Striatin Pro11

Overview
NameStriatin Pro11
Smed IDSMED30003375
Length (bp)2453
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Striatin Pro11 (SMED30003375) t-SNE clustered cells

Violin plots show distribution of expression levels for Striatin Pro11 (SMED30003375) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Striatin Pro11 (SMED30003375) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Striatin Pro11 (SMED30003375) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003375

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003375SMESG000072340.1 dd_Smed_v4_8286_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003375SMESG000072340.1 dd_Smed_v4_8286_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30003375SMESG000072340.1 dd_Smed_v4_8286_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Striatin Pro11 vs. Ensembl Human
Match: STRN3 (striatin 3 [Source:HGNC Symbol;Acc:HGNC:15720])

HSP 1 Score: 319.316 bits (817), Expect = 3.585e-96
Identity = 202/555 (36.40%), Postives = 297/555 (53.51%), Query Frame = 2
Query:  770 DSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSH--IIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE---IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D D EE L EFD++V     +       +    GD  EW K           VDQ +I+K+KE Y +ER   G K   ++N      +  +YD++ +    +  H   + +  I    +A   ++++  G +    +   F +   K     S   ++  L LGDLA LTV N+                +   D   +K D   +KTW+ ++TLRSHFDGVRA+ FHP +P+LV+ASED TLKLWNL KT+P+KK S SLDVEP+YT+R H  PVLSL +    +  FSG +D  I+ W +P  ++DPYD+++ ++       HTDAVW +    + N+L S S+DGTV+ W            N Q K L    T+N  +   IPT +  +       V  F  GS  I ++ T      L     SS+ D         N +V HPT  +TI  ++D HI+ FDN TG+++ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  C+QEIT HRKK DESI+ +AFH SK   A+AGAD L+KVF+
Sbjct:  295 DPDTEEALKEFDFLVTAEDGEG----AGEARSSGDGTEWDKDDLSPTAEVWDVDQGLISKLKEQYKKER--KGKKGVKRAN------RTKLYDMIADLGDDELPH---IPSGIINQSRSASTRMTDH-EGARAEEAEPITFPSGGGKSFIMGSDDVLLSVLGLGDLADLTVTNDA---------------DYSYDLPANK-DAF-RKTWNPKYTLRSHFDGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPAKK-SASLDVEPIYTFRAHIGPVLSLAISSNGEQCFSGGIDATIQWWNMPSPSVDPYDTYEPNVLAGTLVGHTDAVWGLAYSGIKNQLLSCSADGTVRLW------------NPQEK-LPCICTYNGDKKHGIPTSVDFIGCDPAHMVTSFNTGSAVIYDLETSQSLVIL-----SSQVDSGLQSNNHINRVVSHPTLPVTITAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHSSKAYIASAGADALAKVFV 797          

HSP 2 Score: 110.923 bits (276), Expect = 2.680e-24
Identity = 48/77 (62.34%), Postives = 61/77 (79.22%), Query Frame = 2
Query:   92 PILDECANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            P L     Y++ GI+ ++Q+EW + E++   WEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   55 PELSRPQQYTIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 131          
BLAST of Striatin Pro11 vs. Ensembl Human
Match: STRN (striatin [Source:HGNC Symbol;Acc:HGNC:11424])

HSP 1 Score: 316.62 bits (810), Expect = 2.341e-95
Identity = 201/562 (35.77%), Postives = 301/562 (53.56%), Query Frame = 2
Query:  764 GFDSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHII-------EDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE---IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            G D D +E L EFD++V   +       + +    GD  +W K           VDQ +I K+KE Y +ER G   K   + N      +  + D++ N    D D    +     P   +     S+ +   +++  D  +    P   +S KS I+        +L LG+LA LTV NE                +  T +  +  D L +KTW+ +FTLRSHFDG+RA+ FHP +P+L++ASED TLK+WNL KT P+KK S SLDVEP+YT+R HK PVL + +    +  +SG  DG I+ W      +DPYDS+D S+       HTDAVW +     + +L S S+DGT++ W            N        +  FND++   IP  + LV +     V  F+ G  SI NM     +T+ ++ +  S  D  +    + N ++ HPT  ++I  ++D HI+ +DNNTG+L+ S++ H ++V+ +AVD +G  +++GSHD ++R+WN+ +  CIQE T HRKKF+ESIH +AFHPSK   A+AGAD L+KVF+
Sbjct:  276 GEDRDTKEALKEFDFLVTSEEG------DNESRSAGDGTDWEKEDQCLMPEAWNVDQGVITKLKEQYKKERKG--KKGVKRPN------RSKLQDMLAN--LRDVDELPSLQ----PSVGSPSRPSSSRLPEHEINRADEVEALTFPP--SSGKSFIMGADEALESELGLGELAGLTVANEA---------------DSLTYDIANNKDAL-RKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKK-STSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNIDPYDSYDPSVLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLW------------NTTEVAPALS-VFNDTKELGIPASVDLVSSDPSHMVASFSKGYTSIFNM-----ETQQRILTLESNVDTTANSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV 780          

HSP 2 Score: 114.775 bits (286), Expect = 1.742e-25
Identity = 51/69 (73.91%), Postives = 60/69 (86.96%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            YSL GI+ FLQ+EW + E++  QWEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   47 YSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 115          
BLAST of Striatin Pro11 vs. Ensembl Human
Match: STRN (striatin [Source:HGNC Symbol;Acc:HGNC:11424])

HSP 1 Score: 303.523 bits (776), Expect = 6.697e-91
Identity = 164/396 (41.41%), Postives = 236/396 (59.60%), Query Frame = 2
Query: 1208 DLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE---IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            +L LG+LA LTV NE                +  T +  +  D L +KTW+ +FTLRSHFDG+RA+ FHP +P+L++ASED TLK+WNL KT P+KK S SLDVEP+YT+R HK PVL + +    +  +SG  DG I+ W      +DPYDS+D S+       HTDAVW +     + +L S S+DGT++ W            N        +  FND++   IP  + LV +     V  F+ G  SI NM T+     L+     S  D  +    + N ++ HPT  ++I  ++D HI+ +DNNTG+L+ S++ H ++V+ +AVD +G  +++GSHD ++R+WN+ +  CIQE T HRKKF+ESIH +AFHPSK   A+AGAD L+KVF+
Sbjct:  371 ELGLGELAGLTVANEA---------------DSLTYDIANNKDAL-RKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKK-STSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNIDPYDSYDPSVLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLW------------NTTEVAPALS-VFNDTKELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLE-----SNVDTTANSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV 731          

HSP 2 Score: 116.701 bits (291), Expect = 3.151e-26
Identity = 52/71 (73.24%), Postives = 61/71 (85.92%), Query Frame = 2
Query:  110 ANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            A YSL GI+ FLQ+EW + E++  QWEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   33 AQYSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 103          
BLAST of Striatin Pro11 vs. Ensembl Human
Match: STRN3 (striatin 3 [Source:HGNC Symbol;Acc:HGNC:15720])

HSP 1 Score: 298.516 bits (763), Expect = 3.572e-89
Identity = 166/395 (42.03%), Postives = 233/395 (58.99%), Query Frame = 2
Query: 1211 LSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE---IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            L LGDLA LTV N+                +   D   +K D   +KTW+ ++TLRSHFDGVRA+ FHP +P+LV+ASED TLKLWNL KT+P+KK S SLDVEP+YT+R H  PVLSL +    +  FSG +D  I+ W +P  ++DPYD+++ ++       HTDAVW +    + N+L S S+DGTV+ W            N Q K L    T+N  +   IPT +  +       V  F  GS  I ++ T      L     SS+ D         N +V HPT  +TI  ++D HI+ FDN TG+++ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  C+QEIT HRKK DESI+ +AFH SK   A+AGAD L+KVF+
Sbjct:  355 LGLGDLADLTVTNDA---------------DYSYDLPANK-DAF-RKTWNPKYTLRSHFDGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPAKK-SASLDVEPIYTFRAHIGPVLSLAISSNGEQCFSGGIDATIQWWNMPSPSVDPYDTYEPNVLAGTLVGHTDAVWGLAYSGIKNQLLSCSADGTVRLW------------NPQEK-LPCICTYNGDKKHGIPTSVDFIGCDPAHMVTSFNTGSAVIYDLETSQSLVIL-----SSQVDSGLQSNNHINRVVSHPTLPVTITAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHSSKAYIASAGADALAKVFV 713          

HSP 2 Score: 110.923 bits (276), Expect = 2.385e-24
Identity = 48/77 (62.34%), Postives = 61/77 (79.22%), Query Frame = 2
Query:   92 PILDECANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            P L     Y++ GI+ ++Q+EW + E++   WEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   55 PELSRPQQYTIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 131          
BLAST of Striatin Pro11 vs. Ensembl Human
Match: STRN4 (striatin 4 [Source:HGNC Symbol;Acc:HGNC:15721])

HSP 1 Score: 271.166 bits (692), Expect = 8.599e-80
Identity = 151/393 (38.42%), Postives = 226/393 (57.51%), Query Frame = 2
Query: 1208 DLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            ++SLGDLA LTV N+                N+ + +     D   KKTW+ +FTLRSH+DG+R++ FH SQ  L++ASED TLKLWNL K + +KK + +LDVEP++ +R H+ PVL++ +    +  +SG  D  I  W+IP  ++DPYD +D S+       H DAVW +     + +L S S+DGTV+ W            ++   CL    T ++  +PT +    T     V  F +G   + +M        L       ES G+S G  + N +V HP + +TI  +DD  IR  DN TG+ + S++ H  +V+C+AVD +G  +++GSHD ++R+W++    C+QEIT HRKK +E+IH +A HPSK L A+AGAD L+KVF+
Sbjct:  277 EVSLGDLADLTVTND----------------NDLSCDLSDSKDAF-KKTWNPKFTLRSHYDGIRSLAFHHSQSALLTASEDGTLKLWNLQKAVTAKK-NAALDVEPIHAFRAHRGPVLAVAMGSNSEYCYSGGADACIHSWKIPDLSMDPYDGYDPSVLSHVLEGHGDAVWGLAFSPTSQRLASCSADGTVRIW---------DPSSSSPACLCTFPTASEHGVPTSVAFTSTEPAHIVASFRSGDTVLYDMEVGSALLTL-------ESRGSS-GPTQINQVVSHPNQPLTITAHDDRGIRFLDNRTGKPVHSMVAHLDAVTCLAVDPNGAFLMSGSHDCSLRLWSLDNKTCVQEITAHRKKHEEAIHAVACHPSKALIASAGADALAKVFV 634          
BLAST of Striatin Pro11 vs. Ensembl Celegans
Match: cash-1 (CKA And Striatin Homolog [Source:UniProtKB/TrEMBL;Acc:G5EE12])

HSP 1 Score: 251.906 bits (642), Expect = 8.664e-73
Identity = 133/345 (38.55%), Postives = 195/345 (56.52%), Query Frame = 2
Query: 1355 WSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCL--LDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNN-KLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEI-PTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            W+ + TLRSH D +RA+ FHP +P+L +ASED  +KLWNL +    K  S   ++EPVYT+RGHK PVL L L      +++G +DG I  + +P    DP+DS+D  +       HTDA+W++  H +N +L SASSD TV+ W           GN +   L+ T     S I PT +  V T     +  +TN    II++ T                 G   G    N +V HPT  +T++G +D  IR FDN  G ++   + H + VS +A+D +G  +L+GSHD ++R+WNM    C+QEI+ HRKK D ++  +AFHPS++L  +AGAD L+KV++
Sbjct:  349 WNIKVTLRSHLDSIRAMQFHPVEPVLFTASEDGLIKLWNLDQKKDEKHNSGGTELEPVYTFRGHKGPVLCLVLSPTGDHLYTGGIDGNICCFNVPSSNGDPFDSYDPRVLTETLTGHTDAIWSVAYHSSNSRLVSASSDSTVRLWEP---------GNGE--PLIRTIGAPKSGILPTSVDFVSTETSHLLAAYTNCYAQIIDIDTGSTVMVFDF--------GAVTGSPTMNKIVSHPTMPLTLIGGEDRTIRYFDNTNGSIIHEAIAHVEGVSSLAIDPNGLYLLSGSHDGSIRMWNMEKRSCLQEISAHRKKNDSAVTSVAFHPSRSLIGSAGADSLAKVYV 674          

HSP 2 Score: 108.997 bits (271), Expect = 3.137e-24
Identity = 48/78 (61.54%), Postives = 63/78 (80.77%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGD 349
            Y+++GI+ F+Q+EWTK E+   +WE E+AE+QA+IA+LQGERK QENLK DL+RRIKMLE+ LKQER K   LT  G+
Sbjct:   24 YTMSGILHFIQHEWTKNELDRTRWEAERAEMQARIAFLQGERKGQENLKQDLVRRIKMLEFCLKQERAKNYRLTHNGE 101          
BLAST of Striatin Pro11 vs. Ensembl Celegans
Match: lis-1 (Lissencephaly-1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9NDC9])

HSP 1 Score: 64.6994 bits (156), Expect = 1.306e-10
Identity = 74/341 (21.70%), Postives = 138/341 (40.47%), Query Frame = 2
Query: 1373 LRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPV--LSLCLLDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDD--LFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIV---GYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVF 2374
            L  H   +  ++FHP   ++ S SED T+K+W+       + G +        T +GH   V  +++    + + S S D  I++W       D   ++D    L  +     +V        + + SAS D T+K W +               C+      ND      + ++  S+D  LF     + + ++ +  TK  K  L+    + E    +      N     P  + T +   G  D  I+ ++ NTG++L +LL H+  V  +A    G  +++ + D  +R+W ++   C++ I  H    +  +  +AFH +     T   D   KV+
Sbjct:  102 LTGHRLPITRVIFHPLWTIMASCSEDATIKVWDY------ETGQLE------RTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLW-------DFGQTYDCLKSLKGHEHTVSSV--TFLPTGDFVLSASRDHTIKQWDISTGY-----------CVYTFRGHND-----WVRMIRISNDGTLFASASLDQTVTVWSFATKSAKLVLRDHEHAVECVEWAPDTAYTNVTGQQPEGNSTHILFSGSRDRSIKAWNINTGDVLFTLLAHENWVRGLAFHPKGKYLISVADDKTLRVWELSAQRCMKAIEAH----EHFVSTVAFHQTSPFVITGSVDMSCKVW 401          
BLAST of Striatin Pro11 vs. Ensembl Celegans
Match: pfs-2 (Polyadenylation Factor Subunit homolog [Source:UniProtKB/TrEMBL;Acc:U4PN22])

HSP 1 Score: 60.077 bits (144), Expect = 5.884e-9
Identity = 67/277 (24.19%), Postives = 118/277 (42.60%), Query Frame = 2
Query: 1547 KSPVLSLCLLDQ--LIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNK-LFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSH--IRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHP-SKNLFATAGADG 2359
            K PV S+C   +   + +G   GE  +W           +F+    L A   H  A+ A+    N + L SA   G VK W  +++       NA      + ++ +  E    +   PT D  F     +G+  + +      +  L+         G+   V    C+  HPTK +   G  D+   ++ +D  +G  L++L  H+ SV  +  + +G  +LTG  D  V+++++     ++E+  +R    E I  LA+HP  + LF + G DG
Sbjct:  144 KCPVYSVCWSPEGKRLITGCQTGEFTLWN--------GTAFNFETILQA---HDSAIRALKWASNEQWLLSADQGGYVKYWQPNMN-------NA------HMFSAHKDEAIRGLAFAPT-DVKFATASDDGTARVWDFARYTEERVLR---------GHGAEV---RCIDWHPTKGLIATGSRDTQQPVKIWDPKSGSCLATLQEHKSSVMAVEFNKNGNWLLTGGRDHLVKMYDIR---MMKEMRTYRAHKKEVI-SLAWHPIHEGLFVSGGGDG 379          
BLAST of Striatin Pro11 vs. Ensembl Celegans
Match: wdr-48 (WD repeat-containing protein 48 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q20059])

HSP 1 Score: 59.6918 bits (143), Expect = 7.811e-9
Identity = 79/311 (25.40%), Postives = 116/311 (37.30%), Query Frame = 2
Query: 1469 NLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLDQLIFSGSLDGEIRIWRIP---------VGALDPYDSFDSSIQLSAYF-QHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFT-NGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRA-NCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGL 2362
            N ++T P KK S  +  E  Y+ R   S  L     +  +F+G  D  IR W +P          G   P    +S +Q      QHTD V  M LC     L SAS+D TVK W ++ D         +H  +    T  D    +C+   P  +      F  N     IN   K +               N +G   +   L   P  S+ +    +  IR FD  T E +  L  H  +V  + V+  G   L+   D  +R+W++    CI     H    +E +  L    S     +AG D +
Sbjct:    6 NTSQTGPKKKISFIIRDEHEYSNRSAVS-ALQYDAQNGRLFTGGSDTIIRTWSVPHHKDAFSARGGVRSP--GKNSPVQYQGSLEQHTDWVNDMILCGHGKILISASNDTTVKVWNIERD--------NKHGFIDCIRTHKD--YVSCLAYAPIVEKAVSASFDHNIFVYDINANFKTV--------------NNLIGCKDSIYSLATTPNLSLVLGAGTEKCIRLFDPRTNEKIMKLRGHTDNVRALVVNDDGTRALSAGSDATIRLWDIGQQRCIATCIAH----EEGVWTLQVDSSFTTVYSAGKDKM 285          
BLAST of Striatin Pro11 vs. Ensembl Celegans
Match: wdr-48 (WD repeat-containing protein 48 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q20059])

HSP 1 Score: 59.3066 bits (142), Expect = 8.711e-9
Identity = 79/311 (25.40%), Postives = 116/311 (37.30%), Query Frame = 2
Query: 1469 NLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLDQLIFSGSLDGEIRIWRIP---------VGALDPYDSFDSSIQLSAYF-QHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFT-NGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRA-NCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGL 2362
            N ++T P KK S  +  E  Y+ R   S  L     +  +F+G  D  IR W +P          G   P    +S +Q      QHTD V  M LC     L SAS+D TVK W ++ D         +H  +    T  D    +C+   P  +      F  N     IN   K +               N +G   +   L   P  S+ +    +  IR FD  T E +  L  H  +V  + V+  G   L+   D  +R+W++    CI     H    +E +  L    S     +AG D +
Sbjct:    6 NTSQTGPKKKISFIIRDEHEYSNRSAVS-ALQYDAQNGRLFTGGSDTIIRTWSVPHHKDAFSARGGVRSP--GKNSPVQYQGSLEQHTDWVNDMILCGHGKILISASNDTTVKVWNIERD--------NKHGFIDCIRTHKD--YVSCLAYAPIVEKAVSASFDHNIFVYDINANFKTV--------------NNLIGCKDSIYSLATTPNLSLVLGAGTEKCIRLFDPRTNEKIMKLRGHTDNVRALVVNDDGTRALSAGSDATIRLWDIGQQRCIATCIAH----EEGVWTLQVDSSFTTVYSAGKDKM 285          
BLAST of Striatin Pro11 vs. Ensembl Fly
Match: Cka (gene:FBgn0044323 transcript:FBtr0306000)

HSP 1 Score: 311.997 bits (798), Expect = 3.740e-94
Identity = 168/405 (41.48%), Postives = 238/405 (58.77%), Query Frame = 2
Query: 1172 NKRNSQKSHIIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE-IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            N  N     +   L LG+LA LTVNNE         S   +  N +     S      +KTW+A++TLRSHFDGVR+++FHP +P+L++ASED TLKLWNL KT+ +KK S SLDVEP+YT+R H  PVL L +    +  +SG LDG I  W++P   +DPYD +D ++       HTDAVW  L  + + + S S+DGTVK W                + LL TYT +++E +P+ +  V    D  VV + +  C + +  T     RL+     S + G  +     N +V HPT  +TI  ++D HIR +DN +G L+ S++ H + V+ +AVD  G  +L+GSHD ++R+WN+    C+QEIT HRKKFDESI  +AFH +K   A+AGADGL+KVF+
Sbjct:  372 NDMNLMTEEVDGSLGLGELAQLTVNNE---------SDGAYDANSKDGTGGSAGGAGYRKTWNAKYTLRSHFDGVRSLIFHPEEPVLITASEDHTLKLWNLQKTVQAKK-SASLDVEPLYTFRAHTGPVLCLGMSSSGETCYSGGLDGNIECWQLPSPNIDPYDCYDPNVHSGTLEGHTDAVWG-LTTMQSNIVSCSADGTVKLW-----------SPYNKEPLLRTYTASEAEGVPSSVDFVRNEVDHIVVAYNSAHCIVYDTETGKQVVRLEAAQEMSGNTGKFI-----NKVVSHPTLPITITAHEDRHIRFWDNTSGTLVHSMVAHLEPVTSLAVDAHGLYLLSGSHDCSIRLWNLDNKTCVQEITAHRKKFDESIFDVAFHATKPYIASAGADGLAKVFV 749          

HSP 2 Score: 102.834 bits (255), Expect = 3.337e-22
Identity = 57/150 (38.00%), Postives = 90/150 (60.00%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKIND--ENIKWKDEKIRLKKLILDMNDGD---DLRNSR 550
            Y++ GI+ F+Q+EW++ E++  QW+V++AELQA+IA L GERKC E+LK DL RRIKMLEYAL+QER K   L    D             NE K   +D+ +  E++ +++       N  W+  +  L++ + ++   D   D+R++R
Sbjct:   97 YTIPGILHFIQHEWSRFELERSQWDVDRAELQARIAMLLGERKCLESLKSDLTRRIKMLEYALRQERAKFYRLKYGTDPPQ---------LNEFKPSNEDAGLAGEVATDSEVPYSSVSNTTWRQGRQMLRQYLAEIGYTDNIIDVRSNR 237          
BLAST of Striatin Pro11 vs. Ensembl Fly
Match: Cka (gene:FBgn0044323 transcript:FBtr0079538)

HSP 1 Score: 311.227 bits (796), Expect = 4.219e-94
Identity = 166/392 (42.35%), Postives = 235/392 (59.95%), Query Frame = 2
Query: 1211 LSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE-IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            L LG+LA LTVNNE         S   +  N +     S      +KTW+A++TLRSHFDGVR+++FHP +P+L++ASED TLKLWNL KT+ +KK S SLDVEP+YT+R H  PVL L +    +  +SG LDG I  W++P   +DPYD +D ++       HTDAVW  L  + + + S S+DGTVK W                + LL TYT +++E +P+ +  V    D  VV + +  C + +  T     RL+     S + G  +     N +V HPT  +TI  ++D HIR +DN +G L+ S++ H + V+ +AVD  G  +L+GSHD ++R+WN+    C+QEIT HRKKFDESI  +AFH +K   A+AGADGL+KVF+
Sbjct:  366 LGLGELAQLTVNNE---------SDGAYDANSKDGTGGSAGGAGYRKTWNAKYTLRSHFDGVRSLIFHPEEPVLITASEDHTLKLWNLQKTVQAKK-SASLDVEPLYTFRAHTGPVLCLGMSSSGETCYSGGLDGNIECWQLPSPNIDPYDCYDPNVHSGTLEGHTDAVWG-LTTMQSNIVSCSADGTVKLW-----------SPYNKEPLLRTYTASEAEGVPSSVDFVRNEVDHIVVAYNSAHCIVYDTETGKQVVRLEAAQEMSGNTGKFI-----NKVVSHPTLPITITAHEDRHIRFWDNTSGTLVHSMVAHLEPVTSLAVDAHGLYLLSGSHDCSIRLWNLDNKTCVQEITAHRKKFDESIFDVAFHATKPYIASAGADGLAKVFV 730          

HSP 2 Score: 103.219 bits (256), Expect = 2.660e-22
Identity = 57/150 (38.00%), Postives = 90/150 (60.00%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKIND--ENIKWKDEKIRLKKLILDMNDGD---DLRNSR 550
            Y++ GI+ F+Q+EW++ E++  QW+V++AELQA+IA L GERKC E+LK DL RRIKMLEYAL+QER K   L    D             NE K   +D+ +  E++ +++       N  W+  +  L++ + ++   D   D+R++R
Sbjct:   97 YTIPGILHFIQHEWSRFELERSQWDVDRAELQARIAMLLGERKCLESLKSDLTRRIKMLEYALRQERAKFYRLKYGTDPPQ---------LNEFKPSNEDAGLAGEVATDSEVPYSSVSNTTWRQGRQMLRQYLAEIGYTDNIIDVRSNR 237          
BLAST of Striatin Pro11 vs. Ensembl Fly
Match: Cka (gene:FBgn0044323 transcript:FBtr0079537)

HSP 1 Score: 311.227 bits (796), Expect = 4.219e-94
Identity = 166/392 (42.35%), Postives = 235/392 (59.95%), Query Frame = 2
Query: 1211 LSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE-IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            L LG+LA LTVNNE         S   +  N +     S      +KTW+A++TLRSHFDGVR+++FHP +P+L++ASED TLKLWNL KT+ +KK S SLDVEP+YT+R H  PVL L +    +  +SG LDG I  W++P   +DPYD +D ++       HTDAVW  L  + + + S S+DGTVK W                + LL TYT +++E +P+ +  V    D  VV + +  C + +  T     RL+     S + G  +     N +V HPT  +TI  ++D HIR +DN +G L+ S++ H + V+ +AVD  G  +L+GSHD ++R+WN+    C+QEIT HRKKFDESI  +AFH +K   A+AGADGL+KVF+
Sbjct:  366 LGLGELAQLTVNNE---------SDGAYDANSKDGTGGSAGGAGYRKTWNAKYTLRSHFDGVRSLIFHPEEPVLITASEDHTLKLWNLQKTVQAKK-SASLDVEPLYTFRAHTGPVLCLGMSSSGETCYSGGLDGNIECWQLPSPNIDPYDCYDPNVHSGTLEGHTDAVWG-LTTMQSNIVSCSADGTVKLW-----------SPYNKEPLLRTYTASEAEGVPSSVDFVRNEVDHIVVAYNSAHCIVYDTETGKQVVRLEAAQEMSGNTGKFI-----NKVVSHPTLPITITAHEDRHIRFWDNTSGTLVHSMVAHLEPVTSLAVDAHGLYLLSGSHDCSIRLWNLDNKTCVQEITAHRKKFDESIFDVAFHATKPYIASAGADGLAKVFV 730          

HSP 2 Score: 103.219 bits (256), Expect = 2.660e-22
Identity = 57/150 (38.00%), Postives = 90/150 (60.00%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKIND--ENIKWKDEKIRLKKLILDMNDGD---DLRNSR 550
            Y++ GI+ F+Q+EW++ E++  QW+V++AELQA+IA L GERKC E+LK DL RRIKMLEYAL+QER K   L    D             NE K   +D+ +  E++ +++       N  W+  +  L++ + ++   D   D+R++R
Sbjct:   97 YTIPGILHFIQHEWSRFELERSQWDVDRAELQARIAMLLGERKCLESLKSDLTRRIKMLEYALRQERAKFYRLKYGTDPPQ---------LNEFKPSNEDAGLAGEVATDSEVPYSSVSNTTWRQGRQMLRQYLAEIGYTDNIIDVRSNR 237          
BLAST of Striatin Pro11 vs. Ensembl Fly
Match: Cka (gene:FBgn0044323 transcript:FBtr0079536)

HSP 1 Score: 311.227 bits (796), Expect = 4.219e-94
Identity = 166/392 (42.35%), Postives = 235/392 (59.95%), Query Frame = 2
Query: 1211 LSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE-IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            L LG+LA LTVNNE         S   +  N +     S      +KTW+A++TLRSHFDGVR+++FHP +P+L++ASED TLKLWNL KT+ +KK S SLDVEP+YT+R H  PVL L +    +  +SG LDG I  W++P   +DPYD +D ++       HTDAVW  L  + + + S S+DGTVK W                + LL TYT +++E +P+ +  V    D  VV + +  C + +  T     RL+     S + G  +     N +V HPT  +TI  ++D HIR +DN +G L+ S++ H + V+ +AVD  G  +L+GSHD ++R+WN+    C+QEIT HRKKFDESI  +AFH +K   A+AGADGL+KVF+
Sbjct:  366 LGLGELAQLTVNNE---------SDGAYDANSKDGTGGSAGGAGYRKTWNAKYTLRSHFDGVRSLIFHPEEPVLITASEDHTLKLWNLQKTVQAKK-SASLDVEPLYTFRAHTGPVLCLGMSSSGETCYSGGLDGNIECWQLPSPNIDPYDCYDPNVHSGTLEGHTDAVWG-LTTMQSNIVSCSADGTVKLW-----------SPYNKEPLLRTYTASEAEGVPSSVDFVRNEVDHIVVAYNSAHCIVYDTETGKQVVRLEAAQEMSGNTGKFI-----NKVVSHPTLPITITAHEDRHIRFWDNTSGTLVHSMVAHLEPVTSLAVDAHGLYLLSGSHDCSIRLWNLDNKTCVQEITAHRKKFDESIFDVAFHATKPYIASAGADGLAKVFV 730          

HSP 2 Score: 103.219 bits (256), Expect = 2.660e-22
Identity = 57/150 (38.00%), Postives = 90/150 (60.00%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKIND--ENIKWKDEKIRLKKLILDMNDGD---DLRNSR 550
            Y++ GI+ F+Q+EW++ E++  QW+V++AELQA+IA L GERKC E+LK DL RRIKMLEYAL+QER K   L    D             NE K   +D+ +  E++ +++       N  W+  +  L++ + ++   D   D+R++R
Sbjct:   97 YTIPGILHFIQHEWSRFELERSQWDVDRAELQARIAMLLGERKCLESLKSDLTRRIKMLEYALRQERAKFYRLKYGTDPPQ---------LNEFKPSNEDAGLAGEVATDSEVPYSSVSNTTWRQGRQMLRQYLAEIGYTDNIIDVRSNR 237          
BLAST of Striatin Pro11 vs. Ensembl Fly
Match: Cka (gene:FBgn0044323 transcript:FBtr0079539)

HSP 1 Score: 311.227 bits (796), Expect = 4.219e-94
Identity = 166/392 (42.35%), Postives = 235/392 (59.95%), Query Frame = 2
Query: 1211 LSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE-IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            L LG+LA LTVNNE         S   +  N +     S      +KTW+A++TLRSHFDGVR+++FHP +P+L++ASED TLKLWNL KT+ +KK S SLDVEP+YT+R H  PVL L +    +  +SG LDG I  W++P   +DPYD +D ++       HTDAVW  L  + + + S S+DGTVK W                + LL TYT +++E +P+ +  V    D  VV + +  C + +  T     RL+     S + G  +     N +V HPT  +TI  ++D HIR +DN +G L+ S++ H + V+ +AVD  G  +L+GSHD ++R+WN+    C+QEIT HRKKFDESI  +AFH +K   A+AGADGL+KVF+
Sbjct:  366 LGLGELAQLTVNNE---------SDGAYDANSKDGTGGSAGGAGYRKTWNAKYTLRSHFDGVRSLIFHPEEPVLITASEDHTLKLWNLQKTVQAKK-SASLDVEPLYTFRAHTGPVLCLGMSSSGETCYSGGLDGNIECWQLPSPNIDPYDCYDPNVHSGTLEGHTDAVWG-LTTMQSNIVSCSADGTVKLW-----------SPYNKEPLLRTYTASEAEGVPSSVDFVRNEVDHIVVAYNSAHCIVYDTETGKQVVRLEAAQEMSGNTGKFI-----NKVVSHPTLPITITAHEDRHIRFWDNTSGTLVHSMVAHLEPVTSLAVDAHGLYLLSGSHDCSIRLWNLDNKTCVQEITAHRKKFDESIFDVAFHATKPYIASAGADGLAKVFV 730          

HSP 2 Score: 103.219 bits (256), Expect = 2.660e-22
Identity = 57/150 (38.00%), Postives = 90/150 (60.00%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKIND--ENIKWKDEKIRLKKLILDMNDGD---DLRNSR 550
            Y++ GI+ F+Q+EW++ E++  QW+V++AELQA+IA L GERKC E+LK DL RRIKMLEYAL+QER K   L    D             NE K   +D+ +  E++ +++       N  W+  +  L++ + ++   D   D+R++R
Sbjct:   97 YTIPGILHFIQHEWSRFELERSQWDVDRAELQARIAMLLGERKCLESLKSDLTRRIKMLEYALRQERAKFYRLKYGTDPPQ---------LNEFKPSNEDAGLAGEVATDSEVPYSSVSNTTWRQGRQMLRQYLAEIGYTDNIIDVRSNR 237          
BLAST of Striatin Pro11 vs. Ensembl Zebrafish
Match: strn (striatin, calmodulin binding protein [Source:ZFIN;Acc:ZDB-GENE-070112-1172])

HSP 1 Score: 323.553 bits (828), Expect = 4.116e-98
Identity = 203/555 (36.58%), Postives = 296/555 (53.33%), Query Frame = 2
Query:  770 DSDMEETLAEFDYIV-------GQIQQKKHILVNKKLSQHGDENEWAKVDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQA-IYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHII-------EDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAML-CHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDS-EIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D D +E L  FD++        GQ Q        +K  Q      W  VD+ +I+K+KE Y +ER G   K   + N C+  D  A + D  D            +++ + P    AR S+   +N  ++   D  +    P   +S KS I+        +L LG+LA LTV NE                 E     I+      +KTW+ +FTLR+HFD +R + FHP +P+L++ASED TLK+WNL KT P+KK   +LDVEP+YT+R H+ PVL + +    +  FSG LDG I+ W  P   +DPYDS++SS+   +   HTDAVW ++    + +L S S+DGTV+ W             A  +  +  +  N    +P+ + +V +     V  F+NG   I NM T+ L   L+     S+S G      + N ++ HPT  +TI   +D HIR FDNNTG+L+ S++ H  +V+ +AVD +G  +++GSHD +VR+WNM +  CIQE T HRKKFDESI+ +AFHPSK    +AGAD L+KVF+
Sbjct:  279 DLDTDEVLKGFDFLANTEDMMEGQTQDTPAAGDWEKEEQSPLCESW-DVDEGLISKLKEQYKKERKG--KKGVKRPNRCKLQDMLANLRDAED------------LSSIQPPVAPPARPSLPR-LNEHQLGRTDEVEAMTFPP--SSGKSFIMGTDEALENELGLGELAGLTVANEA----------------ESLSYDITNNKDALRKTWNPKFTLRNHFDSIRGLAFHPVEPVLITASEDHTLKMWNLQKTAPTKK-CAALDVEPIYTFRAHRGPVLCVVMSSSGEQCFSGGLDGTIQSWNTPNPNIDPYDSYESSVLRGSLSGHTDAVWGLVFSSAHQRLLSCSADGTVRLWSA-----------ADTEPAIACFNTNKELGVPSSVDVVCSDPAHMVTAFSNGRTGIYNMETRQLILELE-----SQSAGKPDAPCQINKVLSHPTLPITITAQEDRHIRFFDNNTGKLIHSMVAHLDAVTSLAVDPNGLYLMSGSHDCSVRLWNMESKTCIQEFTAHRKKFDESINDVAFHPSKCYIGSAGADALAKVFV 782          

HSP 2 Score: 115.161 bits (287), Expect = 8.065e-26
Identity = 51/72 (70.83%), Postives = 62/72 (86.11%), Query Frame = 2
Query:  110 ANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKL 325
            A+YS+ GI+ FLQ+EW + E++  QWEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K 
Sbjct:   38 AHYSIPGILHFLQHEWARFELERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKF 109          
BLAST of Striatin Pro11 vs. Ensembl Zebrafish
Match: strn3 (striatin, calmodulin binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-030616-405])

HSP 1 Score: 300.442 bits (768), Expect = 4.011e-90
Identity = 164/429 (38.23%), Postives = 245/429 (57.11%), Query Frame = 2
Query: 1124 GEKVSGFDVTQFSN-IPNKRNSQKSHIIED-------LSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            GE  S  D T+++  +P      KS I+         L LGDLA LTV+N+               + E + +  +  D   +KTW+ ++TLRSHFDGVRA+ FHP +P+LV+ SED TLKLWNL KT+P+KK S S DVEP+YT+RGH  PVLSL +    +  FSG +D  I+ W IP   +DPYD++D S+       H+DAVW +    + N+L S S+DGT+K W    D  E+I       CL    +  D  +PT +          V  +  G   + ++ T            S+   GN +     N +V HPT  +T+  ++D HI+ FDN +G+ + +++ H  +V+ +A+D +G  +++GSHD+++R+WN+ +  C+QE+T HRKK DE+I+ +AFHPSK    +AGAD L+KVF+
Sbjct:  323 GEARSSGDGTEWAEPLPFTPGGGKSFIMGSDDMLESVLGLGDLADLTVSND---------------EAEYSYDLPANKDAF-RKTWNPKYTLRSHFDGVRALAFHPVEPVLVTVSEDHTLKLWNLHKTVPAKK-SASFDVEPIYTFRGHIGPVLSLAVTSSGEQCFSGGIDSTIQWWNIPSSNVDPYDTYDPSVLAGTLLGHSDAVWGLAYSGIKNRLLSCSADGTIKLW----DPQEKI------PCLSTFNSDKDHGVPTSVDFNGCDPAHMVASYNTGDAVVYDLETSQPVVVFSAQGESAIPFGNHI-----NKVVTHPTLPITVTAHEDRHIKFFDNKSGKAIHAMVAHLDAVTSLAIDPNGIYLMSGSHDSSIRLWNLDSKTCVQEVTAHRKKSDEAIYDVAFHPSKAYIGSAGADALAKVFV 719          

HSP 2 Score: 108.997 bits (271), Expect = 4.952e-24
Identity = 46/69 (66.67%), Postives = 59/69 (85.51%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            Y++ GI+ ++Q+EW + E++   WEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   64 YTIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKNDLVRRIKMLEYALKQERAK 132          
BLAST of Striatin Pro11 vs. Ensembl Zebrafish
Match: strn4 (striatin, calmodulin binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-070501-3])

HSP 1 Score: 286.189 bits (731), Expect = 2.377e-84
Identity = 160/400 (40.00%), Postives = 231/400 (57.75%), Query Frame = 2
Query: 1208 DLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLDQ--LIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLN-NKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE---IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTK----LLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D++LG+LA LTV N+      +  +  L    EE            KKTW+ RFTLRSHFD +RA+ FHPSQ +L+SASED TLKLWNL K + SKK + +LDVEP+YT+R H   VLSL + ++    FSG LDG IR W+IP   +DPYD++D  ++ S    H DAVW +    +  +L S S+DGTV+ W               H        FN  +    PT +  V       VV F  G   + ++ T+    +L+T+ +        DG+ L     N +V HP++ ++I  +++  IR  DNNTG+++ S++ H  +V+C+A D  G  +++GSHD +VR+W +    C+QEIT HRKK DE+IH +AFHPS+   A+AGAD L+K+F+
Sbjct:  412 DMNLGELADLTVAND------NDLTIDLQDSREEF-----------KKTWNPRFTLRSHFDAIRALSFHPSQAVLLSASEDGTLKLWNLNKAMHSKK-NAALDVEPIYTFRAHSGAVLSLAMGEEGESCFSGGLDGTIRGWKIPDLNVDPYDNYDPGVESSVLSGHEDAVWGLAFSSSLQRLASCSADGTVRIW-------------DPHNSSPCVSVFNKEKEHGTPTSVAFVNADPSQVVVSFDGGETLLYDLNTEQSIMVLETQTK--------DGSEL----INRVVSHPSQPISITAHENRTIRFLDNNTGKVIHSMVAHLDAVTCLATDPKGTYLISGSHDCSVRLWMLDNRTCVQEITAHRKKHDEAIHDVAFHPSQPFIASAGADALAKIFV 768          

HSP 2 Score: 104.375 bits (259), Expect = 1.691e-22
Identity = 59/153 (38.56%), Postives = 90/153 (58.82%), Query Frame = 2
Query:  101 DECANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKINDENIKWKDEKIRLKKLILDMNDGD---DLRNSR 550
            D  A  SL GI+ F+Q EW++ + +  +WE E+ EL+A++A+LQGERK QEN+K DL+RRIKMLEYALKQER K   L    D S            E+K E +   I    + ++ +  ++ + WK+ +  L+K + ++   D   D+R+ R
Sbjct:   59 DGDAGLSLPGILHFIQYEWSRFQAEKYRWEAERDELRAQVAFLQGERKGQENMKQDLVRRIKMLEYALKQERAKHQKLKSGTDQSP----------GEKKPETEAEPIPNGPANSDSEPTNQ-MPWKEGRQLLRKYLEEVGYSDTILDMRSKR 200          
BLAST of Striatin Pro11 vs. Ensembl Zebrafish
Match: strn4 (striatin, calmodulin binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-070501-3])

HSP 1 Score: 284.263 bits (726), Expect = 2.186e-83
Identity = 159/396 (40.15%), Postives = 228/396 (57.58%), Query Frame = 2
Query: 1208 DLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLDQ--LIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLN-NKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE---IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D++LG+LA LTV N+      +  +  L    EE            KKTW+ RFTLRSHFD +RA+ FHPSQ +L+SASED TLKLWNL K + SKK + +LDVEP+YT+R H   VLSL + ++    FSG LDG IR W+IP   +DPYD++D  ++ S    H DAVW +    +  +L S S+DGTV+ W               H        FN  +    PT +  V       VV F  G   + ++ T+     L+    +   DG+ L     N +V HP++ ++I  +++  IR  DNNTG+++ S++ H  +V+C+A D  G  +++GSHD +VR+W +    C+QEIT HRKK DE+IH +AFHPS+   A+AGAD L+K+F+
Sbjct:  438 DMNLGELADLTVAND------NDLTIDLQDSREEF-----------KKTWNPRFTLRSHFDAIRALSFHPSQAVLLSASEDGTLKLWNLNKAMHSKK-NAALDVEPIYTFRAHSGAVLSLAMGEEGESCFSGGLDGTIRGWKIPDLNVDPYDNYDPGVESSVLSGHEDAVWGLAFSSSLQRLASCSADGTVRIW-------------DPHNSSPCVSVFNKEKEHGTPTSVAFVNADPSQVVVSFDGGETLLYDLNTEQSIMVLE----TQTKDGSEL----INRVVSHPSQPISITAHENRTIRFLDNNTGKVIHSMVAHLDAVTCLATDPKGTYLISGSHDCSVRLWMLDNRTCVQEITAHRKKHDEAIHDVAFHPSQPFIASAGADALAKIFV 794          

HSP 2 Score: 101.293 bits (251), Expect = 1.546e-21
Identity = 55/137 (40.15%), Postives = 82/137 (59.85%), Query Frame = 2
Query:  101 DECANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKINDENIKWKDEKIRLKKLI 511
            D  A  SL GI+ F+Q EW++ + +  +WE E+ EL+A++A+LQGERK QEN+K DL+RRIKMLEYALKQER K   L    D S            E+K E +   I    + ++ +  ++ + WK+ +  L+K +
Sbjct:   59 DGDAGLSLPGILHFIQYEWSRFQAEKYRWEAERDELRAQVAFLQGERKGQENMKQDLVRRIKMLEYALKQERAKHQKLKSGTDQSP----------GEKKPETEAEPIPNGPANSDSEPTNQ-MPWKEGRQLLRKSV 184          
BLAST of Striatin Pro11 vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 62.7734 bits (151), Expect = 5.884e-10
Identity = 79/344 (22.97%), Postives = 133/344 (38.66%), Query Frame = 2
Query: 1346 KKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLL--DQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLN---NKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTT-KLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCS---GGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAG 2350
            K  ++ +FTL  H   V ++ F PS   L S+S D  +K+W             + D +   T  GHK  +  +       L+ S S D  ++IW +  G             L     H++ V    C+ N   N + S S D +V+ W V              KCL      +D   P           L V    +G C I +  + + LKT +   +P              + +   P     +    D+ ++ +D + G+ L +   H+    CI  + S   G  +++GS D  V IWN+ T   +Q++  H     + +   A HP++N+ A+A 
Sbjct:   32 KPNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWG------------AYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKC-----------LKTLKGHSNYV--FCCNFNPQSNLIVSGSFDESVRIWDV-----------KTGKCLKTLPAHSD---PVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPP------------VSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHT----DVVISTACHPTENIIASAA 320          
BLAST of Striatin Pro11 vs. Ensembl Xenopus
Match: ENSXETT00000054524.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:92903155:92938805:-1 gene:ENSXETG00000020805.1 transcript:ENSXETT00000054524.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 323.553 bits (828), Expect = 7.582e-99
Identity = 211/566 (37.28%), Postives = 297/566 (52.47%), Query Frame = 2
Query:  776 DMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVGV-GSKS-----TMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEF--NARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHII--ED-----LSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCL--LDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCH--LNNKLFSASSDGTVKCW--LVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D EE L EFD++V     +       +    GD  EW K           VDQ +I K+KE Y +ER G  G+KS        S +    ++  ++D++ +    D  H        IP E    AR   S   + E   G    +   I     S K  I+  ED     L LGDLA LTV N+                 + + +  S  D   +KTW+ ++TLRSHFDGVRA+ FHP +P+LV+ASED TLKLWNL KT+P+KK S SLDVEP+YT+R H  PVLSL +    +  +SG LD  I+ W+IP   +DPYD++D S+       HTDAVW  L H  + + L S S+DGTV+ W        +    GN +H             IPT +  +       V  FT+G   + ++ T     +L  PS S     N +     N +V HPT  +TI  ++D HI+ FDN +G+ + S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  C+QEIT HRKK DESI+ +AFHPSK   A+AGAD L+KVF+
Sbjct:  174 DTEEALKEFDFLVTAEDGEG----AGEARSSGDGTEWEKDVLSPTTEVWDVDQGLINKLKEEYTKERKGTKGAKSKSFLLAQTSQEKIRVNRTKLHDMIADLGEEDLSH--------IPAEILSPARTPSSRITDHE---GGRAEEAEPIAFPPGSGKPFIMASEDVLESVLGLGDLADLTVTNDA----------------DFSYDIPSNKDAF-RKTWNPKYTLRSHFDGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPTKK-SASLDVEPIYTFRAHIGPVLSLVVGCSGEHCYSGGLDSTIQWWKIPSPNVDPYDTYDPSVLAGTLVGHTDAVWG-LSHSGVKDSLLSCSADGTVRLWSPPTGTQCIGTYNGNREHG------------IPTSVDFIGCDPAHAVASFTSGCIVVYDLETSESVIQLSSPSDSGAPFSNHI-----NKIVSHPTLPVTIAAFEDRHIKFFDNKSGKSIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHPSKAFIASAGADALAKVFV 688          
BLAST of Striatin Pro11 vs. Ensembl Xenopus
Match: ENSXETT00000054536.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:92903155:92938719:-1 gene:ENSXETG00000020805.1 transcript:ENSXETT00000054536.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 323.553 bits (828), Expect = 3.087e-98
Identity = 199/550 (36.18%), Postives = 292/550 (53.09%), Query Frame = 2
Query:  776 DMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-------VDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSDCDH--EWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHIIED-LSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCL--LDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCH--LNNKLFSASSDGTVKCW--LVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D EE L EFD++V     +       +    GD  EW K       VDQ +I K+KE Y +ER G  +K   + N      +  ++D++ +    D  H    +++ A+ P        ++++  G    G +   ++            ++E  L LGDLA LTV N+                  +    I       +KTW+ ++TLRSHFDGVRA+ FHP +P+LV+ASED TLKLWNL KT+P+KK S SLDVEP+YT+R H  PVLSL +    +  +SG LD  I+ W+IP   +DPYD++D S+       HTDAVW  L H  + + L S S+DGTV+ W        +    GN +H             IPT +  +       V  FT+G   + ++ T     +L  PS S     N +     N +V HPT  +TI  ++D HI+ FDN +G+ + S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  C+QEIT HRKK DESI+ +AFHPSK   A+AGAD L+KVF+
Sbjct:  261 DTEEALKEFDFLVTAEDGEG----AGEARSSGDGTEWGKNMSEVWDVDQGLINKLKEEYTKERKG--TKGAKRVN------RTKLHDMIADLGEEDLSHIPAEILSPARTPSS-----RITDHEGGRAEEGAEPFAYN------------VLESVLGLGDLADLTVTNDA-----------------DFSYDIPSNKDAFRKTWNPKYTLRSHFDGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPTKK-SASLDVEPIYTFRAHIGPVLSLVVGCSGEHCYSGGLDSTIQWWKIPSPNVDPYDTYDPSVLAGTLVGHTDAVWG-LSHSGVKDSLLSCSADGTVRLWSPPTGTQCIGTYNGNREHG------------IPTSVDFIGCDPAHAVASFTSGCIVVYDLETSESVIQLSSPSDSGAPFSNHI-----NKIVSHPTLPVTIAAFEDRHIKFFDNKSGKSIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHPSKAFIASAGADALAKVFV 745          

HSP 2 Score: 109.768 bits (273), Expect = 4.929e-24
Identity = 65/153 (42.48%), Postives = 90/153 (58.82%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALT-----GEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKINDENIKWKDEKIRLKKLILDMNDGD---DLRNSR 550
            Y++ GI+ ++Q+EW + E++   WEVEKAELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K   L       +GD  + T          E  E  DS    E+S   Q   +  + WK  +  L++ + ++   D   D+R+ R
Sbjct:   31 YTIPGILHYIQHEWARFEMERAHWEVEKAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLKYGTELNQGDLKTPTF---------ESEETKDS----EVSPGPQ---NSQLTWKQGRQLLRQYLQEVGYTDTILDVRSQR 167          
BLAST of Striatin Pro11 vs. Ensembl Xenopus
Match: strn (striatin [Source:NCBI gene;Acc:100216217])

HSP 1 Score: 323.553 bits (828), Expect = 5.009e-98
Identity = 201/558 (36.02%), Postives = 301/558 (53.94%), Query Frame = 2
Query:  776 DMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHII-------EDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAML-CHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE---IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D EE L EFD++     +        +    GD  EW K           VDQ +I K+KE Y +ER G   K   + N  +  D  A    VD   +              P   ++    S+ I+ ++++  D  +    P   +S KS I+        +L LG+LA LTV NE                +  T +  +  D L +KTW+ +FTLRSHFDG+R + FHPS+P+L++ASED TLK+WNL KT P+KK S SLD+EP+YT+R H+ PVL + +    +  +SG  DG I+ W  P   +DPYDS+D ++   AY  H+D++W ++   ++ +L SAS+DGT++ W            NA       + TFN+++   IP+ + LV       V  F +G  SI NM     +T  +V +  S  D       + N ++ HPT  ++I  ++D HI+ +DNNTG+L+ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  CIQE T HRKK DESIH +AFHPSK   A+AGAD L+KVF+
Sbjct:  268 DTEEALKEFDFLGSDDGE------GGESRSAGDGTEWEKEDQCPITESWNVDQGVITKLKEQYKKERKG--KKGVKRPNRSKLQDMLANLREVDELPSLQ------------PSVVSSSRPTSSRISEQEINRTDEVEALTFPP--SSGKSFIMGADEALENELGLGELAGLTVANEA---------------DSLTYDIANNKDAL-RKTWNPKFTLRSHFDGIRGLAFHPSEPVLITASEDHTLKMWNLQKTAPAKK-STSLDIEPIYTFRAHRGPVLCVVMSSNGEQCYSGGTDGVIQSWNTPNSNVDPYDSYDPTVLRGAYEGHSDSIWGLVYSAVHQRLLSASADGTIRIW------------NAAEVSPALS-TFNENQELGIPSSVDLVSCDPAHLVASFNSGHTSIFNM-----ETHQKVLTLESCIDTAVNSTFQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIHSMVAHLDAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKSDESIHDVAFHPSKCYIASAGADALAKVFV 768          

HSP 2 Score: 112.849 bits (281), Expect = 5.298e-25
Identity = 49/69 (71.01%), Postives = 60/69 (86.96%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            YS+ GI+ FLQ+EW + E++  QWEVE+AE+QA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   38 YSIPGILHFLQHEWARFEVERAQWEVERAEMQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 106          
BLAST of Striatin Pro11 vs. Ensembl Xenopus
Match: ENSXETT00000054540.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:92903155:92938653:-1 gene:ENSXETG00000020805.1 transcript:ENSXETT00000054540.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 323.553 bits (828), Expect = 6.493e-98
Identity = 210/566 (37.10%), Postives = 294/566 (51.94%), Query Frame = 2
Query:  776 DMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVGV-GSKS-----TMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEF--NARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHII--ED-----LSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCL--LDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCH--LNNKLFSASSDGTVKCW--LVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D EE L EFD++V     +       +    GD  EW K           VDQ +I K+KE Y +ER G  G+KS        S +    ++  ++D++ +    D  H        IP E    AR   S   + E   G    +   I     S K  I+  ED     L LGDLA LTV N+                  +    I       +KTW+ ++TLRSHFDGVRA+ FHP +P+LV+ASED TLKLWNL KT+P+KK S SLDVEP+YT+R H  PVLSL +    +  +SG LD  I+ W+IP   +DPYD++D S+       HTDAVW  L H  + + L S S+DGTV+ W        +    GN +H             IPT +  +       V  FT+G   + ++ T     +L  PS S     N +     N +V HPT  +TI  ++D HI+ FDN +G+ + S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  C+QEIT HRKK DESI+ +AFHPSK   A+AGAD L+KVF+
Sbjct:  274 DTEEALKEFDFLVTAEDGEG----AGEARSSGDGTEWEKDVLSPTTEVWDVDQGLINKLKEEYTKERKGTKGAKSKSFLLAQTSQEKIRVNRTKLHDMIADLGEEDLSH--------IPAEILSPARTPSSRITDHE---GGRAEEAEPIAFPPGSGKPFIMASEDVLESVLGLGDLADLTVTNDA-----------------DFSYDIPSNKDAFRKTWNPKYTLRSHFDGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPTKK-SASLDVEPIYTFRAHIGPVLSLVVGCSGEHCYSGGLDSTIQWWKIPSPNVDPYDTYDPSVLAGTLVGHTDAVWG-LSHSGVKDSLLSCSADGTVRLWSPPTGTQCIGTYNGNREHG------------IPTSVDFIGCDPAHAVASFTSGCIVVYDLETSESVIQLSSPSDSGAPFSNHI-----NKIVSHPTLPVTIAAFEDRHIKFFDNKSGKSIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHPSKAFIASAGADALAKVFV 788          

HSP 2 Score: 109.768 bits (273), Expect = 5.312e-24
Identity = 65/155 (41.94%), Postives = 90/155 (58.06%), Query Frame = 2
Query:  110 ANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALT-----GEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKINDENIKWKDEKIRLKKLILDMNDGD---DLRNSR 550
              Y++ GI+ ++Q+EW + E++   WEVEKAELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K   L       +GD  + T          E  E  DS    E+S   Q   +  + WK  +  L++ + ++   D   D+R+ R
Sbjct:   39 PQYTIPGILHYIQHEWARFEMERAHWEVEKAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLKYGTELNQGDLKTPTF---------ESEETKDS----EVSPGPQ---NSQLTWKQGRQLLRQYLQEVGYTDTILDVRSQR 177          
BLAST of Striatin Pro11 vs. Ensembl Xenopus
Match: ENSXETT00000054521.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:92903155:92939014:-1 gene:ENSXETG00000020805.1 transcript:ENSXETT00000054521.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 323.939 bits (829), Expect = 6.572e-98
Identity = 208/560 (37.14%), Postives = 291/560 (51.96%), Query Frame = 2
Query:  776 DMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEF--NARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHII--ED-----LSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCL--LDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCH--LNNKLFSASSDGTVKCW--LVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D EE L EFD++V     +       +    GD  EW K           VDQ +I K+KE Y +ER G  +K   + N      +  ++D++ +    D  H        IP E    AR   S   + E   G    +   I     S K  I+  ED     L LGDLA LTV N+                  +    I       +KTW+ ++TLRSHFDGVRA+ FHP +P+LV+ASED TLKLWNL KT+P+KK S SLDVEP+YT+R H  PVLSL +    +  +SG LD  I+ W+IP   +DPYD++D S+       HTDAVW  L H  + + L S S+DGTV+ W        +    GN +H             IPT +  +       V  FT+G   + ++ T     +L  PS S     N +     N +V HPT  +TI  ++D HI+ FDN +G+ + S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  C+QEIT HRKK DESI+ +AFHPSK   A+AGAD L+KVF+
Sbjct:  298 DTEEALKEFDFLVTAEDGEG----AGEARSSGDGTEWEKDVLSPTTEVWDVDQGLINKLKEEYTKERKG--TKGAKRVN------RTKLHDMIADLGEEDLSH--------IPAEILSPARTPSSRITDHE---GGRAEEAEPIAFPPGSGKPFIMASEDVLESVLGLGDLADLTVTNDA-----------------DFSYDIPSNKDAFRKTWNPKYTLRSHFDGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPTKK-SASLDVEPIYTFRAHIGPVLSLVVGCSGEHCYSGGLDSTIQWWKIPSPNVDPYDTYDPSVLAGTLVGHTDAVWG-LSHSGVKDSLLSCSADGTVRLWSPPTGTQCIGTYNGNREHG------------IPTSVDFIGCDPAHAVASFTSGCIVVYDLETSESVIQLSSPSDSGAPFSNHI-----NKIVSHPTLPVTIAAFEDRHIKFFDNKSGKSIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHPSKAFIASAGADALAKVFV 798          

HSP 2 Score: 109.768 bits (273), Expect = 4.956e-24
Identity = 47/70 (67.14%), Postives = 59/70 (84.29%), Query Frame = 2
Query:  113 NYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
             Y++ GI+ ++Q+EW + E++   WEVEKAELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   62 QYTIPGILHYIQHEWARFEMERAHWEVEKAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 131          
BLAST of Striatin Pro11 vs. Ensembl Mouse
Match: Strn3 (striatin, calmodulin binding protein 3 [Source:MGI Symbol;Acc:MGI:2151064])

HSP 1 Score: 326.25 bits (835), Expect = 6.379e-99
Identity = 207/563 (36.77%), Postives = 290/563 (51.51%), Query Frame = 2
Query:  770 DSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVG-VGSKSTMKSNDCQN----GDKQ------AIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHIIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE--IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D D EE L EFD++V     +       +    GD  EW K           VDQ +I+K+KE Y +ER G  G K   ++N C      GD +       I +   + ST   DHE        P  F +    S  +  + V                     ++  L LGDLA LTV N+                +   D   +K D   +KTW+ ++TLRSHFDGVRA+ FHP +P+LV+ASED TLKLWNL KT+P+KK S SLDVEP+YT+R H  PVLSL +    +  FSG +D  I+ W +P   +DPYD+++S++       HTDAVW +    + N+L S S+DGT++ W            N Q K         D E  IPT +  +       V  F  GS  I ++ T      L     SS+ D         N +V HPT  +TI  ++D HI+ FDN TG+++ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  C+QEIT HRKK DESI+ +AFHPSK   A+AGAD L+KVF+
Sbjct:  294 DPDTEEALKEFDFLVTAEDGEG----AGEARSSGDGTEWDKDDLSPTAEVWDVDQGLISKLKEQYKKERKGKKGVKRVNRTNLCDMITDLGDDELPHIPSGIINQSRSASTRMADHEGARAEEAEPITFPSGGGKSFIMGSDDV---------------------LLSVLGLGDLADLTVTNDA---------------DYSYDLPANK-DAF-RKTWNPKYTLRSHFDGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPAKK-SASLDVEPIYTFRAHIGPVLSLAISSNGEQCFSGGIDATIQWWNMPSPNVDPYDTYESNVLAGTLVAHTDAVWGLAYSGIKNQLLSCSADGTIRLW------------NPQEKLPCVCTYNGDKEHGIPTSVDFIGCDPAHMVTSFNTGSAVIYDLETSQSLVML-----SSQVDSGLQSSNHINRVVSHPTLPVTITAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHPSKAYIASAGADALAKVFV 796          

HSP 2 Score: 108.612 bits (270), Expect = 8.162e-24
Identity = 47/75 (62.67%), Postives = 60/75 (80.00%), Query Frame = 2
Query:   98 LDECANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            L     Y++ GI+ ++Q+EW + E++   WEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   57 LSRPQQYTIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 131          
BLAST of Striatin Pro11 vs. Ensembl Mouse
Match: Strn (striatin, calmodulin binding protein [Source:MGI Symbol;Acc:MGI:1333757])

HSP 1 Score: 315.849 bits (808), Expect = 8.714e-97
Identity = 200/560 (35.71%), Postives = 299/560 (53.39%), Query Frame = 2
Query:  770 DSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHII-------EDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE---IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D D +E L EFD++V   +       + +    GD  +W K           VDQ +I+K+KE Y +ER G   K   + N      +  + D++ N    D D    +     P   +     S+ +  +++S  D  +    P   +S KS I+        +L LG+LA LTV NE   +                   I+      +KTW+ +FTLRSHFDG+RA+ FHP +P+L++ASED TLK+WNL KT P+KK S SLDVEP+YT+R HK PVL + +    +  +SG  DG I+ W      +DPYD++D S+       HTDAVW +     + +L S S+DGT++ W            N        +  FND++   IP  + LV +     V  F+ G  SI NM     +T+ +V +  S  D  S    + N ++ HPT  ++I  ++D HI+ +DNNTG+L+ S++ H ++V+ +AVD +G  +++GSHD ++R+WN+ +  CIQE T HRKKF+ESIH +AFHPSK   A+AGAD L+KVF+
Sbjct:  125 DRDTKEALKEFDFLVTSEEG------DNESRSAGDGTDWEKEDQCLTPEAWNVDQGVISKLKEQYKKERKG--KKGVKRPN------RSKLQDMLAN--LRDVDELPSLQ----PSVGSPSRPSSSRLPEQELSRADEVEALTFPP--SSGKSFIMGADEALESELGLGELAGLTVANEADSLAY----------------DIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKK-STSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGRIQSWSTTNPNVDPYDAYDPSVLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLW------------NTTEVAPALS-VFNDNQELGIPASVDLVSSDPSHMVASFSKGYTSIFNM-----ETQQRVLTLESNVDSTSSSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV 627          
BLAST of Striatin Pro11 vs. Ensembl Mouse
Match: Strn (striatin, calmodulin binding protein [Source:MGI Symbol;Acc:MGI:1333757])

HSP 1 Score: 317.005 bits (811), Expect = 1.166e-95
Identity = 200/560 (35.71%), Postives = 299/560 (53.39%), Query Frame = 2
Query:  770 DSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHII-------EDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE---IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D D +E L EFD++V   +       + +    GD  +W K           VDQ +I+K+KE Y +ER G   K   + N      +  + D++ N    D D    +     P   +     S+ +  +++S  D  +    P   +S KS I+        +L LG+LA LTV NE   +                   I+      +KTW+ +FTLRSHFDG+RA+ FHP +P+L++ASED TLK+WNL KT P+KK S SLDVEP+YT+R HK PVL + +    +  +SG  DG I+ W      +DPYD++D S+       HTDAVW +     + +L S S+DGT++ W            N        +  FND++   IP  + LV +     V  F+ G  SI NM     +T+ +V +  S  D  S    + N ++ HPT  ++I  ++D HI+ +DNNTG+L+ S++ H ++V+ +AVD +G  +++GSHD ++R+WN+ +  CIQE T HRKKF+ESIH +AFHPSK   A+AGAD L+KVF+
Sbjct:  278 DRDTKEALKEFDFLVTSEEG------DNESRSAGDGTDWEKEDQCLTPEAWNVDQGVISKLKEQYKKERKG--KKGVKRPN------RSKLQDMLAN--LRDVDELPSLQ----PSVGSPSRPSSSRLPEQELSRADEVEALTFPP--SSGKSFIMGADEALESELGLGELAGLTVANEADSLAY----------------DIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKK-STSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGRIQSWSTTNPNVDPYDAYDPSVLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLW------------NTTEVAPALS-VFNDNQELGIPASVDLVSSDPSHMVASFSKGYTSIFNM-----ETQQRVLTLESNVDSTSSSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV 780          

HSP 2 Score: 114.39 bits (285), Expect = 1.328e-25
Identity = 51/69 (73.91%), Postives = 60/69 (86.96%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            YSL GI+ FLQ+EW + E++  QWEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   47 YSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 115          
BLAST of Striatin Pro11 vs. Ensembl Mouse
Match: Strn3 (striatin, calmodulin binding protein 3 [Source:MGI Symbol;Acc:MGI:2151064])

HSP 1 Score: 305.064 bits (780), Expect = 8.395e-92
Identity = 166/394 (42.13%), Postives = 231/394 (58.63%), Query Frame = 2
Query: 1211 LSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE--IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            L LGDLA LTV N+                +   D   +K D   +KTW+ ++TLRSHFDGVRA+ FHP +P+LV+ASED TLKLWNL KT+P+KK S SLDVEP+YT+R H  PVLSL +    +  FSG +D  I+ W +P   +DPYD+++S++       HTDAVW +    + N+L S S+DGT++ W            N Q K         D E  IPT +  +       V  F  GS  I ++ T      L     SS+ D         N +V HPT  +TI  ++D HI+ FDN TG+++ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  C+QEIT HRKK DESI+ +AFHPSK   A+AGAD L+KVF+
Sbjct:  354 LGLGDLADLTVTNDA---------------DYSYDLPANK-DAF-RKTWNPKYTLRSHFDGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPAKK-SASLDVEPIYTFRAHIGPVLSLAISSNGEQCFSGGIDATIQWWNMPSPNVDPYDTYESNVLAGTLVAHTDAVWGLAYSGIKNQLLSCSADGTIRLW------------NPQEKLPCVCTYNGDKEHGIPTSVDFIGCDPAHMVTSFNTGSAVIYDLETSQSLVML-----SSQVDSGLQSSNHINRVVSHPTLPVTITAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHPSKAYIASAGADALAKVFV 712          

HSP 2 Score: 108.997 bits (271), Expect = 6.309e-24
Identity = 47/75 (62.67%), Postives = 60/75 (80.00%), Query Frame = 2
Query:   98 LDECANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            L     Y++ GI+ ++Q+EW + E++   WEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   57 LSRPQQYTIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 131          
BLAST of Striatin Pro11 vs. Ensembl Mouse
Match: Strn4 (striatin, calmodulin binding protein 4 [Source:MGI Symbol;Acc:MGI:2142346])

HSP 1 Score: 270.011 bits (689), Expect = 1.925e-78
Identity = 150/393 (38.17%), Postives = 224/393 (57.00%), Query Frame = 2
Query: 1208 DLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            ++SLGDLA LTV N+                N+ + +     D   KKTW+ +FTLRSH+DG+R++ FH SQ  L++ASED TLKLWNL K + +KK + +LDVEP++ +R H+ PVL++ +    +  +SG  D  I  W+IP   +DPYD +D S+       H DAVW +     + +L S S+DGTV+ W            ++   CL       +  IPT +    T     V  F +G   + ++        L       ES G+S G  + N +V HP++ +TI  +DD  IR  DN TG+ + S++ H  +V+C+AVD +G  +++GSHD ++R+W++    C+QEIT HRKK +E+IH +A HPSK L A+AGAD L+KVF+
Sbjct:  396 EVSLGDLADLTVTND----------------NDLSCDLSDSKDAF-KKTWNPKFTLRSHYDGIRSLAFHHSQSALLTASEDGTLKLWNLQKAVTAKK-NAALDVEPIHAFRAHRGPVLAVTMGSNSEYCYSGGADARIHSWKIPDLNMDPYDGYDPSVLSHVLEGHGDAVWGLAFSPTSQRLASCSADGTVRIW---------DPSSSGPSCLCTFPMDGEHGIPTSVAFTSTEPAHVVASFRSGDTVLYDLEAGSALLTL-------ESRGSS-GPAQINQVVSHPSQPLTITAHDDRGIRFLDNRTGKSVHSMVAHLDAVTCLAVDPNGVFLMSGSHDCSLRLWSLDNKTCVQEITAHRKKHEEAIHAVACHPSKALIASAGADALAKVFV 753          

HSP 2 Score: 107.071 bits (266), Expect = 2.775e-23
Identity = 63/150 (42.00%), Postives = 90/150 (60.00%), Query Frame = 2
Query:  119 SLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNN-QKINDEN--IKWKDEKIRLKKLILDMNDGD---DLRNSR 550
            SL GI+ F+Q+EW + E +  +WE E+AELQA++A+LQGERK QENLK DL+RRIKMLEYALKQER K   L            F   LN  EK     +D+  ++S    + +  EN  + WK+ +  L++ + ++   D   D+R+ R
Sbjct:   64 SLPGILHFIQHEWARFEAEKARWEAERAELQAQVAFLQGERKGQENLKTDLVRRIKMLEYALKQERAKYHKLK-----------FGTDLNQGEK----KTDLSEQVSNGPVESVTLENSPLVWKEGRQLLRQYLEEVGYTDTILDMRSKR 198          
BLAST of Striatin Pro11 vs. UniProt/SwissProt
Match: sp|P58405|STRN3_RAT (Striatin-3 OS=Rattus norvegicus OX=10116 GN=Strn3 PE=1 SV=2)

HSP 1 Score: 326.25 bits (835), Expect = 3.770e-98
Identity = 206/563 (36.59%), Postives = 292/563 (51.87%), Query Frame = 2
Query:  770 DSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVG-VGSKSTMKSNDCQN----GDKQ------AIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHIIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHK--CLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D D EE L EFD++V     +       +    GD  EW K           VDQ +++K+KE Y +ER G  G+K   ++N C      GD +       I +   + ST   DHE        P  F +    S  +  + V                     ++  L LGDLA LTV N+                +   D   +K D L +KTW+ ++TLRSHFDGVRA+ FHP +P+LV+ASED TLKLWNL KT+P+KK S SLDVEP+YT+R H  PVLSL +    +  FSG +D  I+ W +P   +DPYD+++S +       HTDAVW +    + N+L S S+DGT++ W            N Q K  C+       +  IPT +  +       V  F  GS  I ++ T      L     SS+ D         N +V HPT  +TI  ++D HI+ FDN TG+++ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  C+QEIT HRKK DESI+ +AFHPSK   A+AGAD L+KVF+
Sbjct:  292 DPDTEEALKEFDFLVTAEDGEG----AGEARSSGDGTEWDKDDLSPTAEVWDVDQGLMSKLKEQYKKERKGKRGAKRVNRTNLCDMITDLGDDELPHIPSGIINQSRSASTRMTDHEGSRAEEAEPITFPSGGGKSFIMGSDDV---------------------LLSVLGLGDLADLTVTNDA---------------DYSYDLPANK-DAL-RKTWNPKYTLRSHFDGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPAKK-SASLDVEPIYTFRAHIGPVLSLAISSNGEQCFSGGIDATIQWWNMPSPNVDPYDTYESHVLAGTLVAHTDAVWGLAYSGIKNQLLSCSADGTIRLW------------NPQEKLPCICTYNGDKEHGIPTSVDFIGCDPAHMVTSFNTGSAIIYDLETSQSLVML-----SSQVDSGLQSSNHINRVVSHPTLPVTITAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHPSKAYIASAGADALAKVFV 794          

HSP 2 Score: 110.923 bits (276), Expect = 1.337e-23
Identity = 48/77 (62.34%), Postives = 61/77 (79.22%), Query Frame = 2
Query:   92 PILDECANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            P L     Y++ GI+ ++Q+EW + E++   WEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   54 PELSRPQQYTIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 130          
BLAST of Striatin Pro11 vs. UniProt/SwissProt
Match: sp|Q9ERG2|STRN3_MOUSE (Striatin-3 OS=Mus musculus OX=10090 GN=Strn3 PE=1 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 4.462e-98
Identity = 207/563 (36.77%), Postives = 290/563 (51.51%), Query Frame = 2
Query:  770 DSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVG-VGSKSTMKSNDCQN----GDKQ------AIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHIIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE--IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D D EE L EFD++V     +       +    GD  EW K           VDQ +I+K+KE Y +ER G  G K   ++N C      GD +       I +   + ST   DHE        P  F +    S  +  + V                     ++  L LGDLA LTV N+                +   D   +K D   +KTW+ ++TLRSHFDGVRA+ FHP +P+LV+ASED TLKLWNL KT+P+KK S SLDVEP+YT+R H  PVLSL +    +  FSG +D  I+ W +P   +DPYD+++S++       HTDAVW +    + N+L S S+DGT++ W            N Q K         D E  IPT +  +       V  F  GS  I ++ T      L     SS+ D         N +V HPT  +TI  ++D HI+ FDN TG+++ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  C+QEIT HRKK DESI+ +AFHPSK   A+AGAD L+KVF+
Sbjct:  294 DPDTEEALKEFDFLVTAEDGEG----AGEARSSGDGTEWDKDDLSPTAEVWDVDQGLISKLKEQYKKERKGKKGVKRVNRTNLCDMITDLGDDELPHIPSGIINQSRSASTRMADHEGARAEEAEPITFPSGGGKSFIMGSDDV---------------------LLSVLGLGDLADLTVTNDA---------------DYSYDLPANK-DAF-RKTWNPKYTLRSHFDGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPAKK-SASLDVEPIYTFRAHIGPVLSLAISSNGEQCFSGGIDATIQWWNMPSPNVDPYDTYESNVLAGTLVAHTDAVWGLAYSGIKNQLLSCSADGTIRLW------------NPQEKLPCVCTYNGDKEHGIPTSVDFIGCDPAHMVTSFNTGSAVIYDLETSQSLVML-----SSQVDSGLQSSNHINRVVSHPTLPVTITAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHPSKAYIASAGADALAKVFV 796          

HSP 2 Score: 108.612 bits (270), Expect = 5.710e-23
Identity = 47/75 (62.67%), Postives = 60/75 (80.00%), Query Frame = 2
Query:   98 LDECANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            L     Y++ GI+ ++Q+EW + E++   WEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   57 LSRPQQYTIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 131          
BLAST of Striatin Pro11 vs. UniProt/SwissProt
Match: sp|A5D7H2|STRN3_BOVIN (Striatin-3 OS=Bos taurus OX=9913 GN=STRN3 PE=2 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 1.263e-95
Identity = 203/555 (36.58%), Postives = 293/555 (52.79%), Query Frame = 2
Query:  770 DSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYD-VVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSH--IIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHK--CLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D D EE L EFD++V     +       +    GD  EW K           VDQ +I+K+KE Y +ER   G K   + N      +  +YD + D G     D   ++ +  I    +A   ++++  G +    +   F +   K     S   ++  L LGDLA LTV N+                +   D   +K D   +KTW+ ++TLRSHFDGVRA+ FHP +P+LV+ASED TLKLWNL KT+P+KK S SLDVEP+YT+R H  PVLSL +    +  FSG  D  I+ W +P   +DPYD+++ ++       HTDAVW +    + N+L S S+DGTV+ W            N Q K  C+       +  IPT +  +       V  F  GS  I ++ T      L     SS+ D         N +V HPT  +TI  ++D HI+ FDN TG+++ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  C+QEIT HRKK DESI+ +AFHPSK   A+AGAD L+KVF+
Sbjct:  295 DPDTEEALKEFDFLVTAEDGEG----AGEARSSGDGTEWDKDDLSPTTEVWDVDQGLISKLKEQYKKER--KGKKGVKRVN------RTKLYDTIADLGD----DELPLIPSGIINQSRSASTRMTDH-EGARAEEAEPITFPSGGGKSFIMGSDDVLLSVLGLGDLADLTVTNDA---------------DYSYDLPANK-DAF-RKTWNPKYTLRSHFDGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPAKK-SASLDVEPIYTFRAHIGPVLSLAISSNGEQCFSGGTDATIQWWNMPSPNVDPYDTYEPNVLAGTLIAHTDAVWGLAYSGIKNQLLSCSADGTVRLW------------NPQEKLPCICTYNGDKEHGIPTSVDFIGCDPAHMVTSFNTGSTVIYDLETSQSLVML-----SSQMDSGLQSSNHINRVVSHPTLPVTITAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHPSKAYIASAGADALAKVFV 797          

HSP 2 Score: 110.923 bits (276), Expect = 1.120e-23
Identity = 48/77 (62.34%), Postives = 61/77 (79.22%), Query Frame = 2
Query:   92 PILDECANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            P L     Y++ GI+ ++Q+EW + E++   WEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   55 PELSRPQQYTIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 131          
BLAST of Striatin Pro11 vs. UniProt/SwissProt
Match: sp|Q13033|STRN3_HUMAN (Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3 PE=1 SV=3)

HSP 1 Score: 319.316 bits (817), Expect = 1.722e-95
Identity = 202/555 (36.40%), Postives = 297/555 (53.51%), Query Frame = 2
Query:  770 DSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSH--IIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE---IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D D EE L EFD++V     +       +    GD  EW K           VDQ +I+K+KE Y +ER   G K   ++N      +  +YD++ +    +  H   + +  I    +A   ++++  G +    +   F +   K     S   ++  L LGDLA LTV N+                +   D   +K D   +KTW+ ++TLRSHFDGVRA+ FHP +P+LV+ASED TLKLWNL KT+P+KK S SLDVEP+YT+R H  PVLSL +    +  FSG +D  I+ W +P  ++DPYD+++ ++       HTDAVW +    + N+L S S+DGTV+ W            N Q K L    T+N  +   IPT +  +       V  F  GS  I ++ T      L     SS+ D         N +V HPT  +TI  ++D HI+ FDN TG+++ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  C+QEIT HRKK DESI+ +AFH SK   A+AGAD L+KVF+
Sbjct:  295 DPDTEEALKEFDFLVTAEDGEG----AGEARSSGDGTEWDKDDLSPTAEVWDVDQGLISKLKEQYKKER--KGKKGVKRAN------RTKLYDMIADLGDDELPH---IPSGIINQSRSASTRMTDH-EGARAEEAEPITFPSGGGKSFIMGSDDVLLSVLGLGDLADLTVTNDA---------------DYSYDLPANK-DAF-RKTWNPKYTLRSHFDGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPAKK-SASLDVEPIYTFRAHIGPVLSLAISSNGEQCFSGGIDATIQWWNMPSPSVDPYDTYEPNVLAGTLVGHTDAVWGLAYSGIKNQLLSCSADGTVRLW------------NPQEK-LPCICTYNGDKKHGIPTSVDFIGCDPAHMVTSFNTGSAVIYDLETSQSLVIL-----SSQVDSGLQSNNHINRVVSHPTLPVTITAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHSSKAYIASAGADALAKVFV 797          

HSP 2 Score: 110.923 bits (276), Expect = 1.287e-23
Identity = 48/77 (62.34%), Postives = 61/77 (79.22%), Query Frame = 2
Query:   92 PILDECANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            P L     Y++ GI+ ++Q+EW + E++   WEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   55 PELSRPQQYTIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 131          
BLAST of Striatin Pro11 vs. UniProt/SwissProt
Match: sp|P70483|STRN_RAT (Striatin OS=Rattus norvegicus OX=10116 GN=Strn PE=1 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 3.832e-95
Identity = 197/560 (35.18%), Postives = 296/560 (52.86%), Query Frame = 2
Query:  770 DSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHII-------EDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE---IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D D +E L EFD++V   +       + +    GD  +W K           VDQ +I ++KE Y +ER G   K   + N      +  + D++ N    D D    +     P   +     S+ +  + +S  D  +    P   +S KS I+        +L LG+LA LTV NE   +                   I+      +KTW+ +FTLRSHFDG+RA+ FHP +P+L++ASED TLK+WNL KT P+KK S SLDVEP+YT+R HK PVL + +    +  +SG  DG I+ W      +DPYDS+D S+       HTDAVW +     + +L S S+DGT++ W                +       FND++   IP  + LV +     V  F+ G  SI NM     +T+ ++ +  S  D  +    + N ++ HPT  ++I  ++D HI+ +DNNTG+L+ S++ H ++V+ +AVD +G  +++GSHD ++R+WN+ +  CIQE T HRKKF+ESIH +AFHPSK   A+AGAD L+KVF+
Sbjct:  278 DRDTKEALKEFDFLVASEEG------DNESRSAGDGTDWEKEDQCLTPERWNVDQGVITRLKEQYKKERKG--KKGVKRPN------RSKLQDMLAN--LRDVDELPSLQ----PSVGSPSRPSSSRLPEQDISRADEVEALTFPP--SSGKSFIMGADEALESELGLGELAGLTVANEADSLAY----------------DIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKK-STSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQSWSTTNPNVDPYDSYDPSVLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWTTT-------------EVAPALTVFNDNQELGIPASVDLVSSDPSHMVASFSKGYTSIFNM-----ETQQRILTLESNVDSTASSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV 780          

HSP 2 Score: 114.775 bits (286), Expect = 7.471e-25
Identity = 51/69 (73.91%), Postives = 60/69 (86.96%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            YSL GI+ FLQ+EW + E++  QWEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   47 YSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 115          
BLAST of Striatin Pro11 vs. TrEMBL
Match: V4C4K3 (WD_REPEATS_REGION domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_231798 PE=4 SV=1)

HSP 1 Score: 428.328 bits (1100), Expect = 2.098e-135
Identity = 279/779 (35.82%), Postives = 421/779 (54.04%), Query Frame = 2
Query:  122 LTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKINDENIKWKDEKIRLKKLILDMNDGD---DLRNSR---------HTQDHYQEMXXXXXXXXXXDHKKSHRKKSKFEDKSSTAFIDNSFRFLXXXXXXXXXX---XXXXXXXXXVKLEMGFDSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK--------VDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHIIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLN-NKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFN-DSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            + GI+ FLQ EW + E++  QWEVE+AELQAKIA+LQGERK QENLK DL+RRIKMLE+ALKQER K   L   G   +   +   V + + + E D +    E+S +N    + N  W+  +  L++ + ++   D   D+R++R         H+ D ++       +   ++ +  H  ++    +S  A +  +F FL S+           + +E  + ++  +G D++ EE LAEFD++V +  +       +  SQ GD   WAK        V+ N ++K+KE Y QER G  +    +S+       QA                 M+ N    D+ +   S ++    +K S F+  Q  ++ ++  +++  +   L LG+LA LTV NE                 +     I+    + +KTW+A++TLRSHFDGVRA+ FHP +P+L++ SED TLKLWNL KT+P+KK + SLDVEPVYT+R H  PVL + +    +  +SG +D  IR W IP   +DPYDS+D S+       HTDAVW +  H + ++L S S+DGTV+ W                  LL T+T + D  + T +  V       V  +T+    I ++ T     +L+    S  S  N +     N +V HPT  +TI  ++D HIR FDNNTG+++ S++ H  SV+C+AVD +G  +L+GSHD ++R+WN+ +  C+QEIT HRKKFDESIH +AFHP K   A+AGAD L+KVF+
Sbjct:    1 MPGILHFLQTEWARFEMERSQWEVERAELQAKIAFLQGERKGQENLKQDLVRRIKMLEFALKQERGKYHKLK-YGTELNPEDLKPPVFDKKNEDEVDST----EMSLSNSSTTNINTSWRQGRQLLRQYLQEIGYTDTIIDVRSARVRSLLGIQPHSGDDHE------LQSGLVNGEPQHNNRNDISKRSENAVM-TTFDFLQSEHVVDDEDDNLRTGNESMAGIEDVLG-DAETEEALAEFDFLVSESGEG----AGEARSQ-GDGMPWAKKEKNEEWVVNHNHLSKLKEQYKQERKGKKTSRPSRSS------LQA-----------------MLANLSSSDDDSPNNSPNSSPRADKSSSFN-NQTPDVTDEFGAEEDALDAALGLGELAGLTVTNEA----------------DPLSYDIAAPKEVFRKTWNAKYTLRSHFDGVRALAFHPVEPVLITGSEDHTLKLWNLQKTVPAKK-TASLDVEPVYTFRAHVGPVLCIAISGDGERCYSGGMDSTIRCWNIPNSNIDPYDSYDPSVLQDTLRAHTDAVWGLSIHSSKSQLLSCSADGTVRLW-----------NPGTKSPLLNTFTVDTDDGVATSVDFVRCDPSQMVASYTSSHTYIFDIETGKQVIKLETKLNSDSSSSNQI-----NRVVSHPTLPLTITAHEDRHIRFFDNNTGQIVHSMVAHLDSVTCLAVDPNGLYLLSGSHDCSIRLWNLDSKTCVQEITSHRKKFDESIHDVAFHPQKPYIASAGADALAKVFV 704          
BLAST of Striatin Pro11 vs. TrEMBL
Match: A0A3Q3MK43 (Striatin, calmodulin binding protein OS=Mastacembelus armatus OX=205130 PE=4 SV=1)

HSP 1 Score: 409.453 bits (1051), Expect = 8.137e-128
Identity = 280/783 (35.76%), Postives = 413/783 (52.75%), Query Frame = 2
Query:  110 ANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKINDENIKWKDEKIRLKKLILDMNDGDDLRNSRHTQDHYQEMXXXXXXXXXXDHKKSHRKKSKFEDKSSTAFIDNSFRFLXXXXXXXXXXXXXXXXXXXVKLEMGFDSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHG-DENEWAK------------VDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHII--------EDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAML-CHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE---IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            A YS+ GI+ FLQ+EW + E++  QWEVE+AELQA+IA+LQGER+ QENLK DL+RRIKMLEYALKQER K   L   G   +   I     +++E    +DS++    + ++Q      + WK  +  L++ + ++   D + + +      Q +        +   K S +K     + +  + + +S   +     S+ S             ++  D D EE L  FD++    +     L     S+ G D  EW K            VDQ +IA++KE Y +ER G   K   + N      +  + D++ N    D +    +   + P    +R SV   +N  +V   D    + +P+   + KS I+         +L LG+LA LTV NE   +  D            T+ K    D L +KTW+ +FTLRSHFD VR++ FHP +P+LV+ASED TLKLWNL KT P+KK   +LDVEP+YT+R H   VL + +    +  FSG +DG I+ W  P   +DPYDS++SS+   A F HTD+VW ++    +++L S S+DGTV+ W    D    +              FN+S    +PT + LV +     V  FT G   + NM T+ L  +L       ES G      + N ++ HPT  +TI   +D HI+ FDNNTG+L+ S++ H  SV+ +AVD +G  +++GSHD ++R+WNM T  CIQE T HRKKF+ESIH +AFHP+K    +AGAD L+KVF+
Sbjct:   39 AQYSIPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERRGQENLKKDLVRRIKMLEYALKQERAKFHKLK-YGTELNQGEIQPPSYDSDEG---NDSEVPSPPNSSHQ------LSWKQGRQLLRQYLQEVGYTDTILDVKS-----QRVRALLGLTGDSGDKPSDKKPEPMVNGTEPSSLKDSGMMVRKKQSSTPSS---------TTSDLSDDPDTEEALKGFDFLASPDE-----LDGSPESRSGEDSGEWEKEDQHPLGELAWEVDQGLIAQLKEQYRKERKG--KKGVKRPN------RSKLQDMLAN--LRDAEE---LPPMQPPVAPPSRPSVPR-LNEHEVGRPDEEAMTFLPS---AGKSFILGRVDEAVSNELGLGELAGLTVANEADSLAYDI-----------TNNK----DAL-RKTWNPKFTLRSHFDSVRSLAFHPVEPVLVTASEDHTLKLWNLQKTAPAKK-CAALDVEPIYTFRAHSGAVLCVTMSSSGEQCFSGGVDGTIQSWNTPNPNIDPYDSYESSVLRGALFGHTDSVWGLVYSPAHHRLLSCSADGTVRLWSA-ADTSPSL------------AVFNESGELGVPTSLDLVSSEPAHMVTSFTTGHVGLFNMETQQLVLKL-------ESAGPPEAPCKINKVLSHPTLPITITAQEDRHIQFFDNNTGKLIHSMVAHLDSVTSLAVDPNGLYLMSGSHDCSIRLWNMETKTCIQEFTAHRKKFEESIHDVAFHPTKCYIGSAGADALAKVFV 738          
BLAST of Striatin Pro11 vs. TrEMBL
Match: A0A3B3X8Z0 (Striatin OS=Poecilia mexicana OX=48701 GN=STRN PE=4 SV=1)

HSP 1 Score: 409.453 bits (1051), Expect = 2.961e-127
Identity = 282/810 (34.81%), Postives = 413/810 (50.99%), Query Frame = 2
Query:  110 ANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKINDENIKWKDEKIRLKKLILDMNDGD---DLRNSR----------HTQDHYQEMXXXXXXXXXXDHKKSHRKKSKFEDKSST----AFIDNS-FRFLXXXXXXXXXXXXXXXXXXXVK-------------LEMGFDSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVG-VGSKSTMKSNDCQNGDKQAIYDVVDN-GSTSDCDHEWMVNNAKIPDEFNARESVSNYIN--GEKVSGFDVTQFSNIPNKR--NSQKSHIIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCL--LDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAML-CHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE---IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            A YS+ GI+ FLQ+EW + E++  QWEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K   L   G   +   I     +++E  E D S      S NNQ      + WK  +  L++ + ++   D   D+++ R                + M T  +        K  R K++  D S+      FI+N+ F     + DS     ++ E  + V+             ++   D D EE L  FD++    +     +   +    GD  +W K           VD  ++ K+KE Y +ER G +G K   +S          + D++ N   T D  H   +     P    +R SV  +    G +    +   F   P K      +  +   L LG+LA LTV NE   ++                  I       +KTW+ +FTLRSHFDG+RA+ FHP +P+L++ASED TLK+WNL KT P+K  S SLDVEP+YT+R H+  VLS+ +    +  FSG +DG I+ W  P   +DPYDS+D S+       HTD+VW ++    + +L S S+DGTVK W            N     L     FN+++   +P+ + LV +     V  FTNG   + NM T+ L   ++    S+   G    +   N ++ HPT  +TI   +D HI+ FDNN+G+L+ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  CIQE T HRKKF+ESIH +AFHPSK   A+AGAD L+KVF+
Sbjct:   38 AQYSIPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLK-YGTELNQGDIKPPSYDSDEANENDSSG-----SLNNQ------LSWKHGRQLLRQYLQEVGYTDTILDVKSQRVRALLGLAGDGAGKTGERMSTEPSVNGPNSTPKGTRGKAELSDTSAVLEAFKFIENADFSDEDEEEDSDGKDRTNVESRTIVRKKPSSSSSSSPASMDTSEDPDTEEALKGFDFLSNPDE-----MDTSESRGTGDGTDWDKDEQGPVSEAWDVDPGVMNKLKEQYKKERKGKMGVKRPNRSK---------LQDMLANLRDTEDLSH---MQPQPTP---QSRPSVPRFSEHEGNRTEEVEALTFPPTPGKSFIMGTEEGMENVLGLGELAGLTVANEADGMVY----------------DIGNNKDAMRKTWNPKFTLRSHFDGIRALTFHPVEPVLITASEDHTLKMWNLQKTAPAKNRSTSLDVEPIYTFRAHRGAVLSVVMSSTGEQCFSGGVDGTIQCWNTPNPNIDPYDSYDPSVLRGELSGHTDSVWGLVYSSAHQRLLSCSADGTVKLW----------DANTTSPSLA---VFNENKKLGVPSSVDLVCSEPAHLVTSFTNGQIGLFNMETRQLVLSME----SNLEPGTPCQI---NKVLSHPTLPITITAQEDRHIKFFDNNSGKLIHSMVAHLDAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV 779          
BLAST of Striatin Pro11 vs. TrEMBL
Match: A0A3Q2XW42 (Striatin OS=Hippocampus comes OX=109280 GN=STRN PE=4 SV=1)

HSP 1 Score: 408.297 bits (1048), Expect = 6.808e-127
Identity = 276/817 (33.78%), Postives = 416/817 (50.92%), Query Frame = 2
Query:  110 ANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKINDENIKWKDEKIRLKKLILDMNDGD---DLRNSR----------HTQDHYQEMXXXXXXXXXXDHKKSHRKKSKFEDKSSTAFIDNSFRFLXXXXX---------------------XXXXXXXXXXXXXXVKLEMGFDSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQA-IYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVS--NYINGEKVSGFDVTQFSNIPNKRNSQKSHII-------EDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAML-CHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE---IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            A YS+ GI+ FLQ+EW + E++  QW+VE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K   L   G + +   +     ++++  E D S      S NNQ      + WK  +  L++ + ++   D   D+++ R           +    + M T           K    + K E  S T+ +  +F+F+ + +                       +  +   S       +++  D D E+ L  FD++         + ++ +    GD  +W K           VD  +I K+KE Y +ER G   K   + N  +  D  A + D  D            V++ + P    +R +V   N ++G +    +   F        S KS I+        +L LG+LA LTV NE                 +     I       +KTW+ +FTLRSHFD +RA+ FHP +P+LV+ASED TLK+WNL KT P+KK S SLDVEP+YT+R H+  VLS+ +    +  FSG +DG I+ W +P   +DPYDS+DS++       HTD++W ++    + +L S S+DGTV+ W            N+    L     FN+++   +P+ + LV +     V  FT+G   + NM T  L   L+    SS   G  + +   N ++ HPT  +TI   +D HI+ FDNNTG+L+ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  CIQE T HRKKF+ESIH +AFHPSK   A+AGAD L+KVF+
Sbjct:   38 AQYSIPGILHFLQHEWARFEVERAQWDVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLK-YGTDLNQGDMKPPSYDSDDTNENDTSG-----SLNNQ------LSWKQGRQLLRQYLQEVGYTDTILDVKSQRVRALLGLAGDGSGKTVEHMNTEPLVNGTDASTKGMGTRGKAELSSDTSAVLEAFKFIENAAAEFSDDDDEEDSEGKDRTNVESRTIIRKKPSSSTPPASMDISEDPDTEDALKGFDFL----SSPDEMDISPECRGTGDGTDWDKDEHGPISEAWDVDPGLITKLKEQYRKERKG--KKGVKRPNRSKLQDMLANLRDAED------------VSHMQPPSTPQSRSNVVRFNELDGNRADEVEALTFPP-----TSGKSFIMGSDEAMESELGLGELAGLTVANEA----------------DSLAYDIGNNKDAMRKTWNPKFTLRSHFDAIRALAFHPVEPVLVTASEDHTLKMWNLQKTTPAKK-STSLDVEPIYTFRAHRGAVLSVVMSSSGEQCFSGGVDGTIQCWNMPNPNIDPYDSYDSTVLRGELCGHTDSIWGLVYSSAHQRLLSCSADGTVRLW----------DANSTSPALA---VFNENKKMGVPSSVDLVCSEPAHLVTSFTSGEIGLFNMETSQLVLNLE----SSSEQGPPIHI---NKILSHPTLPITITAQEDRHIKFFDNNTGKLIHSMVAHLDAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV 782          
BLAST of Striatin Pro11 vs. TrEMBL
Match: A0A087YNI1 (Striatin OS=Poecilia formosa OX=48698 GN=STRN PE=4 SV=2)

HSP 1 Score: 407.527 bits (1046), Expect = 1.219e-126
Identity = 283/810 (34.94%), Postives = 414/810 (51.11%), Query Frame = 2
Query:  110 ANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKINDENIKWKDEKIRLKKLILDMNDGD---DLRNSR----------HTQDHYQEMXXXXXXXXXXDHKKSHRKKSKFEDKSST----AFIDNS-FRFLXXXXXXXXXXXXXXXXXXXVK-------------LEMGFDSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVG-VGSKSTMKSNDCQNGDKQAIYDVVDN-GSTSDCDHEWMVNNAKIPDEFNARESVSNYIN--GEKVSGFDVTQFSNIPNKR--NSQKSHIIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCL--LDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAML-CHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE---IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            A YS+ GI+ FLQ+EW + E++  QWEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K   L   G   +   I     +++E  E D S      S NNQ      + WK  +  L++ + ++   D   D+++ R                + M T  +        K  R K++  D S+      FI+N+ F     + DS     ++ E  + V+             ++   D D EE L  FD++    +     +   +    GD  +W K           VD  ++ K+KE Y +ER G +G K   +S          + D++ N   T D  H   +     P    +R SV  +    G +    +   F   P K      +  +   L LG+LA LTV NE   ++                  I       +KTW+ +FTLRSHFDG+RA+ FHP +P+L++ASED TLK+WNL KT P+KK S SLDVEP+YT+R H+  VLS+ +    +  FSG +DG I+ W  P   +DPYDS+D S+       HTD+VW ++    + +L S S+DGTVK W            N     L     FN+++   +P+ + LV +     V  FTNG   + NM T+ L   ++    S+   G    +   N ++ HPT  +TI   +D HI+ FDNN+G+L+ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  CIQE T HRKKF+ESIH +AFHPSK   A+AGAD L+KVF+
Sbjct:   38 AQYSIPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLK-YGTELNQGDIKPPSYDSDEANENDSSG-----SLNNQ------LSWKHGRQLLRQYLQEVGYTDTILDVKSQRVRALLGLAGDGAGKTGERMSTEPSVNGPNSTPKGTRGKAELSDTSAVLEAFKFIENADFSDEDEEEDSDGKDRTNVESRTIVRKKPSSSSSSSPASMDTSEDPDTEEALKGFDFLSNPDE-----MDTSESRGTGDGTDWDKDEQGPVSEAWDVDPGVMNKLKEQYKKERKGKMGVKRPNRSK---------LQDMLANLRDTEDLSH---MQPQPTP---QSRPSVPRFSEHEGNRTEEVEALTFPPTPGKSFIMGTEEGMENVLGLGELAGLTVANEADSMVY----------------DIGNNKDAMRKTWNPKFTLRSHFDGIRALTFHPVEPVLITASEDHTLKMWNLQKTAPAKK-STSLDVEPIYTFRAHRGAVLSVVMSSTGEQCFSGGVDGTIQCWNTPNPNIDPYDSYDPSVLRGELSGHTDSVWGLVYSSAHQRLLSCSADGTVKLW----------DANTTSPSLA---VFNENKKLGVPSSVDLVCSEPAHLVTSFTNGQIGLFNMETRQLVLSME----SNLEPGTPCQI---NKVLSHPTLPITITAQEDRHIKFFDNNSGKLIHSMVAHLDAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV 778          
BLAST of Striatin Pro11 vs. Ensembl Cavefish
Match: ENSAMXT00000022256.2 (striatin-like [Source:NCBI gene;Acc:103029182])

HSP 1 Score: 323.553 bits (828), Expect = 3.093e-98
Identity = 201/552 (36.41%), Postives = 295/552 (53.44%), Query Frame = 2
Query:  761 MGFDSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK------VDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQA-IYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKR---NSQKSHIIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAML-CHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            +G D D EE L +FD++       + +  + +    GD  +W K      VDQ +I K+KE Y +ER G   K   + N  +  D  A + D  +  S         +     P+     E  S++ +   V   +   F     K     ++++    +L LG+LA LTV NE              + N   D  IS      +KTW+ +FTLRSHFDG+R + FHP +P+L++ASED TLK+WNL KT P+KK + SLDVEP+YT+R H+  VL + + +  +  +SG LDG I+ W  P   +DPYDS+  S+   A   HTDAVW ++    + +L S S+DGTV+ W            N Q    ++     D  +P+ + LV +     V  F NG   + NM     +TR QV +   ES   S    + N ++ HPT  +TI   +D HI+ +DNNTG+L+ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+    CIQE T HRKKFDESIH +AFHPSK   A+AGAD L+KVF+
Sbjct:  272 VGDDPDAEEALKDFDFL----SNTEDMDTSPESRSAGDGTDWEKDRQAWDVDQGLITKLKEQYRKERKG--KKGVKRPNRTKLQDMLANLRDTEEPSSLQPS-----ITPPPRPNANRFNEHDSSHTDEGAVPPVEAITFPPSSGKAFIIGTEEAMETGELGLGELAGLTVANE--------------ADNLAYD--ISNNKDALRKTWNPKFTLRSHFDGIRGLAFHPVEPVLITASEDHTLKMWNLQKTTPAKK-NASLDVEPIYTFRAHRGAVLCVVMSNTGEQCYSGGLDGTIQCWNTPSPNIDPYDSYQPSVLRGALCGHTDAVWGLVHSSAHQRLLSCSADGTVRLWNAS---------NPQAALAVFNEN-KDLGLPSSVDLVCSDPAYMVTSFNNGRIGLFNM-----ETRQQVLN--MESTVESGASCQINKVLSHPTLPITITAQEDRHIKFYDNNTGKLIHSMVAHLDAVTSLAVDPNGLYLMSGSHDCSIRLWNLENKTCIQEFTAHRKKFDESIHDVAFHPSKCYIASAGADSLAKVFV 778          

HSP 2 Score: 112.849 bits (281), Expect = 2.948e-25
Identity = 49/71 (69.01%), Postives = 60/71 (84.51%), Query Frame = 2
Query:  110 ANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            A YS+ GI+ FLQ+EW + E++  QWEVE+AELQA++A+L GERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   40 AQYSIPGILHFLQHEWARFEVERAQWEVERAELQAQVAFLHGERKGQENLKKDLVRRIKMLEYALKQERAK 110          
BLAST of Striatin Pro11 vs. Ensembl Cavefish
Match: strn3 (striatin 3 [Source:NCBI gene;Acc:103045599])

HSP 1 Score: 308.531 bits (789), Expect = 3.814e-93
Identity = 173/434 (39.86%), Postives = 244/434 (56.22%), Query Frame = 2
Query: 1124 GEKVSGFDVTQFSN-IPNKRNSQKSHIIED-------LSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILT-----KKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLL--DQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            GE  S  D T+++  +P      KS I+         L LGDLA LTV+N                     DE     D+       +KTW+A++TLRSHFDGVRA+ FHP +P+LV+ SED TLKLWNL KT+P+KK S S DVEP+YT+R H  PVLSL +    +  FSG +D  I+ W IP   +DPYD++D S+   +   HTDAVW +    + N+L S S+DGTVK W    D  E++       CL    +  +  IPT +          V  F  GS  I ++ T            SS   GN +     N +V HPT  +TI  ++D HI+ FDN +G+++ +++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  C+QE+T HRKK DESI+ +AFHPSK    +AGAD L+KVF+
Sbjct:  320 GEARSSGDGTEWAEPLPFPSGGGKSFIMGSDDVLDSVLGLGDLADLTVSN---------------------DEADYSYDLPANKDAFRKTWNAKYTLRSHFDGVRALAFHPVEPVLVTVSEDHTLKLWNLQKTVPAKK-SASFDVEPIYTFRAHVGPVLSLAVTASGEQCFSGGIDSTIQWWNIPSSNVDPYDTYDPSVLAGSLLGHTDAVWGLAYSGIKNRLLSCSADGTVKLW----DPQEKM------PCLCTFNSEREHGIPTAVDFNGCDPAYMVASFNTGSAVIYDLETSQSVVEFSAQKDSSLPAGNHI-----NKVVSHPTLPVTITAHEDRHIKFFDNKSGKVIHAMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEVTAHRKKSDESIYDVAFHPSKAYIGSAGADALAKVFV 716          

HSP 2 Score: 108.612 bits (270), Expect = 5.802e-24
Identity = 46/69 (66.67%), Postives = 59/69 (85.51%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            Y++ GI+ ++Q+EW + E++   WEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   59 YTIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKNDLVRRIKMLEYALKQERAK 127          
BLAST of Striatin Pro11 vs. Ensembl Cavefish
Match: ENSAMXT00000049468.1 (striatin-like [Source:NCBI gene;Acc:103029182])

HSP 1 Score: 303.523 bits (776), Expect = 4.579e-91
Identity = 166/393 (42.24%), Postives = 234/393 (59.54%), Query Frame = 2
Query: 1208 DLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAML-CHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            +L LG+LA LTV NE              + N   D  IS      +KTW+ +FTLRSHFDG+R + FHP +P+L++ASED TLK+WNL KT P+KK + SLDVEP+YT+R H+  VL + + +  +  +SG LDG I+ W  P   +DPYDS+  S+   A   HTDAVW ++    + +L S S+DGTV+ W            N Q    ++     D  +P+ + LV +     V  F NG   + NM     +TR QV +   ES   S    + N ++ HPT  +TI   +D HI+ +DNNTG+L+ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+    CIQE T HRKKFDESIH +AFHPSK   A+AGAD L+KVF+
Sbjct:  388 ELGLGELAGLTVANE--------------ADNLAYD--ISNNKDALRKTWNPKFTLRSHFDGIRGLAFHPVEPVLITASEDHTLKMWNLQKTTPAKK-NASLDVEPIYTFRAHRGAVLCVVMSNTGEQCYSGGLDGTIQCWNTPSPNIDPYDSYQPSVLRGALCGHTDAVWGLVHSSAHQRLLSCSADGTVRLWNAS---------NPQAALAVFNEN-KDLGLPSSVDLVCSDPAYMVTSFNNGRIGLFNM-----ETRQQVLN--MESTVESGASCQINKVLSHPTLPITITAQEDRHIKFYDNNTGKLIHSMVAHLDAVTSLAVDPNGLYLMSGSHDCSIRLWNLENKTCIQEFTAHRKKFDESIHDVAFHPSKCYIASAGADSLAKVFV 746          

HSP 2 Score: 113.62 bits (283), Expect = 1.960e-25
Identity = 49/71 (69.01%), Postives = 60/71 (84.51%), Query Frame = 2
Query:  110 ANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            A YS+ GI+ FLQ+EW + E++  QWEVE+AELQA++A+L GERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   40 AQYSIPGILHFLQHEWARFEVERAQWEVERAELQAQVAFLHGERKGQENLKKDLVRRIKMLEYALKQERAK 110          
BLAST of Striatin Pro11 vs. Ensembl Cavefish
Match: strn (striatin, calmodulin binding protein [Source:ZFIN;Acc:ZDB-GENE-070112-1172])

HSP 1 Score: 284.263 bits (726), Expect = 9.435e-84
Identity = 193/563 (34.28%), Postives = 279/563 (49.56%), Query Frame = 2
Query:  770 DSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQA-IYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHII-------EDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLL----DQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAML-CHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSE---IPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D D EE L  FD++       + +  +      GD  +W K           VDQ +I+K+KE Y +ER G   K   + N  +  D  A + D  D            + + + P    AR S+   +N  ++   D  +    P   +S KS I+        +L LG+LA LTV NE                 E     I+      +KTW+ +FTLRSHFD +R + FHP +P+LV+ASED TLK+WNL KT P+KK            Y G       LC++     +  FSG +DG I+ W  P   +DPYDS++ S+   A   HTDAVW ++    ++++ S S DGTV+ W            NA          FN+++   IP+ + LV +     V  F+NG   I NM T+ L   L+  +               N ++ HPT  +TI   +D HIR FDNNTG+L+ S++ H  +V+ +AVD +G  +++GSHD ++R+WNM +  CIQE T HRKK DESI+ +AFHPSK    +AGAD L+KVF+
Sbjct:  283 DPDTEEALKGFDFLA----SSEEMEGSSDSPGGGDAQDWGKTHTSPMSEAWEVDQGLISKLKEQYRKERKG--KKGVKRPNRSKLQDMLANLRDAED------------LPSMQPPVAPPARPSLPR-LNEHELGRADEVEALTFPP--SSGKSFIMGADEALENELGLGELAGLTVANEA----------------ESLAYDITNNKDALRKTWNPKFTLRSHFDSIRGLAFHPVEPVLVTASEDHTLKMWNLQKTAPTKK------------YEG-----AVLCVVMSSNGEQCFSGGVDGTIQSWNTPNPNIDPYDSYEPSVLRGALCGHTDAVWGLVYSSAHHRVLSCSGDGTVRLW------------NAADTSPSLA-VFNENKELGIPSSVDLVCSEPAHMVTAFSNGRMGIFNMETQQLVLELESQN--------------INKVLSHPTLPITITAQEDRHIRFFDNNTGKLIHSMVAHLDAVTSLAVDPNGLYLMSGSHDCSIRLWNMESKTCIQEFTAHRKKSDESINDVAFHPSKCYIGSAGADALAKVFV 764          

HSP 2 Score: 104.375 bits (259), Expect = 1.399e-22
Identity = 47/71 (66.20%), Postives = 56/71 (78.87%), Query Frame = 2
Query:  110 ANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            A YS+ GI+ FLQ+EW + E++  QWEVE     A+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   39 AQYSIPGILHFLQHEWARFEVERAQWEVESKLQTAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 109          
BLAST of Striatin Pro11 vs. Ensembl Cavefish
Match: strn4 (striatin 4 [Source:NCBI gene;Acc:103038311])

HSP 1 Score: 201.445 bits (511), Expect = 2.396e-54
Identity = 121/342 (35.38%), Postives = 186/342 (54.39%), Query Frame = 2
Query: 1208 DLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLN-NKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTK----LLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGS 2212
            D++LG+LA LTV N+                NE T++     +   KKTW+ RFTLRSHFD +RA+ FHPS+ +L++ASED TLKLWNL K + SKK + +LDVEPVYT+R H   VLSL + +  +  +SG LDG +R W+IP   +DPYD++D  ++ S    H D+VW +       +L S S+DGTV+ W             +   C+       +   PT I          VV F  G   + ++ T+    +L+T+ +        DG+ L     N +V HP++ ++I  +++  IR  DN TG+++ S++ H  +V+C+  D  G  +++GS
Sbjct:  406 DINLGELADLTVAND----------------NEVTNDLQDSREEF-KKTWNPRFTLRSHFDAIRALTFHPSEAVLLTASEDGTLKLWNLNKAMHSKK-NAALDVEPVYTFRAHSGAVLSLSMGEDGETCYSGGLDGSVRCWKIPDLNVDPYDNYDPGVESSVLLGHEDSVWDLAYSPTLKRLASCSADGTVRIW----------DPQSSSPCISVFNKEKEHGTPTSIAFGNADVSQAVVSFDGGETVLYDLNTEQSILVLETQTK--------DGSKL----INRVVSHPSEQISITAHENRTIRFMDNKTGKVVHSMVAHLDAVTCLTTDPKGTYLVSGS 707          

HSP 2 Score: 101.679 bits (252), Expect = 1.044e-21
Identity = 60/158 (37.97%), Postives = 90/158 (56.96%), Query Frame = 2
Query:  101 DECANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIY-----LELSKNNQKINDENIKWKDEKIRLKKLILDMNDGD---DLRNSR 550
            D  A  SL GI+ F+Q EW + + +  +WE E+ EL+A++A+LQGERK QEN+K DL+RRIKMLEYALKQER K   L    D S            E++ + ++  I      L++  +NQ      + WK+ +  L+K + ++   D   D+R+ R
Sbjct:   60 DGEAGLSLPGILHFIQYEWGRFQAEKYRWEAERDELRAQVAFLQGERKGQENMKQDLVRRIKMLEYALKQERAKYQKLKTGTDQSP----------GEKRPDTENETILNGPADLDIEPSNQ------MTWKEGRQLLRKYLEEVGYSDTILDMRSKR 201          
BLAST of Striatin Pro11 vs. Ensembl Sea Lamprey
Match: strn (striatin, calmodulin binding protein [Source:ZFIN;Acc:ZDB-GENE-070112-1172])

HSP 1 Score: 316.62 bits (810), Expect = 1.053e-98
Identity = 202/569 (35.50%), Postives = 289/569 (50.79%), Query Frame = 2
Query:  749 VKLEMGFDSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAK-----------VDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHI------IEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLL--DQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTK----LLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNT--GELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
             K ++  D D EE L EFD++V     +       +    GD  EW K           +D  +I K+KE Y +ER              +  ++ A+ D++ N    D   E     A  P       +  +Y   E         F  IP  R + K  I      ++   LG+LA LTV N+                 +     I       +KTW+ +FTLRSHFDGVRA+ FHPS+ +LV+ASED TLKLWNL KTI  KK + SLDVEP+YT+R H  PVLSL +    +  FSG  D  IR W +P   +DPYD+F++S+       H+DAVW +    L  +L S S+DGTV+ W        +        CL       +  IP  +  V  +  L V  F  G   + +M T      L++R++  +P     GN +     N +V HPT  +T+  ++D HI+ FDNNT  G+ + S++ H  +V+C+AVD +G  +++GSHD ++R+WN+ +  C+QEIT HRKKFDE+IH +AFHPSK   A+AGAD L+KVF+
Sbjct:   43 AKADLADDPDTEEALKEFDFLVTTEDGEG----AGEARSSGDGTEWDKEELSPSGEEWDIDHGLITKLKEQYKKER--------KNKKGAKRPNRSALQDMLANLREVD---ELSPLAASSPPRQPEERAAQSYARLE--------AFPLIPFPRGTGKMFISGPEEAMDTTGLGELADLTVTNDA----------------DSPSYDIGANKDAFRKTWNPKFTLRSHFDGVRALAFHPSEHVLVTASEDHTLKLWNLQKTISGKK-TASLDVEPIYTFRAHTGPVLSLAISTSGEQCFSGGTDASIRCWNMPSPNIDPYDTFEASVLGQTLLGHSDAVWGLAYSSLRRRLLSCSADGTVRLW--------DPSCQDSPPCLNTYNPDKEHGIPVSVDFVSDASHL-VATFGGGDTLVFDMETAKPVITLESRIETDTPL----GNQI-----NRVVSHPTLPITVTAHEDRHIKFFDNNTATGKQVHSMVAHLDAVTCLAVDPNGLYLMSGSHDCSIRLWNLESKTCVQEITAHRKKFDEAIHDVAFHPSKAFIASAGADALAKVFV 553          
BLAST of Striatin Pro11 vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 65.855 bits (159), Expect = 1.712e-11
Identity = 74/299 (24.75%), Postives = 121/299 (40.47%), Query Frame = 2
Query: 1349 KTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLL--DQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLF-SASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIW 2236
            +T + RF    H D V ++ F PS  L+VSAS D T++LW     +PS KG  ++       ++ H + V S+      Q + + S D  I++W +                L +  QH++ V +     + +L  S S D TV+ W  D +  E +    +H   +    F+ S   TCI    T +                 T K+   R+       +  G ++     N L  HPT +  I   +DS ++  D   G L  +L  HQ   + +A   +G    +G  D  V +W
Sbjct:   50 QTRAYRFV--GHKDAVMSVQFSPSGHLVVSASRDKTVRLW-----VPSVKGESTV-------FKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKF-----------LYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVW--DSNSRECVHTFYEHGGFVNQVDFHPSG--TCIAAAGTDN-----------------TVKVWDIRMNKLLQHYQVHGAAV-----NSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVW 297          

HSP 2 Score: 55.0694 bits (131), Expect = 4.853e-8
Identity = 64/289 (22.15%), Postives = 117/289 (40.48%), Query Frame = 2
Query: 1535 YRGHKSPVLSLCL---LDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLF-SASSDGTVKCWLVDLDILEEIRGNA----QHKCLLYTYTFN-DSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVF 2374
            ++GH+  + S+     + QL  SGS+D  + +W           +F    +   +  H DAV ++    +  L  SAS D TV+ W+        ++G +     H   + + +F+ D +      LV  SDD                + K+     Q    S     N +   + +     P   + + G DD  +R +D+N+ E + +   H   V+ +    SG C+     D  V++W+    I + ++  H +    +++ L+FHP+ N   TA  D   KV 
Sbjct:   14 FKGHRDTITSVDFNPNMKQLA-SGSMDACLMVW-----------NFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWV------PSVKGESTVFKAHTATVRSVSFSADGQ-----SLVTASDD---------------KSIKVWTVHRQKFLYSLNQHSNWVRSAKFS-----PDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWD----IRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVL 255          
BLAST of Striatin Pro11 vs. Ensembl Sea Lamprey
Match: WDR86 (WD repeat domain 86 [Source:HGNC Symbol;Acc:HGNC:28020])

HSP 1 Score: 62.7734 bits (151), Expect = 1.072e-10
Identity = 48/155 (30.97%), Postives = 71/155 (45.81%), Query Frame = 2
Query: 1427 LLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCL--LDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIG 1885
            LL+S S D T++LW L+    ++            T RGH+ PVL L +   +  ++SG  DG +R W              S  QL +Y +HTD V   L   N  L+S SSDGT + WL ++     +     HK  + T  ++D  + T  G
Sbjct:  174 LLMSGSVDGTVRLWRLSSGACAR------------TLRGHQGPVLCLAVDASNGALYSGGADGTVRKW-----------DLSSGQQLRSYTEHTDLV-ICLQLANRHLYSGSSDGTARRWLSEVGGCARV--YRPHKHTVSTLRYHDGILFTGSG 302          
BLAST of Striatin Pro11 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 6.031e-9
Identity = 75/316 (23.73%), Postives = 133/316 (42.09%), Query Frame = 2
Query: 1430 LVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIV-GYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVF 2374
            +VS S+D TLK+W+            ++  + + T  GH   V S  +   +I SGS D  +++W           + D+   +   + HT  V  M  H  N++ S S D T++ W  D++  + +   A H   +    ++   +      V  + D  V                      +V  P SE+  ++L  G  N +       + IV G  D+ IR +D  TG  L +L+ HQ   S   ++     +++G+ D+ V+IW++ T  C+Q +     K   ++  L F  S+ L  T+  DG  K++
Sbjct:  247 IVSGSDDNTLKVWS------------AVTGKCLRTLVGHTGGVWSSQMRGNIIVSGSTDRTLKVW-----------NADTGQCVHTLYGHTSTVRCMHLH-GNRVVSGSRDATLRVW--DIETGQCLHVLAGHVAAVRCVQYDGRRV------VSGAYDYTV----------------------KVWDPESETCLHTL-QGHTNRVYSLQFDGVHIVSGSLDTSIRVWDAETGTCLHTLVGHQSLTS--GMELRDNILVSGNADSTVKIWDIKTGQCLQTLQ-GPNKHQSAVTCLQF--SRKLVVTSSDDGTVKLW 502          

HSP 2 Score: 52.373 bits (124), Expect = 3.820e-7
Identity = 83/318 (26.10%), Postives = 130/318 (40.88%), Query Frame = 2
Query: 1322 ISKLDILTKKTWSA-----RFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDI-LEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLL---VHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMAT 2248
            +S  D  T K WSA       TL  H  GV +     +  ++VS S D TLK+WN                + V+T  GH S V  + L    + SGS D  +R+W I  G             L     H  AV   + +   ++ S + D TVK W  + +  L  ++G   H   +Y+  F+   I +  G + TS  + V     G+C    +  + L + +++               R N LV          G  DS ++ +D  TG+ L +L     HQ +V+C+    S   V+T S D  V++W++ T
Sbjct:  248 VSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRGN--IIVSGSTDRTLKVWNADTG------------QCVHTLYGHTSTVRCMHLHGNRVVSGSRDATLRVWDIETGQC-----------LHVLAGHVAAV-RCVQYDGRRVVSGAYDYTVKVWDPESETCLHTLQG---HTNRVYSLQFDGVHIVS--GSLDTS--IRVWDAETGTCLHTLVGHQSLTSGMEL---------------RDNILV---------SGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQF--SRKLVVTSSDDGTVKLWDLRT 506          
BLAST of Striatin Pro11 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008376.1 (pep scaffold:Pmarinus_7.0:GL476355:345359:369781:1 gene:ENSPMAG00000007551.1 transcript:ENSPMAT00000008376.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 1.471e-8
Identity = 49/171 (28.65%), Postives = 72/171 (42.11%), Query Frame = 2
Query: 1877 CIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQV---PSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNM-ATWICIQEITCHRKKFDESIHQLAFHPS-KNLFATAGADGLSKVF 2374
            C+ L P S+   +    NGS  + N  T+ L    +V   P  +++       V R N +V          G DD  IR F+ NT E +     H   + CIAV  S   +LT S D  +++W+    W C Q    H       + Q+  +P   N FA+A  D   KV+
Sbjct:   20 CVDLHP-SEPWMLASLYNGSVCVWNHETQTLVKTFEVCDLPVRAAKF------VARKNWMVA---------GSDDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPSQPFLLTSSDDMLIKLWDWEKKWTCSQVFEGH----THYVMQIVINPKDNNQFASASLDRTIKVW 170          

HSP 2 Score: 48.1358 bits (113), Expect = 9.136e-6
Identity = 53/249 (21.29%), Postives = 99/249 (39.76%), Query Frame = 2
Query: 1373 LRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLL---DQLIFSGSLDGEIRIWRIPVGALDP---YDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHI 2101
              +H D +R I  HPSQP L+++S+D  +KLW+  K     +            + GH   V+ + +    +    S SLD  I++W++  G+  P    +  +  +    Y+   D  +         L S + D  VK W            + QHK    T      ++     ++  +  ++V+ +  G+  I + +T  L++ L            + G+ RA C+      +   +GYD+  I
Sbjct:   95 FEAHSDYIRCIAVHPSQPFLLTSSDDMLIKLWDWEKKWTCSQ-----------VFEGHTHYVMQIVINPKDNNQFASASLDRTIKVWQL--GSSTPNFTLEGHEKGVNCVDYYSGGDKPY---------LISGADDRLVKIW------------DYQHKI---TTAMKKYKLKQLHQILIRAKTVYVLWYA-GTVRIWHSSTYRLESTL------------NYGMERAWCVSGLRGSNTIALGYDEGSI 293          
BLAST of Striatin Pro11 vs. Ensembl Yeast
Match: MET30 (F-box protein containing five copies of the WD40 motif; controls cell cycle function, sulfur metabolism, and methionine biosynthesis as part of the ubiquitin ligase complex; interacts with and regulates Met4p, localizes within the nucleus; dissociation of Met30p from SCF complex in response to cadmium stress is regulated by Cdc48p [Source:SGD;Acc:S000001308])

HSP 1 Score: 63.929 bits (154), Expect = 6.263e-11
Identity = 73/307 (23.78%), Postives = 128/307 (41.69%), Query Frame = 2
Query: 1373 LRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNN-KLFSASSDGTVKCWLVDLD-ILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSES--DGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHR 2281
            L  H DGV+ + F   +  L++ S D T+++WN             +  E + TYRGH   VLS+    ++I SGS D  +++W +             S        HT+ V  +  H  +   FS S D T++ W +  +  L+  RG+      +   T  D E            +L     ++GS    + T          PS   E+  D N          + +PT  ++  G D++ I+ +D  TG+ + +   H + V  IA D     +++GSHD ++++W++ +  C+      R
Sbjct:  338 LSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNY------------ITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHV------------ESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVE------------NLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDEN----------IPYPTHLLS-CGLDNT-IKLWDVKTGKCIRTQFGHVEGVWDIAAD--NFRIISGSHDGSIKVWDLQSGKCMHTFNGRR 592          
BLAST of Striatin Pro11 vs. Ensembl Yeast
Match: COP1 (Alpha subunit of COPI vesicle coatomer complex; complex surrounds transport vesicles in the early secretory pathway [Source:SGD;Acc:S000002304])

HSP 1 Score: 62.7734 bits (151), Expect = 1.750e-10
Identity = 81/354 (22.88%), Postives = 140/354 (39.55%), Query Frame = 2
Query: 1343 TKKTWSARF-TLRSHFD----GVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEP-VYTYRGHKSPVLSLCLLDQL--IFSGSLDGEIRIW----RIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGEL--LSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGL 2362
            T + W  R  TL   F+     VR + FHP+QP+ VSA +D T+K+W             SLD    +YT  GH   V ++    +L  I S S D  IRIW    R  +  L  ++ F     + A F  TD +          + SAS D T++ W        +I G  +      T +F +            S    ++  + G C +  +                  +G++ GV  A+    HPT  + + G DD  ++ +  +  +   + +   H  +V  +        +++   D  +R+W++     +++     K+ ++    +A HP  NLF  A   G+
Sbjct:   34 TIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVW-------------SLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHF----VMCAQFHPTDDL----------IVSASLDETIRIW--------DISGLRKRHSAPGTSSFEEQ----------MSAQQNLLDGSLGDCVVKFIL-----------------EGHTRGVNWAS---FHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQF----KRENDRFWLIAAHPHINLFGAAHDSGI 318          

HSP 2 Score: 56.6102 bits (135), Expect = 1.284e-8
Identity = 40/144 (27.78%), Postives = 60/144 (41.67%), Query Frame = 2
Query: 1364 RFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCL--LDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVD 1789
            +F L  H  GV    FHP+ PL+VS S+D  +KLW ++ T              V T RGH + V S+       LI S   D  +R+W             D    +  + +  D  W +  H +  LF A+ D  +  + +D
Sbjct:  202 KFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSAT----------KAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVW-----------DLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLD 324          

HSP 3 Score: 53.1434 bits (126), Expect = 1.716e-7
Identity = 37/110 (33.64%), Postives = 50/110 (45.45%), Query Frame = 2
Query: 1322 ISKLDILTKKTWSAR-----FTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVL--SLCLLDQLIFSGSLDGEIRIWRI 1630
            +S  D  T K WS       +TL  H D VR + FH   P ++SAS+D T+++WN              + + +    GH   V+       D LI S SLD  IRIW I
Sbjct:   69 VSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQ------------NRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDI 166          

HSP 4 Score: 48.521 bits (114), Expect = 4.755e-6
Identity = 22/62 (35.48%), Postives = 35/62 (56.45%), Query Frame = 2
Query: 1313 DEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKK 1498
            D ++    +   K W    T R H + V +++FHP Q L++S  ED TL++W+L K  P K+
Sbjct:  230 DRQVKLWRMSATKAWEVD-TCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQ 290          
BLAST of Striatin Pro11 vs. Ensembl Yeast
Match: SEC27 (Essential beta'-coat protein of the COPI coatomer; involved in ER-to-Golgi and Golgi-to-ER transport; contains WD40 domains that mediate cargo selective interactions; 45% sequence identity to mammalian beta'-COP [Source:SGD;Acc:S000003105])

HSP 1 Score: 60.8474 bits (146), Expect = 6.495e-10
Identity = 83/350 (23.71%), Postives = 141/350 (40.29%), Query Frame = 2
Query: 1328 KLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNK-LFSASSDGTVKCWLVDLD-ILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPS--KNLFATAGADGLS 2365
            KLDI  KKT+S R       D V+ I FHP++P +++      ++LWN    +  +  S+ +   PV   R  K            I  GS D  IR++         Y++ +  +   A   H D + ++  H     + S S D TVK W  + +  LE+     +H  +             C+   P     F  G     C  ++ T K+       P+  + + G   GV   +   + P K   I   DD  I+ +D  T   +++L  H  +VS      +   +++GS D  ++IWN +T+   + +        E    +A HP+  KN  A+   +G +
Sbjct:    2 KLDI--KKTFSNRS------DRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVR--SIQVTETPV---RAGK-----FIARKNWIIVGSDDFRIRVFN--------YNTGEKVVDFEA---HPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVM-------------CVAFNPKDPSTFASG-----C--LDRTVKVWSLGQSTPN-FTLTTGQERGVNYVDYYPL-PDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGL----ERSWCIATHPTGRKNYIASGFDNGFT 296          

HSP 2 Score: 53.5286 bits (127), Expect = 1.286e-7
Identity = 38/116 (32.76%), Postives = 54/116 (46.55%), Query Frame = 2
Query: 2033 RANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMA-TWICIQEITCHRKKFDESIHQLAFHPS-KNLFATAGADGLSKVF 2374
            RA   +    K+  IVG DD  IR F+ NTGE +     H   +  IAV  +   VL+GS D  V++WN    W   Q    H    +  +  +AF+P   + FA+   D   KV+
Sbjct:   59 RAGKFIAR--KNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGH----EHFVMCVAFNPKDPSTFASGCLDRTVKVW 168          

HSP 3 Score: 47.7506 bits (112), Expect = 6.764e-6
Identity = 37/118 (31.36%), Postives = 55/118 (46.61%), Query Frame = 2
Query: 1322 ISKLDILTKKTW-----SARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWN-----LTKTI--------------PSKKGSVSLDVEPVYTY--RGHKSPVLSLCLLDQLIFSG 1597
            I+  D LT K W     S   TL  H   V   VFHP+ P+++S SED TLK+WN     + KT+                +K  ++   +  +T    G+  P LSL  + +L++SG
Sbjct:  202 ITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLGNDEPTLSLDPVGKLVWSG 319          
BLAST of Striatin Pro11 vs. Ensembl Yeast
Match: RRT13 (Putative protein of unknown function; non-essential gene identified in a screen for mutants with decreased levels of rDNA transcription [Source:SGD;Acc:S000000868])

HSP 1 Score: 55.0694 bits (131), Expect = 4.358e-9
Identity = 37/146 (25.34%), Postives = 69/146 (47.26%), Query Frame = 2
Query: 1367 FTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLD--------VEPVYTYRGHKSPVLSLCLLDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCW 1780
            + L  H D + + ++   +   +SAS DTT+++W+L     + + S + +        +  +YT RGH++ V  L L D+ + S S+DG IR W       D    F     L  +F HT        H+++++  + S+G +  +
Sbjct:    5 YILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCAKILGAMYTLRGHRALVGLLGLSDKFLVSASVDGSIRCW-------DANTYF-----LKHFFDHTQLNTITALHVSDEVLVSGSEGLLNIY 138          
BLAST of Striatin Pro11 vs. Ensembl Yeast
Match: PRP46 (Member of the NineTeen Complex (NTC); this complex contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs [Source:SGD;Acc:S000006072])

HSP 1 Score: 55.4546 bits (132), Expect = 2.061e-8
Identity = 74/308 (24.03%), Postives = 122/308 (39.61%), Query Frame = 2
Query: 1364 RFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCL---LDQLIFSGSLDGEIRIW----RIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDG--NSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSL--------LVHQKSVSCIAVDCSGGCVLTGSHDTAVRIW 2236
            + TL  H   VR +      P L S SED T+K W+L K             + +  Y GH S V ++ +   LD LI +   D  I++W    RIPV  L  +    + +Q +               ++ ++ S+S+D TV+ W  D+   + ++    HK  +     +  E          +DD+   G   GS          L T  +     SE  G  N+L + + + L           G D+  +  +D  +G    SL        L  ++SV C   D +G  ++TG  D +++IW
Sbjct:  175 KTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKN------------QIIRDYYGHLSGVRTVSIHPTLD-LIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTP--------------VDPQVVSSSTDATVRLW--DVVAGKTMKVLTHHKRSVRATALHPKEFSVASAC---TDDIRSWGLAEGS----------LLTNFE-----SEKTGIINTLSINQDDVL---------FAGGDNGVLSFYDYKSGHKYQSLATREMVGSLEGERSVLCSTFDKTGLRLITGEADKSIKIW 426          

HSP 2 Score: 53.9138 bits (128), Expect = 5.495e-8
Identity = 38/145 (26.21%), Postives = 70/145 (48.28%), Query Frame = 2
Query: 1943 IINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPT-KSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVF 2374
            I+N   KLL  R +  +P   S   +  +G   C+ + P      I G +D+ ++ +D  TG+L ++L  H  +V  +AV      + + S D  V+ W++     I++   H       +  ++ HP+ +L ATAG D + K++
Sbjct:  111 IVNRYEKLLSQRPEWHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHL----SGVRTVSIHPTLDLIATAGRDSVIKLW 251          
BLAST of Striatin Pro11 vs. Ensembl Nematostella
Match: EDO48532 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ76])

HSP 1 Score: 292.352 bits (747), Expect = 4.342e-88
Identity = 160/394 (40.61%), Postives = 234/394 (59.39%), Query Frame = 2
Query: 1211 LSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCL--LDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNN-KLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFN--DSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            L LG+LA LTVNNE                 E    +I+K D   +KTW+ +FTLRSHFD +R++ FHP +  +++ASED T+KLWNL KT+P KK ++ LDVEP+YT+RGH + VLS+ +     + FSG  DG I  W IP   LDPY  +  ++  +    HTDAVW +    N+ +L S SSDGT + W   L              LL T+  +   S  PT I  +       V  +++   +I ++ T   +  + + S  + S+ ++    + N +V HPT  +TI  ++D HIR FDNNTG+ + S++ H  +V+ +AVD +G  +L+GSHD ++R+WN+ +  C+QEIT HRKKFDESI+ +AFHP+K   A+AGADGL+KVF+
Sbjct:  301 LGLGELAELTVNNEA----------------EALSYEINKKDEF-RKTWNPKFTLRSHFDSIRSVYFHPQEAAVITASEDHTMKLWNLQKTVPQKKSNI-LDVEPIYTFRGHSAAVLSVVISSTSDMCFSGGADGTILCWNIPSLDLDPYGPYSPNVTGALLEVHTDAVWGLAVQTNSLQLLSCSSDGTCRLWNPTL-----------KSPLLNTFILDKESSCTPTSIDFLRMDTSQMVASYSSARAAIFDLETA--EAVVNLDSAKTYSNPST----QINKVVSHPTLPVTITAHEDRHIRFFDNNTGKQIHSMVAHLDAVTSLAVDPNGLYLLSGSHDCSIRLWNLDSKTCVQEITSHRKKFDESIYDVAFHPTKPYIASAGADGLAKVFV 659          

HSP 2 Score: 107.457 bits (267), Expect = 4.897e-24
Identity = 46/69 (66.67%), Postives = 59/69 (85.51%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            +++ GI+ F+Q+EW + E++   WEVE+AELQA+IA+LQGERK QENLK DLIRRIKMLE+ALKQER K
Sbjct:    2 FTIPGILHFIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKHDLIRRIKMLEFALKQERAK 70          
BLAST of Striatin Pro11 vs. Ensembl Nematostella
Match: EDO29812 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2K4])

HSP 1 Score: 159.458 bits (402), Expect = 5.320e-44
Identity = 100/283 (35.34%), Postives = 155/283 (54.77%), Query Frame = 2
Query: 1379 SHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCL--LDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNN-KLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFN--DSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGS 2212
            SHFD +R++ FHP +  +++ASED T+KLWNL KT+P KK ++ LDVEP+YT+RGH + VLS+ +     + FSG  DG I  W IP   LDPY  +       A+   T    A+    N+ +L S S+DGT + W   L              LL T+  +   S  PT I  +       V  +++   +I ++ T   +  + + S  + S+ ++    + N +V HPT  +TI  ++D HIR FDNNTG+ + S++ H  +V+ +AVD +G  +L+GS
Sbjct:    1 SHFDSIRSVYFHPQEAAVITASEDHTMKLWNLQKTVPQKKSNI-LDVEPIYTFRGHSAAVLSVVISSTSDMCFSGGADGTILCWNIPSLDLDPYGPYS-----CAFLGSTVLFGALPVQTNSLQLLSCSADGTCRLWNPTLK-----------SPLLNTFILDKESSCTPTSIDFLRMDTSQMVASYSSARAAIFDLETA--EAVVNLDSAKTYSNPST----QINKVVSHPTLPVTITAHEDRHIRFFDNNTGKQIHSMVAHLDAVTSLAVDPNGLYLLSGS 260          
BLAST of Striatin Pro11 vs. Ensembl Nematostella
Match: EDO49439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK1])

HSP 1 Score: 68.5514 bits (166), Expect = 3.171e-12
Identity = 85/337 (25.22%), Postives = 129/337 (38.28%), Query Frame = 2
Query: 1370 TLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEI--PTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVF 2374
            +L  H  G+ A+        +V+ SED T +LW+ T+T            + +   +GH   +  +C  D+  F+ + D  IR W +  G             +  +  H   V  +L ++ + LFS S D T K W  D    E +R    HK  +Y   F  SEI   T I L   +DD+ V G  + +     M +       +  +     +G  L      CL V     +   G  DS IR +D +T   L S   H  SV CI V      + + S D   + W +    C +    H+      + Q        L  T   DG +KVF
Sbjct:   27 SLEHHEGGINAMCISSDGKTIVTGSEDKTGRLWD-TRT-----------EDTIGELQGHVGYINGVCASDKYAFTCASDKTIRKWSLETGRC-----------IKVFKGHASTVHRVL-YVCDFLFSTSYDKTAKLWQADTG--ECVRTFKGHKRGVYPLIFVPSEINRGTYIDL-DNNDDILVTGSADNTAKAWGMNSN------ECMNTFKGHEGAIL------CLAVDGKGRLLFTGSSDSTIRSWDLHTYSPLKSFKGHSASVICIQV--VNKLMYSSSADHTAKCWVVEFGDCTRTYRGHKHCIGAMVVQ------DGLMFTGSGDGTAKVF 316          

HSP 2 Score: 61.6178 bits (148), Expect = 4.950e-10
Identity = 57/231 (24.68%), Postives = 91/231 (39.39%), Query Frame = 2
Query: 1343 TKKTWSARF-----TLRSHFDGVRAIVFHPSQ-------------PLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCL--LDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDL-DILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLK 1972
            T K W A       T + H  GV  ++F PS+              +LV+ S D T K W +               E + T++GH+  +L L +    +L+F+GS D  IR W +      P  SF           H+ +V  +   +N  ++S+S+D T KCW+V+  D     RG+                   CIG +   D L   G  +G+  + +  +   K
Sbjct:  135 TAKLWQADTGECVRTFKGHKRGVYPLIFVPSEINRGTYIDLDNNDDILVTGSADNTAKAWGMNSN------------ECMNTFKGHEGAILCLAVDGKGRLLFTGSSDSTIRSWDLHT--YSPLKSFKG---------HSASVICIQV-VNKLMYSSSADHTAKCWVVEFGDCTRTYRGHKH-----------------CIGAMVVQDGLMFTGSGDGTAKVFDAKSGTCK 324          
BLAST of Striatin Pro11 vs. Ensembl Nematostella
Match: EDO48004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKK9])

HSP 1 Score: 67.3958 bits (163), Expect = 1.453e-11
Identity = 59/195 (30.26%), Postives = 92/195 (47.18%), Query Frame = 2
Query: 1289 LHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSA---SEDTTLKLWNLTKTIPSKK-GSVSLDVEPVY----TYRGHKSPVLSLCLLDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVD-LDILEEIRGNAQHKCLLYT 1846
            LHS   E D++IS L  +  K       +    D +R  +   SQ  L S    S +    L N   T+ S+  G  + D++P++    T+ GH  PV +LC+  +L+FSGS D  I++W          D+  +   +     HT  V A LC  + KLFS S+D  +  W ++ L++L+ I G+    C L T
Sbjct:  306 LHSALREKDQEISYLKNMIVKLTERVDRMEKTVD-IRIDLLDESQTKLSSDLLDSREIVTTLQNDLSTVESRLWGVGTFDIQPLFKCKGTFVGHTGPVWALCVHGELLFSGSSDKTIKVW----------DTLTTYKCVKTLEGHTGIVLA-LCTHDKKLFSGSADCVINIWSIETLELLDSIHGHENPVCTLVT 488          
BLAST of Striatin Pro11 vs. Ensembl Nematostella
Match: EDO40986 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5J4])

HSP 1 Score: 62.3882 bits (150), Expect = 3.128e-10
Identity = 60/228 (26.32%), Postives = 108/228 (47.37%), Query Frame = 2
Query: 1697 HTDAVWAMLC-HLNNKLFSASSDGTVKCWLVDLDILE--EIRGNAQHKCLLYT-YTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSH--IRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHP-SKNLFATAGADG 2359
            H   V AM+  H ++ L SA   G VK W  +++ ++  E     Q + L+ + ++  D++  +C      +DD  V  +    C    M  K L+             G+   V    C+  HP KS+ + G  DS   I+ +D  TG  L++L +H+ +V  I  + +G  +LT S D  ++++++     +Q    H+++       +A+HP  +NLFA+ G+DG
Sbjct:  120 HESPVRAMVWNHHDSWLLSADHSGIVKYWQSNMNNVQMYEAHKEPQSRTLIISSFSPTDNKYASC------ADDGLVKIWDFYRC----MEEKTLR-------------GHGADV---KCIDWHPHKSLLVSGSKDSQQPIKLWDTRTGNGLATLHLHKSTVMSIKWNQNGNWLLTASRDHLLKLFDIRAMKELQAFRGHKREAT----AIAWHPIHENLFASGGSDG 317          
BLAST of Striatin Pro11 vs. Ensembl Medaka
Match: strn3 (striatin 3 [Source:NCBI gene;Acc:101160699])

HSP 1 Score: 308.531 bits (789), Expect = 2.032e-93
Identity = 170/430 (39.53%), Postives = 245/430 (56.98%), Query Frame = 2
Query: 1124 GEKVSGFDVTQFSN-IPNKRNSQKSHIIED--------LSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLD--QLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            GE  S  D T+++  +P      KS ++          L LGDLA + V N+            L S  E +           +KTW+ ++TLRSHFDGVRA+ FHP +P LVS SED TLKLWNLTKT+P+KK S S DVEP+YT+RGH+ PVLSL +    +  FSG +D  I+ W IP   +DPYD++DSS+    +  HTDAVW +    + N+L S S+DGTVK W             A+  C+    T  +  IPT +          V  F  G  +I ++ T      L+      + DG    +   N +V HPT  +TI  ++D HI+ FDN TG+L+ +++ H  +V+C+AV+ +G  +++GSHD ++R+WN+ T  C+QEIT HRKK +E+I+ + FHPSK   A+AGAD L++V++
Sbjct:  297 GEARSSGDGTEWAEPLPFSSGGGKSFLLGGSDDALENMLGLGDLADICVTND-----EVDFGYDLSSSKESS----------FRKTWNPKYTLRSHFDGVRALAFHPVEPCLVSVSEDHTLKLWNLTKTVPAKK-SASFDVEPIYTFRGHEGPVLSLAMTSTGEQCFSGGIDSTIQWWNIPGSNVDPYDTYDSSVLAGTWAGHTDAVWGLAYSGIKNRLLSCSADGTVKLW----------NPAAKEPCISTFNTDMEHGIPTSVDFNGCDPAHMVASFNGGDVAIYDLETSQTAVVLK-----GQGDGTGPSLNHINKVVSHPTLPITITAHEDRHIKFFDNKTGKLIHAMVAHLDAVTCLAVEPNGIYLISGSHDCSLRLWNLDTKTCVQEITAHRKKCEEAIYDVTFHPSKAYIASAGADALARVYV 695          

HSP 2 Score: 108.227 bits (269), Expect = 7.227e-24
Identity = 46/69 (66.67%), Postives = 59/69 (85.51%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            Y++ GI+ ++Q+EW + E++   WEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   48 YTIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKNDLVRRIKMLEYALKQERAK 116          
BLAST of Striatin Pro11 vs. Ensembl Medaka
Match: STRN (striatin [Source:NCBI gene;Acc:101168645])

HSP 1 Score: 305.834 bits (782), Expect = 3.595e-92
Identity = 192/521 (36.85%), Postives = 278/521 (53.36%), Query Frame = 2
Query:  848 NKKLSQHGDENEWAKVDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDN-GSTSDCDHEWMVNNAKIPDEFNARESVSNYINGE-------KVSGFDVTQFSNIPNKRNSQKSHIIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLL--DQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAML-CHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            +++ ++ G  +E   V   +I ++KE Y ++R G   K   + N      +  + D++ N     D  H       + P     R SV  +   E       +   F  T  + I     + KS    DL LG+LAS+TV NE                 E     I       +KTW+ +FTLRSHFDG+RA+ FHP +P+LV+ASED TLK+WNL KT P+KK S SLDVEPVYT+R H+  V+S+ +    +  FSG LDG I+ W  P   +DPYDS+D S+       HTD+VW ++   ++ +L S S+DGTV+ W            +     L       +  IP+ + LV +     V  FTNG   I NM T+ L   L       ES+  +      N ++ HPT  +TI   +D HI+ FDNN+G+L+ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  CIQE T HRKKF+ESIH +AFHPSK   A+AGAD L+KVF+
Sbjct:  249 SREKNEQGSISEAWDVAPGLITQLKEQYKKDRKG--KKGVKRPN------RSKLQDMLANLRDGEDMPH------MQPPSAPQPRPSVPRFNEHEGNRPDEVETLAFPPTSGTFIMGADEAMKS----DLGLGELASITVANE----------------VESLAYDIGNNKDAMRKTWNPKFTLRSHFDGIRALTFHPVEPVLVTASEDHTLKMWNLQKTAPAKK-STSLDVEPVYTFRAHRGAVVSVVMSSSGEQCFSGGLDGTIQCWNTPNPNVDPYDSYDPSVLRGELSGHTDSVWGLVYSGVHQRLLSCSADGTVRLW----------DASTTSPALAVFNENKNMGIPSSVDLVCSESAHLVASFTNGEIGIFNMETRQLVLSL-------ESNLEAGTFCHINKVLSHPTLPITITAQEDRHIKFFDNNSGKLIHSMVAHLDAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKGYIASAGADALAKVFV 717          

HSP 2 Score: 115.931 bits (289), Expect = 3.444e-26
Identity = 51/71 (71.83%), Postives = 61/71 (85.92%), Query Frame = 2
Query:  110 ANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            A YS+ GI+ FLQ+EW + E++  QWEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   38 AQYSIPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 108          
BLAST of Striatin Pro11 vs. Ensembl Medaka
Match: STRN (striatin [Source:NCBI gene;Acc:101168645])

HSP 1 Score: 306.99 bits (785), Expect = 4.775e-92
Identity = 194/525 (36.95%), Postives = 276/525 (52.57%), Query Frame = 2
Query:  869 GDENEWAKVDQN-----------IIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDN-GSTSDCDHEWMVNNAKIPDEFNARESVSNYINGE-------KVSGFDVTQFSNIPNKRNSQKSHIIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLL--DQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAML-CHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            GD  +W K +Q            +I ++KE Y ++R G   K   + N      +  + D++ N     D  H       + P     R SV  +   E       +   F  T  + I     + KS    DL LG+LAS+TV NE                 E     I       +KTW+ +FTLRSHFDG+RA+ FHP +P+LV+ASED TLK+WNL KT P+KK S SLDVEPVYT+R H+  V+S+ +    +  FSG LDG I+ W  P   +DPYDS+D S+       HTD+VW ++   ++ +L S S+DGTV+ W            +     L       +  IP+ + LV +     V  FTNG   I NM T+ L   L       ES+  +      N ++ HPT  +TI   +D HI+ FDNN+G+L+ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  CIQE T HRKKF+ESIH +AFHPSK   A+AGAD L+KVF+
Sbjct:  300 GDGTDWEKNEQGSISEAWDVAPGLITQLKEQYKKDRKG--KKGVKRPN------RSKLQDMLANLRDGEDMPH------MQPPSAPQPRPSVPRFNEHEGNRPDEVETLAFPPTSGTFIMGADEAMKS----DLGLGELASITVANE----------------VESLAYDIGNNKDAMRKTWNPKFTLRSHFDGIRALTFHPVEPVLVTASEDHTLKMWNLQKTAPAKK-STSLDVEPVYTFRAHRGAVVSVVMSSSGEQCFSGGLDGTIQCWNTPNPNVDPYDSYDPSVLRGELSGHTDSVWGLVYSGVHQRLLSCSADGTVRLW----------DASTTSPALAVFNENKNMGIPSSVDLVCSESAHLVASFTNGEIGIFNMETRQLVLSL-------ESNLEAGTFCHINKVLSHPTLPITITAQEDRHIKFFDNNSGKLIHSMVAHLDAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKGYIASAGADALAKVFV 772          

HSP 2 Score: 115.931 bits (289), Expect = 3.713e-26
Identity = 51/71 (71.83%), Postives = 61/71 (85.92%), Query Frame = 2
Query:  110 ANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            A YS+ GI+ FLQ+EW + E++  QWEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   38 AQYSIPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 108          
BLAST of Striatin Pro11 vs. Ensembl Medaka
Match: STRN (striatin [Source:NCBI gene;Acc:101168645])

HSP 1 Score: 304.294 bits (778), Expect = 2.067e-91
Identity = 167/393 (42.49%), Postives = 232/393 (59.03%), Query Frame = 2
Query: 1208 DLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLL--DQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAML-CHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            DL LG+LAS+TV NE                 E     I       +KTW+ +FTLRSHFDG+RA+ FHP +P+LV+ASED TLK+WNL KT P+KK S SLDVEPVYT+R H+  V+S+ +    +  FSG LDG I+ W  P   +DPYDS+D S+       HTD+VW ++   ++ +L S S+DGTV+ W            +     L       +  IP+ + LV +     V  FTNG   I NM T+ L   L       ES+  +      N ++ HPT  +TI   +D HI+ FDNN+G+L+ S++ H  +V+ +AVD +G  +++GSHD ++R+WN+ +  CIQE T HRKKF+ESIH +AFHPSK   A+AGAD L+KVF+
Sbjct:  377 DLGLGELASITVANE----------------VESLAYDIGNNKDAMRKTWNPKFTLRSHFDGIRALTFHPVEPVLVTASEDHTLKMWNLQKTAPAKK-STSLDVEPVYTFRAHRGAVVSVVMSSSGEQCFSGGLDGTIQCWNTPNPNVDPYDSYDPSVLRGELSGHTDSVWGLVYSGVHQRLLSCSADGTVRLW----------DASTTSPALAVFNENKNMGIPSSVDLVCSESAHLVASFTNGEIGIFNMETRQLVLSL-------ESNLEAGTFCHINKVLSHPTLPITITAQEDRHIKFFDNNSGKLIHSMVAHLDAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKGYIASAGADALAKVFV 735          

HSP 2 Score: 116.316 bits (290), Expect = 2.441e-26
Identity = 51/71 (71.83%), Postives = 61/71 (85.92%), Query Frame = 2
Query:  110 ANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            A YS+ GI+ FLQ+EW + E++  QWEVE+AELQA+IA+LQGERK QENLK DL+RRIKMLEYALKQER K
Sbjct:   38 AQYSIPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAK 108          
BLAST of Striatin Pro11 vs. Ensembl Medaka
Match: strn (striatin [Source:NCBI gene;Acc:101155981])

HSP 1 Score: 303.908 bits (777), Expect = 8.231e-91
Identity = 195/549 (35.52%), Postives = 286/549 (52.09%), Query Frame = 2
Query:  776 DMEETLAEFDYIVG--------QIQQKKHILVNKKLSQHGDENEWAKVDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSD--CDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHIIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVL--SLCLLDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAML-CHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQ--HKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            D EE L  FD++          + +  K     ++  + G E  W  VDQ +IA++KE Y +ER G   K   + N      +  + D++ N   ++     +  V     P      E  +     E ++    T  S +    +   S  +    LG+LA LTV NE                 E    ++S      +KTW+ RFTLRSHFD VR + FHP +P+LV+ASED TL+LWNL +T P+KK   +LDVEP+YT+R H   VL  ++    +  FSG +DG I+ W  P   +DPYDS++ S+   A   HTD+VW ++    +++L S S+DGTV+ W            NA     CL       +   PT + LV +     V  F++G   + NM T+ L  +L       ES G      + N ++ HP   ++I   +D HIR FDNNTG+L+ S++ H  SV+C+AVD +G  +++GSHD ++R+WNM T  CIQE T HRKKF+ESIH +AFHP+K   ++AGAD L+KVF+
Sbjct:  277 DTEEALKGFDFLTSPDEMDGPPEFRGGKDGGEWEEERRPGGELGW-DVDQGLIAQLKEQYRKERRG--KKGVKRPN------RSKLQDMLANLRDAEELPPMQAAVTPPLRPSVPRISEPDAARPEDEPMAFLPATGKSFLLGGEDEAVSGELGLGELGELAGLTVANEA----------------ESPSYEVSNNKDALRKTWNLRFTLRSHFDSVRGLAFHPVEPVLVTASEDHTLRLWNLQRTAPAKK-CAALDVEPIYTFRAHSGAVLCVTMSASGEQCFSGGVDGTIQSWNTPNPNIDPYDSYEPSVLRGALSGHTDSVWGVVYSAAHHRLLSCSADGTVRLW------------NAADTAPCLAVFNEGGELGAPTSVDLVSSDPAYMVASFSSGHMGLFNMETQQLVLKL-------ESAGAPEAPSKINKVLSHPALPISITAQEDRHIRFFDNNTGKLIHSMVAHLDSVTCLAVDPNGLYLMSGSHDCSIRLWNMETRTCIQEFTAHRKKFEESIHDVAFHPTKCYISSAGADALAKVFV 780          

HSP 2 Score: 107.842 bits (268), Expect = 1.318e-23
Identity = 45/71 (63.38%), Postives = 59/71 (83.10%), Query Frame = 2
Query:  110 ANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNK 322
            A YS+ GI+ FLQ+EW + E++   WEVE+A+LQA++A+LQGER+ QENLK DL+RRIKMLE+ LKQER K
Sbjct:   34 ARYSVPGILHFLQHEWARFEVERAHWEVERAKLQAQVAFLQGERRGQENLKKDLVRRIKMLEFVLKQERAK 104          
BLAST of Striatin Pro11 vs. Planmine SMEST
Match: SMESG000072340.1 (SMESG000072340.1)

HSP 1 Score: 1453.34 bits (3761), Expect = 0.000e+0
Identity = 774/776 (99.74%), Postives = 775/776 (99.87%), Query Frame = 2
Query:   32 MDDNLNIKSRQDYTYDYYDYPILDECANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKINDENIKWKDEKIRLKKLILDMNDGDDLRNSRHTQDHYQEMXXXXXXXXXXDHKKSHRKKSKFEDKSSTAFIDNSFRFLXXXXXXXXXXXXXXXXXXXVKLEMGFDSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAKVDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHIIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADG 2359
            MDDNLNIKSRQDYTYDYYDYPILDECANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKINDENIKWKDEKIRLKKLILDMNDGDDLRNSRHTQDHYQE+ETTENEEINIDHKKSHRKKSKFEDKSSTAFIDNSFRFLSSDSDSSKSKSSDSEDESSVKLEMGFDSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAKVDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVT FSNIPNKRNSQKSHIIEDLSLGDLASLTVNNEGGIIISDPDSSSLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADG
Sbjct:    1 MDDNLNIKSRQDYTYDYYDYPILDECANYSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKINDENIKWKDEKIRLKKLILDMNDGDDLRNSRHTQDHYQEIETTENEEINIDHKKSHRKKSKFEDKSSTAFIDNSFRFLSSDSDSSKSKSSDSEDESSVKLEMGFDSDMEETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAKVDQNIIAKMKELYVQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTPFSNIPNKRNSQKSHIIEDLSLGDLASLTVNNEGGIIISDPDSSSLHSQNEETDEKISKLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADG 776          
BLAST of Striatin Pro11 vs. Planmine SMEST
Match: SMESG000052367.1 (SMESG000052367.1)

HSP 1 Score: 284.648 bits (727), Expect = 2.897e-85
Identity = 157/396 (39.65%), Postives = 239/396 (60.35%), Query Frame = 2
Query: 1214 SLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKK-----TWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGC--VLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            +LG+LASLT+ NE                  + +  +  +D  T+K     +WS +F+LRSHFD +R + FH ++PLL++ SED  LKLWNL KT  SKK S + ++EP+YT+RGHKSPVLS+ + D+ IFSG LDG++++W IP   ++ YD ++SS+  +A  +H +AVW++ L   +NKL S S+DG +  W ++    + ++  A     + + +F           V    D  VVG   G   IIN     L+T   + S ++E +     +     L+VHPTKS+ I G DD  IR FD N+G+L+SSL+ H  +VS +A++   G   +L+GSHD ++R+W+++T  CIQE T HRKKFDESI+ ++ HP+   FA+ G+D ++KVFI
Sbjct:  280 ALGELASLTILNEA----------------VDAETNLENIDTSTQKHNNRISWSPKFSLRSHFDSIRCVGFHETKPLLITGSEDKCLKLWNLVKTYHSKKSSNNFEMEPIYTFRGHKSPVLSMVINDETIFSGDLDGDVKLWNIP-SKVELYDEYNSSVLSNATLKHPNAVWSLTLQKASNKLLSGSADGMINLWDINALSDKPLKKIALSSSSISSMSF-----------VTMKPDNCVVGTGKGEVFIIN-----LETGQTICSLATEEE-----MSTVYKLIVHPTKSLIISGNDDRKIRMFDINSGKLVSSLVAHLDAVSSVAIEHKSGANYLLSGSHDCSIRLWDLSTHACIQETTSHRKKFDESINDISVHPNLQYFASGGSDAIAKVFI 637          

HSP 2 Score: 105.145 bits (261), Expect = 4.206e-23
Identity = 50/89 (56.18%), Postives = 67/89 (75.28%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENV 382
            Y + GI+QFL+N+  K EI   QW VEKAELQA+IA+LQGERK QENLK DL++RIKMLEY+L+QE NKL  +  +    +++ + EN+
Sbjct:   16 YGIAGIVQFLKNQSMKNEIIRAQWNVEKAELQARIAFLQGERKGQENLKVDLVKRIKMLEYSLEQENNKLNFIKSQKSMITDSNVEENI 104          
BLAST of Striatin Pro11 vs. Planmine SMEST
Match: SMESG000052367.1 (SMESG000052367.1)

HSP 1 Score: 284.263 bits (726), Expect = 4.541e-85
Identity = 175/472 (37.08%), Postives = 266/472 (56.36%), Query Frame = 2
Query:  986 QNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIPDEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHIIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEETDEKISKLDILTKK-----TWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAM-LCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGC--VLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVFI 2377
            +N D   IYD VD+ ST D              E     SV+N   G+  + + V+   N+P+             +LG+LASLT+ NE                  + +  +  +D  T+K     +WS +F+LRSHFD +R + FH ++PLL++ SED  LKLWNL KT  SKK S + ++EP+YT+RGHKSPVLS+ + D+ IFSG LDG++++W IP   ++ YD ++SS+  +A  +H +AVW++ L   +NKL S S+DG +  W ++    + ++  A     + + +F           V    D  VVG   G   IIN     L+T   + S ++E +     +     L+VHPTKS+ I G DD  IR FD N+G+L+SSL+ H  +VS +A++   G   +L+GSHD ++R+W+++T  CIQE T HRKKFDESI+ ++ HP+   FA+ G+D ++KVFI
Sbjct:  218 ENYDDSPIYDTVDDSSTFD--------------ERYIGVSVTNV--GKNHNDYPVS-VENLPHPEIMVSGD--SSSALGELASLTILNEA----------------VDAETNLENIDTSTQKHNNRISWSPKFSLRSHFDSIRCVGFHETKPLLITGSEDKCLKLWNLVKTYHSKKSSNNFEMEPIYTFRGHKSPVLSMVINDETIFSGDLDGDVKLWNIP-SKVELYDEYNSSVLSNATLKHPNAVWSLTLQKASNKLLSGSADGMINLWDINALSDKPLKKIALSSSSISSMSF-----------VTMKPDNCVVGTGKGEVFIIN-----LETGQTICSLATEEE-----MSTVYKLIVHPTKSLIISGNDDRKIRMFDINSGKLVSSLVAHLDAVSSVAIEHKSGANYLLSGSHDCSIRLWDLSTHACIQETTSHRKKFDESINDISVHPNLQYFASGGSDAIAKVFI 632          

HSP 2 Score: 105.145 bits (261), Expect = 4.594e-23
Identity = 50/89 (56.18%), Postives = 67/89 (75.28%), Query Frame = 2
Query:  116 YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIALTGEGDNSSNTVIFENV 382
            Y + GI+QFL+N+  K EI   QW VEKAELQA+IA+LQGERK QENLK DL++RIKMLEY+L+QE NKL  +  +    +++ + EN+
Sbjct:   11 YGIAGIVQFLKNQSMKNEIIRAQWNVEKAELQARIAFLQGERKGQENLKVDLVKRIKMLEYSLEQENNKLNFIKSQKSMITDSNVEENI 99          
BLAST of Striatin Pro11 vs. Planmine SMEST
Match: SMESG000064750.1 (SMESG000064750.1)

HSP 1 Score: 219.55 bits (558), Expect = 1.499e-60
Identity = 133/434 (30.65%), Postives = 231/434 (53.23%), Query Frame = 2
Query: 1178 RNSQKSHIIEDLSLGDLASLTVNNEGGXXXXXXXXXXLHSQNEE---TDEKISKLDILT---KKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLDQLIF--------SGSLDGEIRIWRIPVGALDPYDSFDSSIQ--LSAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLV-----------------DLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSSESDG--NSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGELLSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVF 2374
            +N++  +      LGDLAS+TV N+      D   S   + +++   T +K+    + T   KK W+ ++TLR HFD VR+I F+ ++  ++S S+D T+K+WN  K   SKKG  ++++E V T RGH   VLS+ +LD+ +F        SG LDG +R W +P   +DPY+ +DS +Q  L+    H+  +W + C LN  +  ++S   +K W V                  +DI   +    +   LL     N + I T + ++    +  ++G + G   ++++ ++ +K  + +    S  +   N  G+   + + VHPT  +   G++D ++R  D  T  ++ S++VHQ+ VSC+ +D +G  ++TGSHD ++R+W+M    CIQEIT HR K +ES+H + FH       + GA+G+ K++
Sbjct:  340 QNNEMDNYCSSFGLGDLASITVTNDADGESLDASKSFCGANSQQISMTKDKVDSAAVETNSSKKFWNVKYTLRGHFDSVRSISFYKNESAVISGSDDGTVKVWNFNKAQLSKKGP-NVEIEAVQTMRGHDGAVLSVRVLDEDLFHSGANIAASGGLDGCLRFWTLPNLEIDPYELYDS-VQNALNISDAHSSPIWKVSCLLNEPIILSASPSEIKLWSVVTGDNVSTLNREGDIFKGIDIAAYMLKEFKLANLLPESGLNSARI-TTMSILKQDPNQIIMGTSTGQMHVLDIQSENIKCSIDMSKSDSILNNCWNDQGI---HSMAVHPTLPLVFSGHEDHYLRTVDLRTNSMVHSMVVHQEPVSCVDIDKNGIYLITGSHDGSLRMWDMEKKSCIQEITSHRIKNNESVHDVLFHSQMPFIGSCGAEGIVKIY 767          

HSP 2 Score: 105.916 bits (263), Expect = 3.623e-23
Identity = 66/159 (41.51%), Postives = 98/159 (61.64%), Query Frame = 2
Query:  104 ECAN-YSLTGIIQFLQNEWTKIEIKTVQWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLI-----ALTGEGDNSSNT-VIFENVLNNEEKAEFDDSDIYLELSKNNQKINDENIKWKDEKIRLKKLILDMNDGDDLRNSRHTQ 559
            E AN YS  GI+ FLQ EW K+E +   WE+EKAEL AKIA+LQGE+K QENLK DL+RRIKMLEYALKQ +N+ I      ++   +N SN      N+ +N+ K+E +      +L  +  K    + +WK+ + RL++ + ++   D + ++R  +
Sbjct:   32 ENANLYSFPGILHFLQAEWNKMEAERAHWEIEKAELMAKIAFLQGEKKGQENLKEDLVRRIKMLEYALKQ-KNQTINELKYGVSKANNNVSNLDATKTNIEDNKSKSETN-----AKLLNDIDKAKVASSEWKESRQRLRQFLQEVGYVDTIVDARQIR 184          
BLAST of Striatin Pro11 vs. Planmine SMEST
Match: SMESG000077177.1 (SMESG000077177.1)

HSP 1 Score: 63.1586 bits (152), Expect = 7.315e-10
Identity = 83/362 (22.93%), Postives = 136/362 (37.57%), Query Frame = 2
Query: 1394 VRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCL-LDQLIF-SGSLDGEIRIWRIPVGALDPYDSFDSSIQLSAYFQHTDAVWAMLCHLNNK-LFSASSDGTVKCWLVDLDILEEIRGNAQHKCLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRLQVPSPSS---------------------ESDGNSLGVGR---------ANCLVVHPTKSMTIVGYDDSHIRCFDNNTGEL--LSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHRKKFDESIHQLAFHPSKNLFATAGADGLSKVF 2374
            V+ I  HP +P ++++  +  ++LW+       +K            +  H+ PV  +    +Q IF SG  D +I++W           ++ +   L     H D +     H     + SAS D T++ W            N Q +  +   T   S    C    P  +DL V    + +  + +++   L+ +  VP PS                      E  G S  V +          N    HPT  + +   DD  ++ +  N      L +   H  +VSC      G  +L+ S D ++R+W+M+   CI  I     +F      LA HP+ NLFA AG D    VF
Sbjct:   14 VKGISLHPKRPWILTSLHNGLIQLWDYRMCTLIEK------------FDEHEGPVRGIDFHSNQPIFVSGGDDYKIKVW-----------NYKTKRCLFTLLGHLDYIRTTFFHKEYPWIISASDDQTIRIW------------NWQSRTAICVLT-GHSHYVMCAQFHP-KEDLVVSASLDQTVRVWDISG--LRKKSVVPGPSGLEEHIRSLQNTGSSSSGSGTTELFGTSDAVVKHVLEGHDRGVNWAAFHPTSKVIVSAADDRQVKIWRMNDMRAWELDTCRGHYNNVSCAIFHPRGDLLLSNSEDKSIRVWDMSKRTCITSIRRESDRF----WVLAAHPTLNLFA-AGHDNGVIVF 331          

HSP 2 Score: 50.447 bits (119), Expect = 5.989e-6
Identity = 31/101 (30.69%), Postives = 44/101 (43.56%), Query Frame = 2
Query: 1328 KLDILTKKTWSARFTLRSHFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVYTYRGHKSPVLSLCLLDQLIFSGSLDGEIRIWRI 1630
            K+ +   KT    FTL  H D +R   FH   P ++SAS+D T+++WN            S     V T   H          + L+ S SLD  +R+W I
Sbjct:   76 KIKVWNYKTKRCLFTLLGHLDYIRTTFFHKEYPWIISASDDQTIRIWNWQ----------SRTAICVLTGHSHYVMCAQFHPKEDLVVSASLDQTVRVWDI 166          
The following BLAST results are available for this feature:
BLAST of Striatin Pro11 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STRN33.585e-9636.40striatin 3 [Source:HGNC Symbol;Acc:HGNC:15720][more]
STRN2.341e-9535.77striatin [Source:HGNC Symbol;Acc:HGNC:11424][more]
STRN6.697e-9141.41striatin [Source:HGNC Symbol;Acc:HGNC:11424][more]
STRN33.572e-8942.03striatin 3 [Source:HGNC Symbol;Acc:HGNC:15720][more]
STRN48.599e-8038.42striatin 4 [Source:HGNC Symbol;Acc:HGNC:15721][more]
back to top
BLAST of Striatin Pro11 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cash-18.664e-7338.55CKA And Striatin Homolog [Source:UniProtKB/TrEMBL... [more]
lis-11.306e-1021.70Lissencephaly-1 homolog [Source:UniProtKB/Swiss-P... [more]
pfs-25.884e-924.19Polyadenylation Factor Subunit homolog [Source:Un... [more]
wdr-487.811e-925.40WD repeat-containing protein 48 homolog [Source:U... [more]
wdr-488.711e-925.40WD repeat-containing protein 48 homolog [Source:U... [more]
back to top
BLAST of Striatin Pro11 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cka3.740e-9441.48gene:FBgn0044323 transcript:FBtr0306000[more]
Cka4.219e-9442.35gene:FBgn0044323 transcript:FBtr0079538[more]
Cka4.219e-9442.35gene:FBgn0044323 transcript:FBtr0079537[more]
Cka4.219e-9442.35gene:FBgn0044323 transcript:FBtr0079536[more]
Cka4.219e-9442.35gene:FBgn0044323 transcript:FBtr0079539[more]
back to top
BLAST of Striatin Pro11 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
strn4.116e-9836.58striatin, calmodulin binding protein [Source:ZFIN;... [more]
strn34.011e-9038.23striatin, calmodulin binding protein 3 [Source:ZFI... [more]
strn42.377e-8440.00striatin, calmodulin binding protein 4 [Source:ZFI... [more]
strn42.186e-8340.15striatin, calmodulin binding protein 4 [Source:ZFI... [more]
wdr55.884e-1022.97WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
back to top
BLAST of Striatin Pro11 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000054524.17.582e-9937.28pep primary_assembly:Xenopus_tropicalis_v9.1:8:929... [more]
ENSXETT00000054536.13.087e-9836.18pep primary_assembly:Xenopus_tropicalis_v9.1:8:929... [more]
strn5.009e-9836.02striatin [Source:NCBI gene;Acc:100216217][more]
ENSXETT00000054540.16.493e-9837.10pep primary_assembly:Xenopus_tropicalis_v9.1:8:929... [more]
ENSXETT00000054521.16.572e-9837.14pep primary_assembly:Xenopus_tropicalis_v9.1:8:929... [more]
back to top
BLAST of Striatin Pro11 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Strn36.379e-9936.77striatin, calmodulin binding protein 3 [Source:MGI... [more]
Strn8.714e-9735.71striatin, calmodulin binding protein [Source:MGI S... [more]
Strn1.166e-9535.71striatin, calmodulin binding protein [Source:MGI S... [more]
Strn38.395e-9242.13striatin, calmodulin binding protein 3 [Source:MGI... [more]
Strn41.925e-7838.17striatin, calmodulin binding protein 4 [Source:MGI... [more]
back to top
BLAST of Striatin Pro11 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P58405|STRN3_RAT3.770e-9836.59Striatin-3 OS=Rattus norvegicus OX=10116 GN=Strn3 ... [more]
sp|Q9ERG2|STRN3_MOUSE4.462e-9836.77Striatin-3 OS=Mus musculus OX=10090 GN=Strn3 PE=1 ... [more]
sp|A5D7H2|STRN3_BOVIN1.263e-9536.58Striatin-3 OS=Bos taurus OX=9913 GN=STRN3 PE=2 SV=... [more]
sp|Q13033|STRN3_HUMAN1.722e-9536.40Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3 PE=1 S... [more]
sp|P70483|STRN_RAT3.832e-9535.18Striatin OS=Rattus norvegicus OX=10116 GN=Strn PE=... [more]
back to top
BLAST of Striatin Pro11 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4C4K32.098e-13535.82WD_REPEATS_REGION domain-containing protein OS=Lot... [more]
A0A3Q3MK438.137e-12835.76Striatin, calmodulin binding protein OS=Mastacembe... [more]
A0A3B3X8Z02.961e-12734.81Striatin OS=Poecilia mexicana OX=48701 GN=STRN PE=... [more]
A0A3Q2XW426.808e-12733.78Striatin OS=Hippocampus comes OX=109280 GN=STRN PE... [more]
A0A087YNI11.219e-12634.94Striatin OS=Poecilia formosa OX=48698 GN=STRN PE=4... [more]
back to top
BLAST of Striatin Pro11 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000022256.23.093e-9836.41striatin-like [Source:NCBI gene;Acc:103029182][more]
strn33.814e-9339.86striatin 3 [Source:NCBI gene;Acc:103045599][more]
ENSAMXT00000049468.14.579e-9142.24striatin-like [Source:NCBI gene;Acc:103029182][more]
strn9.435e-8434.28striatin, calmodulin binding protein [Source:ZFIN;... [more]
strn42.396e-5435.38striatin 4 [Source:NCBI gene;Acc:103038311][more]
back to top
BLAST of Striatin Pro11 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
strn1.053e-9835.50striatin, calmodulin binding protein [Source:ZFIN;... [more]
POC1A1.712e-1124.75POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
WDR861.072e-1030.97WD repeat domain 86 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ENSPMAT00000008862.16.031e-923.73pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
ENSPMAT00000008376.11.471e-828.65pep scaffold:Pmarinus_7.0:GL476355:345359:369781:1... [more]
back to top
BLAST of Striatin Pro11 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MET306.263e-1123.78F-box protein containing five copies of the WD40 m... [more]
COP11.750e-1022.88Alpha subunit of COPI vesicle coatomer complex; co... [more]
SEC276.495e-1023.71Essential beta'-coat protein of the COPI coatomer;... [more]
RRT134.358e-925.34Putative protein of unknown function; non-essentia... [more]
PRP462.061e-824.03Member of the NineTeen Complex (NTC); this complex... [more]
back to top
BLAST of Striatin Pro11 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO485324.342e-8840.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298125.320e-4435.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494393.171e-1225.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480041.453e-1130.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409863.128e-1026.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Striatin Pro11 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
strn32.032e-9339.53striatin 3 [Source:NCBI gene;Acc:101160699][more]
STRN3.595e-9236.85striatin [Source:NCBI gene;Acc:101168645][more]
STRN4.775e-9236.95striatin [Source:NCBI gene;Acc:101168645][more]
STRN2.067e-9142.49striatin [Source:NCBI gene;Acc:101168645][more]
strn8.231e-9135.52striatin [Source:NCBI gene;Acc:101155981][more]
back to top
BLAST of Striatin Pro11 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072340.10.000e+099.74SMESG000072340.1[more]
SMESG000052367.12.897e-8539.65SMESG000052367.1[more]
SMESG000052367.14.541e-8537.08SMESG000052367.1[more]
SMESG000064750.11.499e-6030.65SMESG000064750.1[more]
SMESG000077177.17.315e-1022.93SMESG000077177.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003375 ID=SMED30003375|Name=Striatin Pro11|organism=Schmidtea mediterranea sexual|type=transcript|length=2453bp
TTAATTTTTAAAATAAATAATGATTTTTTAAATGGATGACAATTTAAATA
TTAAATCTCGTCAAGATTATACTTATGATTACTATGATTATCCAATATTA
GATGAATGTGCGAATTATTCATTAACTGGTATAATTCAATTTTTGCAGAA
TGAATGGACTAAAATTGAGATTAAAACTGTTCAGTGGGAGGTTGAGAAAG
CAGAATTGCAAGCTAAAATAGCTTATCTTCAAGGAGAAAGAAAATGTCAA
GAGAACCTCAAATGTGACTTAATTCGAAGAATTAAAATGCTTGAATATGC
ATTGAAACAAGAAAGAAACAAACTAATTGCACTTACTGGTGAAGGTGATA
ATTCCTCAAATACTGTGATATTTGAAAACGTTCTTAATAATGAAGAAAAA
GCCGAGTTTGACGATTCTGATATTTATTTAGAATTATCCAAAAATAATCA
AAAAATAAATGATGAAAATATTAAATGGAAAGATGAAAAAATTCGATTAA
AAAAACTGATTTTAGACATGAACGATGGTGATGATTTGCGTAATAGTCGT
CATACCCAAGATCATTATCAGGAAATGGAAACTACTGAAAATGAAGAAAT
AAATATTGACCATAAAAAATCTCATCGTAAAAAATCTAAATTTGAAGATA
AATCATCAACCGCGTTTATTGATAATAGTTTCCGATTTCTCAGTAGCGAT
TCTGACAGTAGCAAAAGCAAATCCAGCGATTCTGAAGATGAATCTTCCGT
TAAGTTGGAAATGGGATTCGATTCTGATATGGAAGAAACGTTGGCAGAAT
TTGATTATATTGTCGGTCAAATCCAGCAAAAAAAGCACATATTAGTGAAT
AAAAAATTATCTCAGCATGGAGATGAAAACGAATGGGCAAAGGTTGATCA
AAATATAATTGCTAAAATGAAAGAGCTTTACGTTCAAGAACGAGTTGGAG
TTGGCTCTAAGTCGACAATGAAATCTAATGACTGCCAAAATGGTGATAAA
CAAGCGATTTATGATGTCGTAGATAATGGTTCTACTTCTGATTGCGACCA
TGAGTGGATGGTTAATAATGCTAAAATACCCGATGAATTCAATGCAAGAG
AATCTGTTTCTAATTACATAAATGGAGAGAAAGTATCAGGTTTTGATGTC
ACTCAGTTCTCAAACATACCCAACAAACGCAACAGTCAAAAGAGTCATAT
AATTGAAGATTTGAGTTTGGGCGATTTGGCCAGTCTCACTGTAAATAATG
AAGGTGGAATTATTATCTCTGATCCTGATAGTTCTTCTTTGCACTCTCAA
AATGAAGAAACAGATGAGAAAATTTCTAAATTGGATATTTTAACTAAGAA
AACTTGGTCTGCTCGGTTTACTCTTAGAAGTCATTTTGATGGAGTTCGAG
CTATAGTTTTCCATCCGTCGCAGCCGTTATTGGTATCAGCAAGTGAAGAT
ACCACCTTAAAACTTTGGAATTTAACTAAAACGATACCATCCAAAAAGGG
ATCTGTAAGTTTGGACGTTGAACCGGTTTACACTTATAGAGGTCATAAAA
GTCCTGTTTTGAGTCTTTGTTTACTGGACCAGTTGATTTTTTCTGGATCA
CTTGATGGAGAAATCCGTATATGGAGGATTCCAGTTGGGGCTTTGGATCC
ATATGATTCATTCGATAGCTCAATTCAGTTGTCGGCTTACTTTCAGCACA
CAGATGCCGTTTGGGCGATGCTTTGTCACTTGAACAACAAATTATTTTCT
GCCTCTTCGGATGGAACTGTAAAATGTTGGTTGGTCGACCTTGACATTTT
GGAAGAAATCAGAGGAAATGCTCAACATAAATGTTTGCTTTATACTTACA
CTTTCAATGATTCAGAAATACCAACTTGTATCGGGCTTGTACCAACATCA
GACGATTTGTTTGTTGTTGGATTCACAAACGGTTCTTGTAGTATTATTAA
TATGACAACTAAACTATTGAAAACTCGTCTTCAAGTTCCTTCACCGTCTT
CTGAATCTGATGGTAATTCTTTGGGAGTTGGGAGAGCTAATTGTTTAGTT
GTTCACCCCACTAAATCAATGACAATTGTTGGTTATGATGATTCTCATAT
TCGATGTTTTGACAACAATACTGGTGAACTGTTATCTTCACTATTAGTCC
ATCAGAAATCCGTTTCTTGCATTGCGGTCGATTGTAGCGGCGGTTGCGTT
CTAACAGGAAGCCATGACACCGCCGTGCGGATATGGAACATGGCGACATG
GATTTGTATTCAAGAGATTACATGCCATCGAAAGAAATTCGATGAATCTA
TTCATCAACTTGCTTTTCACCCGTCAAAGAATTTGTTCGCAACAGCTGGT
GCTGACGGTTTGTCTAAAGTGTTTATTTGATAACTTACTGCAGTTTTATT
ATTATTGTACATTTTCAACCATTGTTTATTATTTGCAATTTTTTTATCAG
AAA
back to top

protein sequence of SMED30003375-orf-1

>SMED30003375-orf-1 ID=SMED30003375-orf-1|Name=SMED30003375-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=783bp
MDDNLNIKSRQDYTYDYYDYPILDECANYSLTGIIQFLQNEWTKIEIKTV
QWEVEKAELQAKIAYLQGERKCQENLKCDLIRRIKMLEYALKQERNKLIA
LTGEGDNSSNTVIFENVLNNEEKAEFDDSDIYLELSKNNQKINDENIKWK
DEKIRLKKLILDMNDGDDLRNSRHTQDHYQEMETTENEEINIDHKKSHRK
KSKFEDKSSTAFIDNSFRFLSSDSDSSKSKSSDSEDESSVKLEMGFDSDM
EETLAEFDYIVGQIQQKKHILVNKKLSQHGDENEWAKVDQNIIAKMKELY
VQERVGVGSKSTMKSNDCQNGDKQAIYDVVDNGSTSDCDHEWMVNNAKIP
DEFNARESVSNYINGEKVSGFDVTQFSNIPNKRNSQKSHIIEDLSLGDLA
SLTVNNEGGIIISDPDSSSLHSQNEETDEKISKLDILTKKTWSARFTLRS
HFDGVRAIVFHPSQPLLVSASEDTTLKLWNLTKTIPSKKGSVSLDVEPVY
TYRGHKSPVLSLCLLDQLIFSGSLDGEIRIWRIPVGALDPYDSFDSSIQL
SAYFQHTDAVWAMLCHLNNKLFSASSDGTVKCWLVDLDILEEIRGNAQHK
CLLYTYTFNDSEIPTCIGLVPTSDDLFVVGFTNGSCSIINMTTKLLKTRL
QVPSPSSESDGNSLGVGRANCLVVHPTKSMTIVGYDDSHIRCFDNNTGEL
LSSLLVHQKSVSCIAVDCSGGCVLTGSHDTAVRIWNMATWICIQEITCHR
KKFDESIHQLAFHPSKNLFATAGADGLSKVFI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000909sporocarp development involved in sexual reproduction
GO:0030154cell differentiation
GO:0007626locomotory behavior
GO:0008285negative regulation of cell proliferation
GO:0016055Wnt signaling pathway
GO:0016358dendrite development
GO:0070830bicellular tight junction assembly
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0005515protein binding
GO:0005516calmodulin binding
GO:0030331estrogen receptor binding
GO:0032403protein complex binding
GO:0051721protein phosphatase 2A binding
GO:0070016armadillo repeat domain binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR013258Striatin_N
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005923bicellular tight junction
GO:0014069postsynaptic density
GO:0016020membrane
GO:0042995cell projection
GO:0043025neuronal cell body
GO:0043197dendritic spine
GO:0045211postsynaptic membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 723..737
score: 29.04
coord: 467..481
score: 40.92
coord: 519..533
score: 33.9
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 652..694
e-value: 29.0
score: 7.8
coord: 547..584
e-value: 0.0026
score: 27.0
coord: 599..640
e-value: 74.0
score: 5.2
coord: 495..532
e-value: 1.1E-6
score: 38.2
coord: 697..736
e-value: 4.9E-6
score: 36.1
coord: 441..480
e-value: 3.5E-7
score: 39.8
coord: 739..782
e-value: 0.02
score: 24.0
IPR001680WD40 repeatPFAMPF00400WD40coord: 446..480
e-value: 6.7E-6
score: 26.7
coord: 497..531
e-value: 4.1E-4
score: 21.1
coord: 699..736
e-value: 3.1E-4
score: 21.5
coord: 742..780
e-value: 0.053
score: 14.4
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 704..739
score: 11.277
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 448..481
score: 14.251
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 502..533
score: 10.442
IPR013258Striatin, N-terminalPFAMPF08232Striatincoord: 31..180
e-value: 1.2E-25
score: 90.9
NoneNo IPR availableGENE3DG3DSA:1.20.5.300coord: 48..97
e-value: 2.2E-25
score: 90.2
NoneNo IPR availablePANTHERPTHR15653STRIATINcoord: 27..781
NoneNo IPR availableCDDcd00200WD40coord: 445..781
e-value: 1.40403E-42
score: 154.415
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 665..781
e-value: 1.0E-21
score: 79.2
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 372..664
e-value: 1.7E-33
score: 117.9
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 467..481
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 723..737
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 448..782
score: 22.728
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 440..780