISLVYSVPLLLNTVIIVAVWVWRTFSTMTELKILQLKRKAARENHKKTQ 152          
BLAST of Transmembrane protein 18 vs. UniProt/SwissProt
Match: sp|Q3SZ36|TMM18_BOVIN (Transmembrane protein 18 OS=Bos taurus OX=9913 GN=TMEM18 PE=2 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 7.090e-12
Identity = 38/119 (31.93%), Postives = 67/119 (56.30%), Query Frame = 2
Query:  113 DWFKEKWILAILFGHITITICISLCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIK--RKQLITKEKEKKN 463
            DW  E W++ +   H+   +      +   +    F+ + ++V+ A YINE A +NW+ FS   YFDS+GMFIS+  S P+++N L I+ +W +K   +M D++  R+Q   + + K+ 
Sbjct:   22 DW-TEPWLVGLAGFHVLCLLLTCFSSQRYRLQVGHFLCLVTLVYCAEYINEVAAMNWRLFSKHQYFDSRGMFISLVFSAPLLLNALVIVVLWVRKTLVVMTDLRSLREQRRARARPKEE 139          
BLAST of Transmembrane protein 18 vs. UniProt/SwissProt
Match: sp|Q5F410|TMM18_CHICK (Transmembrane protein 18 OS=Gallus gallus OX=9031 GN=TMEM18 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.609e-11
Identity = 36/82 (43.90%), Postives = 54/82 (65.85%), Query Frame = 2
Query:  218 FITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKR-KQLITKEKEKK 460
            F+ M  +V+ A YINE A +NW+ FS   YFDS+GMFIS+  S P+++N + I+  W  +  N+M ++K  +Q I  EK+KK
Sbjct:   60 FLCMVCLVYCAEYINELAAMNWRLFSKYQYFDSRGMFISLVFSAPLLVNTIIIVVNWVYRTLNVMTELKTLQQRIKAEKDKK 141          
BLAST of Transmembrane protein 18 vs. UniProt/SwissProt
Match: sp|Q96B42|TMM18_HUMAN (Transmembrane protein 18 OS=Homo sapiens OX=9606 GN=TMEM18 PE=1 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 3.184e-11
Identity = 39/107 (36.45%), Postives = 60/107 (56.07%), Query Frame = 2
Query:  113 DWFKEKWILAILFGHITITICISLCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQ 433
            DW  E W++ +   H    +   L  +   +    F+ +  +V+ A YINE A +NW+ FS   YFDS+GMFISI  S P+++N + I+ +W  K  N+M D+K  Q
Sbjct:   22 DW-TEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAPLLVNAMIIVVMWVWKTLNVMTDLKNAQ 127          
BLAST of Transmembrane protein 18 vs. UniProt/SwissProt
Match: sp|Q28GF5|TMM18_XENTR (Transmembrane protein 18 OS=Xenopus tropicalis OX=8364 GN=tmem18 PE=2 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 4.100e-11
Identity = 40/109 (36.70%), Postives = 60/109 (55.05%), Query Frame = 2
Query:  107 SIDWFKEKWILAILFGHITITICISLCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQ 433
             IDW KE W++ +   HI   I   +  K   +    F+ M  +V  A YINEFA ++W+ +S + YFDS GMFIS+  S P++ N + I+  W  K   +M ++K  Q
Sbjct:   15 PIDW-KEPWLIGLAVFHILCLIVTYVSFKSYPLQICHFLLMVVLVSCAEYINEFAAMHWRSYSKQQYFDSSGMFISLAFSAPLLCNTIIIVVHWVYKTLCVMTELKTLQ 122          
BLAST of Transmembrane protein 18 vs. TrEMBL
Match: A0A5A9NER9 (Transmembrane protein 18 OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti017974 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 2.941e-17
Identity = 53/152 (34.87%), Postives = 87/152 (57.24%), Query Frame = 2
Query:   32 TNMNFSHFSNLPVIN----KIHNFTDYFLSIDWFKEKWILAILFGHITITICISLCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQL---ITKEKEKKNQ 466
            T+    + S++P+      +I +   +  S+DW  E W++ +L  H+       LCRK   +    F+ M ++V+TA Y+NE A + W+ FS   YFDSKGMFIS+  S P+++N + I+ IW  + F+ M+++K  QL     +EK KK+Q
Sbjct:    2 TDSKVKNTSSVPIDGYSNVRITSVWTFLQSVDW-SESWLMGLLAFHVFCFAVTVLCRKYYRLQIGQFLVMVAMVYTAEYLNELAAMKWRSFSRFQYFDSKGMFISLVYSIPLLLNTVIIVAIWVCRTFSTMVELKTVQLKRKAAREKLKKSQ 152          
BLAST of Transmembrane protein 18 vs. TrEMBL
Match: A0A3Q3N0D2 (Transmembrane protein 18 OS=Labrus bergylta OX=56723 PE=4 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.315e-16
Identity = 52/149 (34.90%), Postives = 88/149 (59.06%), Query Frame = 2
Query:   32 TNMNFSHFSNLPVINKIHNFTDYFLSIDWFKEKWILAILFGHITITICISL----CRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQLITKEKEKKNQ 466
            T++    FSNL    +I +   + +S+ W  E W++ +L  H+   +C+ L    CR     +  LF+ M  +V++A Y+NEFA +NW+ FS+  YFDSKGMFIS+  S P+++N + I+ +W  + F+ M ++K  QL  K + +K +
Sbjct:   10 TSIPIDEFSNL----RITSIWTFLMSVQW-SEPWLIGMLVFHV---VCLFLTVLTCRYYKAQI-CLFMLMAGLVYSAEYLNEFAAMNWRSFSNFQYFDSKGMFISLVYSIPLLLNTVIIVMVWVYRTFSTMTELKTLQLKRKARREKRE 149          
BLAST of Transmembrane protein 18 vs. TrEMBL
Match: A0A194PKM3 (Insulin-like growth factor-binding protein complex acid labile subunit OS=Papilio xuthus OX=66420 GN=RR46_13151 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.285e-15
Identity = 48/128 (37.50%), Postives = 77/128 (60.16%), Query Frame = 2
Query:   71 INKIHNFTDYFLSIDWFKEKWILAILFGHITITICISLCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQLITKEKE 454
            +N+I +F  Y  SI+W ++ W++A+L  HI +T      R       +LFIT+  +V+ +  INE A  NW  FS + YFDSKG+FIS+  S PI++N + ++G W  +   +M ++K+ QL  + KE
Sbjct:    7 VNEISDFVSYIRSIEW-RDPWLIALLSFHILVTFTCFSTRNYGNFQVILFITLLLLVYFSENINEVAARNWTLFSRQQYFDSKGLFISVVFSIPILLNCMIMVGSWLYQSTQIMTNLKKAQLRQRLKE 133          
BLAST of Transmembrane protein 18 vs. TrEMBL
Match: A0A0P7ZAE5 (Transmembrane protein 18-like OS=Scleropages formosus OX=113540 GN=Z043_102661 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.578e-15
Identity = 51/148 (34.46%), Postives = 83/148 (56.08%), Query Frame = 2
Query:   38 MNFSHFSNLPVINKIHNFT-----DYFLSIDWFKEKWILAILFGHITITICISLCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQLITKEKEKKNQ 466
            M   + S +P I+ I N        + LSIDW  E W++A+LF H+       L  +   +    F  +  +V++A Y+NE A +NW+ FS   YFDSKGMFIS+  S P+++N + I+G+W  + F  M ++K  QL  ++  ++N+
Sbjct:    1 MAKQNISTIP-IDAISNMRITSVWTFLLSIDW-SESWLVALLFFHLFCFAVTLLTTRFYRLQICYFTILAGMVYSAEYLNEMAAMNWRSFSKYQYFDSKGMFISLVFSAPLLLNTVVIVGLWVYRTFATMTELKTLQLKRRKAIRENK 146          
BLAST of Transmembrane protein 18 vs. TrEMBL
Match: A0A0A1WZ89 (Transmembrane protein 18 OS=Zeugodacus cucurbitae OX=28588 GN=tmem18 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.133e-15
Identity = 45/132 (34.09%), Postives = 72/132 (54.55%), Query Frame = 2
Query:   71 INKIHNFTDYFLSIDWFKEKWILAILFGHITITICISLCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQLITKEKEKKNQ 466
            +N+I  +  Y  SIDW  + W++ ++  HI  T+   + R        LF+ + S  + +  INEFA   WK FS + YFDS G+FIS   S PI++N + I+G W      +M+ +KR QL+ + K  + +
Sbjct:    9 VNEITGYWSYLASIDW-NDPWLIGLIALHILTTVTTLMTRNSTNFQIFLFLILLSAAYCSESINEFAAARWKSFSKQQYFDSNGLFISTVFSIPILLNCMLIIGAWMYNSLQIMVTLKRAQLLQQAKRDQQE 139          
BLAST of Transmembrane protein 18 vs. Ensembl Cavefish
Match: tmem18 (transmembrane protein 18 [Source:NCBI gene;Acc:111194052])

HSP 1 Score: 63.929 bits (154), Expect = 4.126e-13
Identity = 35/86 (40.70%), Postives = 57/86 (66.28%), Query Frame = 2
Query:  218 FITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQL---ITKEKEKKNQ 466
            F+ M ++V++A Y+NE A +NW+ FS   YFDSKGMFIS+  S P++ N + I+ +W ++ F+ M ++K  QL     ++  KK+Q
Sbjct:   68 FLLMVAMVYSAEYLNEVAAMNWRSFSKFQYFDSKGMFISLVYSVPLLFNSIIIVAVWVKRTFSTMTELKTLQLNRKAARQNAKKSQ 153          
BLAST of Transmembrane protein 18 vs. Ensembl Cavefish
Match: ENSAMXT00000042551.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002164.1:12495:16685:1 gene:ENSAMXG00000036751.1 transcript:ENSAMXT00000042551.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 7.924e-12
Identity = 34/86 (39.53%), Postives = 57/86 (66.28%), Query Frame = 2
Query:  218 FITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQL---ITKEKEKKNQ 466
            F+ M ++V++A Y+NE A +NW++F    YFDSKGMFIS+  S P++ N + I+ +W ++ F+ M ++K  QL     ++  KK+Q
Sbjct:    7 FLLMVAMVYSAEYLNEVAAMNWRQF---QYFDSKGMFISLVYSVPLLFNSIIIVAVWVKRTFSTMTELKTLQLKRKAARQNAKKSQ 89          
BLAST of Transmembrane protein 18 vs. Ensembl Cavefish
Match: ENSAMXT00000042259.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002164.1:12145:16685:1 gene:ENSAMXG00000036751.1 transcript:ENSAMXT00000042259.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 6.375e-9
Identity = 31/82 (37.80%), Postives = 54/82 (65.85%), Query Frame = 2
Query:  233 SIVFTASYINEFAGLNWKKFSHE-NYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQL---ITKEKEKKNQ 466
            ++V++A Y+NE A +NW++   +  YFDSKGMFIS+  S P++ N + I+ +W ++ F+ M ++K  QL     ++  KK+Q
Sbjct:   41 AMVYSAEYLNEVAAMNWRQVIFKFQYFDSKGMFISLVYSVPLLFNSIIIVAVWVKRTFSTMTELKTLQLKRKAARQNAKKSQ 122          
BLAST of Transmembrane protein 18 vs. Ensembl Cavefish
Match: ENSAMXT00000047890.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002164.1:64916:68041:1 gene:ENSAMXG00000035795.1 transcript:ENSAMXT00000047890.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 1.006e-7
Identity = 32/84 (38.10%), Postives = 51/84 (60.71%), Query Frame = 2
Query:  248 ASYINEFAGLNWKKFSHE-NYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQLITKEKEK----KNQ*RPIWQ 484
            A Y+NE A +NW++   +  YFDSKGMFIS+  S P++ N + I+ +W ++ F+ M ++K  QL  K  +K     N  R +W+
Sbjct:   51 AEYLNEVAAMNWRQVIFKFQYFDSKGMFISLVYSVPLLFNSIIIVAVWVKRTFSTMTELKTLQLKRKAADKMLRNPNSWRLVWR 134          
BLAST of Transmembrane protein 18 vs. Ensembl Cavefish
Match: ENSAMXT00000050579.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002164.1:12145:16685:1 gene:ENSAMXG00000036751.1 transcript:ENSAMXT00000050579.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 1.679e-7
Identity = 30/77 (38.96%), Postives = 49/77 (63.64%), Query Frame = 2
Query:  248 ASYINEFAGLNWKKFSHE-NYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQL---ITKEKEKKNQ 466
            A Y+NE A +NW++   +  YFDSKGMFIS+  S P++ N + I+ +W ++ F+ M ++K  QL     ++  KK+Q
Sbjct:   56 AEYLNEVAAMNWRQVIFKFQYFDSKGMFISLVYSVPLLFNSIIIVAVWVKRTFSTMTELKTLQLKRKAARQNAKKSQ 132          
BLAST of Transmembrane protein 18 vs. Ensembl Medaka
Match: tmem18 (transmembrane protein 18 [Source:NCBI gene;Acc:101158989])

HSP 1 Score: 61.2326 bits (147), Expect = 4.337e-12
Identity = 33/83 (39.76%), Postives = 54/83 (65.06%), Query Frame = 2
Query:  218 FITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQLITKEKEKKNQ 466
            F+ +  +V+ A Y+NE A +NW+ FS+  YFDSKGMFIS+  S P++ N + I+ +W  + F+ M ++K  QL  + + +K Q
Sbjct:   66 FLLLVGLVYCAEYLNELAAMNWRAFSNFQYFDSKGMFISLVFSIPLLFNAMIIVVVWVYRTFSTMTELKTLQLKREAQRQKRQ 148          
BLAST of Transmembrane protein 18 vs. Planmine SMEST
Match: SMESG000023756.1 (SMESG000023756.1)

HSP 1 Score: 259.225 bits (661), Expect = 6.336e-90
Identity = 142/143 (99.30%), Postives = 143/143 (100.00%), Query Frame = 2
Query:   38 MNFSHFSNLPVINKIHNFTDYFLSIDWFKEKWILAILFGHITITICISLCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMXXXXXXXXXXXXNLLFILGIWFQKIFNLMIDIKRKQLITKEKEKKNQ 466
            MNFSHFSNLPVINKIHNFTDYFLSIDWFKEKWILAILFGHITITICI+LCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMFISIFVSFPIIINLLFILGIWFQKIFNLMIDIKRKQLITKEKEKKNQ
Sbjct:    1 MNFSHFSNLPVINKIHNFTDYFLSIDWFKEKWILAILFGHITITICIALCRKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMFISIFVSFPIIINLLFILGIWFQKIFNLMIDIKRKQLITKEKEKKNQ 143          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 18 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TMEM181.090e-1236.04transmembrane protein 18 [Source:HGNC Symbol;Acc:H... [more]
TMEM183.313e-1235.04transmembrane protein 18 [Source:HGNC Symbol;Acc:H... [more]
TMEM186.631e-1236.45transmembrane protein 18 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Transmembrane protein 18 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 18 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tmem181.201e-1636.36gene:FBgn0050051 transcript:FBtr0114521[more]
back to top
BLAST of Transmembrane protein 18 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem182.892e-1634.67transmembrane protein 18 [Source:NCBI gene;Acc:449... [more]
back to top
BLAST of Transmembrane protein 18 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tax1bp37.740e-1236.70Tax1 binding protein 3 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Transmembrane protein 18 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tmem187.134e-1143.06transmembrane protein 18 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Transmembrane protein 18 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q641M3|TMM18_DANRE2.183e-1534.67Transmembrane protein 18 OS=Danio rerio OX=7955 GN... [more]
sp|Q3SZ36|TMM18_BOVIN7.090e-1231.93Transmembrane protein 18 OS=Bos taurus OX=9913 GN=... [more]
sp|Q5F410|TMM18_CHICK1.609e-1143.90Transmembrane protein 18 OS=Gallus gallus OX=9031 ... [more]
sp|Q96B42|TMM18_HUMAN3.184e-1136.45Transmembrane protein 18 OS=Homo sapiens OX=9606 G... [more]
sp|Q28GF5|TMM18_XENTR4.100e-1136.70Transmembrane protein 18 OS=Xenopus tropicalis OX=... [more]
back to top
BLAST of Transmembrane protein 18 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5A9NER92.941e-1734.87Transmembrane protein 18 OS=Triplophysa tibetana O... [more]
A0A3Q3N0D21.315e-1634.90Transmembrane protein 18 OS=Labrus bergylta OX=567... [more]
A0A194PKM31.285e-1537.50Insulin-like growth factor-binding protein complex... [more]
A0A0P7ZAE51.578e-1534.46Transmembrane protein 18-like OS=Scleropages formo... [more]
A0A0A1WZ892.133e-1534.09Transmembrane protein 18 OS=Zeugodacus cucurbitae ... [more]
back to top
BLAST of Transmembrane protein 18 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem184.126e-1340.70transmembrane protein 18 [Source:NCBI gene;Acc:111... [more]
ENSAMXT00000042551.17.924e-1239.53pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000042259.16.375e-937.80pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000047890.11.006e-738.10pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050579.11.679e-738.96pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Transmembrane protein 18 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 18 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 18 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 18 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem184.337e-1239.76transmembrane protein 18 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Transmembrane protein 18 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023756.16.336e-9099.30SMESG000023756.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003376 ID=SMED30003376|Name=Transmembrane protein 18|organism=Schmidtea mediterranea sexual|type=transcript|length=513bp
GCAGTGTTTAAATAAATAATAGATAATTGATACCAATATGAATTTTTCTC
ATTTTAGTAATTTACCTGTGATTAATAAAATTCACAATTTTACTGATTAC
TTTTTATCTATTGATTGGTTCAAGGAAAAGTGGATTTTAGCTATATTATT
TGGACATATTACAATTACAATCTGTATTTCCTTATGTCGAAAAGTAGATT
GGATGTTAACAGTTTTATTTATAACAATGGGTTCAATTGTTTTTACTGCT
AGTTATATTAATGAATTCGCTGGTCTTAATTGGAAGAAATTTTCACACGA
AAACTATTTTGATAGTAAAGGAATGTTTATTTCAATATTTGTCAGCTTTC
CTATTATTATTAATTTGTTATTTATATTAGGAATCTGGTTTCAGAAAATA
TTCAATCTCATGATCGACATCAAGCGAAAACAGTTAATAACAAAAGAAAA
GGAGAAAAAAAATCAATAAAGACCAATTTGGCAAGAGTTTATTACAAACA
CAATATATTTTAC
back to top

protein sequence of SMED30003376-orf-1

>SMED30003376-orf-1 ID=SMED30003376-orf-1|Name=SMED30003376-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=144bp
MNFSHFSNLPVINKIHNFTDYFLSIDWFKEKWILAILFGHITITICISLC
RKVDWMLTVLFITMGSIVFTASYINEFAGLNWKKFSHENYFDSKGMFISI
FVSFPIIINLLFILGIWFQKIFNLMIDIKRKQLITKEKEKKNQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026721TMEM18
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR026721Transmembrane protein 18PFAMPF14770TMEM18coord: 22..137
e-value: 3.4E-33
score: 114.2
NoneNo IPR availablePANTHERPTHR22593:SF2TRANSMEMBRANE PROTEIN 18coord: 14..141
NoneNo IPR availablePANTHERPTHR22593FAMILY NOT NAMEDcoord: 14..141
NoneNo IPR availableTMHMMTMhelixcoord: 58..80
NoneNo IPR availableTMHMMTMhelixcoord: 32..51
NoneNo IPR availableTMHMMTMhelixcoord: 95..117