Spectrin beta chain

Overview
NameSpectrin beta chain
Smed IDSMED30003374
Length (bp)7443
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Spectrin beta chain (SMED30003374) t-SNE clustered cells

Violin plots show distribution of expression levels for Spectrin beta chain (SMED30003374) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Spectrin beta chain (SMED30003374) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Spectrin beta chain (SMED30003374) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003374

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003374SMESG000039799.1 dd_Smed_v4_6202_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003374SMESG000039799.1 dd_Smed_v4_6202_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003374SMESG000039799.1 dd_Smed_v4_6202_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30003374SMESG000039799.1 dd_Smed_v4_6202_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30003374SMESG000039799.1 dd_Smed_v4_6202_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30003374SMESG000039799.1 dd_Smed_v4_6202_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30003374SMESG000039799.1 dd_Smed_v4_6202_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003374SMESG000039799.1 Contig39747uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003374SMESG000039799.1 Contig39747newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30003374SMESG000039799.1 OX_Smed_1.0.03613ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Spectrin beta chain vs. Ensembl Human
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1352.42 bits (3499), Expect = 0.000e+0
Identity = 842/2393 (35.19%), Postives = 1368/2393 (57.17%), Query Frame = 1
Query:  160 DEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDI-------RSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKAS-KYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMI-DENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFIN------EALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSA-SRPMRQVNPSNTNPSTTQSHPNLSSSL 7245
            D D+    N ++++FERSRIKALADERE VQKKTFTKW+NS L  V+ +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA +V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +LP V AA KKHEAIETDI AYEE +  +  ++  LE E Y+DI  I   K+ V+ LW+ LL+ L  RR+ L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI       R +N   +K  ++   Y + CD             +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+SV RLL KH+ FE E+S +    E  + EG+ ++     G E I  +   I+  W  L   +  RK +L E    +Q+ +D DD + W+ +  ++     +G     T+ L++K++   E + NYR  ++ +  QA S L     +   V  +L  IE++Y+++ ++    ++ L D L +Y++ +++D+   WI EK+++L N    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ +G+P+ + I   QD LN  W++  ++VD K+D LLS     N+ ++C +T  WIREK K+IES  +LG DL  VM  QR++  M+RD+ AIEAK+  L  + +++   +   A+ I  +L  +   WE ++  +++R+++L   + + +F++ LDDF +WL + QT +AS+++P + +EAEKL+ ++ + ++E+   E+  ++   +G+   + + D  Q++ L+ R+++++  W  L+ + E ++  L +      F  D +Q E  LN QE  L               + L      + + E F+  M ++E+ +  V++ G+ L+ + N+  DR+Q K  ++D+R +KN   A     +LK+   L + LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K G Q  ++ P  +  + + L  L+  W  L    + K Q L   N+ +LF +S   + KWL  +E QI +DD        +TS+   LKK      ++E +KK +E L+  ++ L Q+         ++L  Q K  M+ L    E K ++   K I  QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    ++D + + +Q ++ D + L    +   +  LK+    L EE EK    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+  +L     P+  +  ++   V+  +  LK +  E++ ++       + + L+Q      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N   DELI   H  A +I+ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +   IQ+K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + K+  E+++A++SL    E R++  ++  D   F SMVR+L+ W+E+V  Q+E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++T+KR  +  KW +  + L L++EV+Q++RDA+ AEAW++ QE YL++  +G ++DE   L+K+   F+K+    +E+F  L+RLTT+E+   +   + +         E    + + AE +         +   T + + +        Q + R   ++D+     SE+ +    Q+ +S++S   P P S         +++K   P+                SA+  PA T+  P  +  M+G L RKH+WE  N+KAS+R+WH++Y +++   M F+KD +         Y  E+P+ L E V   A DY K+  VF++R  +G EYLFQ     +M  W+ AI+SA S    +V+ S  +   +     L +S+
Sbjct:   26 DVDDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGY-KPCD-----------PQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQA-SALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDA-QYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLA---------HTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYG----KDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKF-MELLEPLNERKHNLLASKEI-HQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIK------KNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEE-KAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLD------ERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPEPSTKVSEEAESQ---------QQWDTSKGEQVSQNGLPAEQGSPRMAETVDT-----SEMVNGATEQRTSSKESSPIPSPTSD--------RKAKTALPAQ---------------SAATLPARTQETPSAQ--MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKTAASGIP--YHSEVPVSLKEAVCEVALDYKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAISSDKHEVSASTQSTPASSRAQTLPTSV 2333          
BLAST of Spectrin beta chain vs. Ensembl Human
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1351.27 bits (3496), Expect = 0.000e+0
Identity = 840/2395 (35.07%), Postives = 1363/2395 (56.91%), Query Frame = 1
Query:  160 DEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDI-------RSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDS---HNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMI-DENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFIN------EALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSA-SRPMRQVNPSNTNPSTTQSHPNLSSSL 7245
            D D+    N ++++FERSRIKALADERE VQKKTFTKW+NS L  V+ +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA +V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +LP V AA KKHEAIETDI AYEE +  +  ++  LE E Y+DI  I   K+ V+ LW+ LL+ L  RR+ L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI       R +N   +K  ++   Y + CD             +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+SV RLL KH+ FE E+S +    E  + EG+ ++     G E I  +   I+  W  L   +  RK +L E    +Q+ +D DD + W+ +  ++     +G     T+ L++K++   E + NYR  ++ +  QA S L     +   V  +L  IE++Y+++ ++    ++ L D L +Y++ +++D+   WI EK+++L N    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ +G+P+ + I   QD LN  W++  ++VD K+D LLS     N+ ++C +T  WIREK K+IES  +LG DL  VM  QR++  M+RD+ AIEAK+  L  + +++   +   A+ I  +L  +   WE ++  +++R+++L   + + +F++ LDDF +WL + QT +AS+++P + +EAEKL+ ++ + ++E+   E+  ++   +G+   + + D  Q++ L+ R+++++  W  L+ + E ++  L +      F  D +Q E  LN QE  L               + L      + + E F+  M ++E+ +  V++ G+ L+ + N+  DR+Q K  ++D+R +KN   A     +LK+   L + LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K G Q  ++ P  +  + + L  L+  W  L    + K Q L   N+ +LF +S   + KWL  +E QI +DD        +TS+   LKK  +    N     KK++ E       L ++         ++L  Q K  M+ L    E K ++   K I  QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    ++D + + +Q ++ D + L    +   +  LK+    L EE EK    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+  +L     P+  +  ++   V+  +  LK +  E++ ++       + + L+Q      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N   DELI   H  A +I+ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +   IQ+K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + K+  E+++A++SL    E R++  ++  D   F SMVR+L+ W+E+V  Q+E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++T+KR  +  KW +  + L L++EV+Q++RDA+ AEAW++ QE YL++  +G ++DE   L+K+   F+K+    +E+F  L+RLTT+E+   +   + +         E    + + AE +         +   T + + +        Q + R   ++D+     SE+ +    Q+ +S++S   P P S         +++K   P+                SA+  PA T+  P  +  M+G L RKH+WE  N+KAS+R+WH++Y +++   M F+KD +         Y  E+P+ L E V   A DY K+  VF++R  +G EYLFQ     +M  W+ AI+SA S    +V+ S  +   +     L +S+
Sbjct:   26 DVDDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGY-KPCD-----------PQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQA-SALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDA-QYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLA---------HTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYG----KDLTSVNILLKKQQATMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKF-MELLEPLNERKHNLLASKEI-HQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIK------KNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEE-KAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLD------ERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHFTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPEPSTKVSEEAESQ---------QQWDTSKGEQVSQNGLPAEQGSPRMAETVDT-----SEMVNGATEQRTSSKESSPIPSPTSD--------RKAKTALPAQ---------------SAATLPARTQETPSAQ--MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKTAASGIP--YHSEVPVSLKEAVCEVALDYKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAISSDKHEVSASTQSTPASSRAQTLPTSV 2335          
BLAST of Spectrin beta chain vs. Ensembl Human
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1257.28 bits (3252), Expect = 0.000e+0
Identity = 753/2075 (36.29%), Postives = 1217/2075 (58.65%), Query Frame = 1
Query:  211 SRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDI-------RSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKAS-KYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMI-DENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKF 6363
             R K L DERE VQKKTFTKW+NS L  V+ +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA +V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +LP V AA KKHEAIETDI AYEE +  +  ++  LE E Y+DI  I   K+ V+ LW+ LL+ L  RR+ L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI       R +N   +K  ++   Y + CD             +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+SV RLL KH+ FE E+S +    E  + EG+ ++     G E I  +   I+  W  L   +  RK +L E    +Q+ +D DD + W+ +  ++     +G     T+ L++K++   E + NYR  ++ +  QA S L     +   V  +L  IE++Y+++ ++    ++ L D L +Y++ +++D+   WI EK+++L N    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ +G+P+ + I   QD LN  W++  ++VD K+D LLS     N+ ++C +T  WIREK K+IES  +LG DL  VM  QR++  M+RD+ AIEAK+  L  + +++   +   A+ I  +L  +   WE ++  +++R+++L   + + +F++ LDDF +WL + QT +AS+++P + +EAEKL+ ++ + ++E+   E+  ++   +G+   + + D  Q++ L+ R+++++  W  L+ + E ++  L +      F  D +Q E  LN QE  L               + L      + + E F+  M ++E+ +  V++ G+ L+ + N+  DR+Q K  ++D+R +KN   A     +LK+   L + LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K G Q  ++ P  +  + + L  L+  W  L    + K Q L   N+ +LF +S   + KWL  +E QI +DD        +TS+   LKK      ++E +KK +E L+  ++ L Q+         ++L  Q K  M+ L    E K ++   K I  QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    ++D + + +Q ++ D + L    +   +  LK+    L EE EK    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+  +L     P+  +  ++   V+  +  LK +  E++ ++       + + L+Q      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N   DELI   H  A +I+ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +   IQ+K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + K+  E+++A++SL    E R++  ++  D   F SMVR+L+ W+E+V  Q+E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++T+KR  +  KW +  + L L++EV+Q++RDA+ AEAW++ QE YL++  +G ++DE   L+K+   F+K+    +E+F
Sbjct:   30 GRFKQLQDEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGY-KPCD-----------PQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQA-SALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDA-QYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLA---------HTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYG----KDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKF-MELLEPLNERKHNLLASKEI-HQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIK------KNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEE-KAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLD------ERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERF 2060          
BLAST of Spectrin beta chain vs. Ensembl Human
Match: SPTBN2 (spectrin beta, non-erythrocytic 2 [Source:HGNC Symbol;Acc:HGNC:11276])

HSP 1 Score: 1252.65 bits (3240), Expect = 0.000e+0
Identity = 792/2375 (33.35%), Postives = 1295/2375 (54.53%), Query Frame = 1
Query:  193 SKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCD--QDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEAL--INIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKR---PQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAIN--------SASRPMRQVNPSNTNPSTTQSHPNLSSSLPP 7251
            +++FERSRIKALADERE VQKKTFTKW+NS L  VT ++ DLY DLRDG+ LL LLE+LS EI+PKPT+GRMRIHCLENVDK L FL  QKVHLEN+G+HDIVDGN RLTLGL+WTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VN+ NFT SWR GL F A++HKHRPDL+DF S  + +   NL  AF++AE  LG+  LLDPEDVNV  PDE+S+ITYVA+YYHYF+ +KA +V  KR+ K+L+  +E E++++ Y+SL S+LL+WI  TI  LN RQ +NS+ G+Q Q+ +FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA +F++KAA+RE+W+++N  L+ + + G  L  V AA++KHEAIETDI AY   +  +  ++  L  E Y+DI  I   ++ V  LW  L Q +  RRE L   L++  +  +   +   +  +  + +  + G+HL  VE+LL+ HEL+E+DI    +R+  + + A R   FC+  +++R      +  ++ E+     + +  L +    R+  L+ S  +W+F+ +    E W++E   ++ + D G DL+   RLL KH     E+S +   L+  L +G+ LV     G    +A+  ++Q  WE L    E R  +L +    YQ+ +D +D E W+ +  RL     LG     T+ L R+++   E + ++R  ++ +R QA + L  ++     V  ++  +E+ Y++L   A +    L  AL +Y +L+++ +   W+ EK+++L      + +E+LEV++ RFE  E E+   A ++  VN+++E L+    P    IVN Q+ LN+ W +   + D K+  L S     N+ ++C +T  W+REK K+IES   LG DL  V+  QR++   +RD+ AI A++  L  + + +   +   A  I  +L  V   WE L+  +R R+ +L     +  F++ LDDF  WLG+ QT +AS+  P +  EAE L+ ++ + R E+   + +      +G++  + + D  Q + L+ R+E++   W+ L  + E ++ RL +      F  DARQ E +L++QE  L         +       L + +  + + E F+  M ++ + +  +L+ G+ L+ E N++ D+++ K  +++ R KKN  AAQ    +L++       LQD  +L   + EK+    ++S    ++  +   + +A   E+ A +  +++++K G++ + + P  K  + + L +L+  W EL    + K ++L   NR +LF +S  ++  WL++++ Q+ +DD        +TS+   LKK      E+  ++K +E ++  ++ L Q++   A + E+    V+     L  P+  +           QF +D +DEI W+ E++ +    +  ME    L   Q L  ++++++ EI+    ++  L +E QR      L  A     + +L++  + L  E+E     L + L  Q+F  D +E  +W+ E+EL +MG    +KD+   +  ++K Q LE  + +Y   I +   S   +     P+  +  ++   V+  +  LK +  E++  +   +  C       ++E WI ER  +A S + G+D +  T+LRD+F  FS +T+ IG  +V+ AN   + LI G H    +++ WKD +NE WADLLEL+DTR Q+L +A++L R+   ++  L  +Q K+   ++ +  G+D  +   LQR+   +E D+  L   +       + L   Y  DK   + +  Q + +A+  L+     R+   L+  D   F   VREL+ W++EV +QM+ + +PRDVS  +L++ N + +K E++++ + FS C+++G+ LL   H  + EI  K  ++  +R    +KW   +D L L++EV  + RDA  AEAW+ SQE  + +  LG T+DE  +L+K+   FQK+ +  EE+F  L++LT +E R K+    R+           E TA     +++   T +  T++       P  Q         S++         +     Q++        P P S   +  P+ ++  R   P PS M +     S ST+   A+  P      P  +  M+G L RK + E   +KA+NR+W ++Y +L +  + F+KD +         Y  E+P+ L     + A DY KR  VF++  ++G EYLFQ     +M+ W+  +N        ++  P   V PS T   T       + ++PP
Sbjct:   40 ARLFERSRIKALADEREAVQKKTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGEILPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHAMEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAERYHDIKRIAARQHNVARLWDFLRQMVAARRERLLLNLELQKVFQDLLYLMDWMEEMKGRLQSQDLGRHLAGVEDLLQLHELVEADIAVQAERVRAVSASALR---FCNPGKEYRPC----DPQLVSERVAKLEQSYEALCELAAARRARLEESRRLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGASQASARAAELQAQWERLEALAEERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPELGHDEFSTQALARQHRALEEEIRSHRPTLDALREQA-AALPPTLSRTPEVQSRVPTLERHYEELQARAGERARALEAALALYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPEMNTLAAQITAVNDIAEQLLKANPPGKDRIVNTQEQLNHRWQQFRRLADGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAIAARVGELTREANALAAGHPAQAVAINARLREVQTGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRALGEEVTRDQADP-QCLFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVL---------SHTEMPGTLQAADAAIKKLEDFMSTMDANGERIHGLLEAGRQLVSEGNIHADKIREKADSIERRHKKNQDAAQQFLGRLRDNREQQHFLQDCHELKLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKALVSEKLRDLHRRWDELETTTQAKARSLFDANRAELFAQSCCALESWLESLQAQLHSDD----YGKDLTSVNILLKKQQMLEWEMAVREKEVEAIQAQAKALAQED-QGAGEVERTSRAVEEKFRALCQPMRERCRRLQASREQHQFHRDVEDEILWVTERLPM----ASSMEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADL-RERQRA-----LGAAAAGPELAELQEMWKRLGHELELRGKRLEDALRAQQFYRDAAEAEAWMGEQELHMMGQE-KAKDELSAQAEVKKHQVLEQALADYAQTIHQLAASSQDMIDHEHPESTRISIRQAQVDKLYAGLKELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSRDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALARVQHKQ--QQLPDGTGRDLNAAEALQRRHCAYEHDIQALSPQVQQVQDDGHRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDEVNLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGKELLARSHYAAEEISEKLSQLQARRQETAEKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESLIKRHEAFQKSAVAWEERFCALEKLTALEEREKERKRKREEEERRKQPPAPEPTASVPPGDLVGGQTASDTTWDGTQPRPPPSTQ-------APSVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRGPAPSAMPQ-----SRSTESAHAATLPPRG-PEPSAQEQMEGMLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAASAGVP--YHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEPVVPSTTRGMTR------AMTMPP 2357          
BLAST of Spectrin beta chain vs. Ensembl Human
Match: SPTBN2 (spectrin beta, non-erythrocytic 2 [Source:HGNC Symbol;Acc:HGNC:11276])

HSP 1 Score: 1252.65 bits (3240), Expect = 0.000e+0
Identity = 792/2375 (33.35%), Postives = 1295/2375 (54.53%), Query Frame = 1
Query:  193 SKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCD--QDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEAL--INIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKR---PQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAIN--------SASRPMRQVNPSNTNPSTTQSHPNLSSSLPP 7251
            +++FERSRIKALADERE VQKKTFTKW+NS L  VT ++ DLY DLRDG+ LL LLE+LS EI+PKPT+GRMRIHCLENVDK L FL  QKVHLEN+G+HDIVDGN RLTLGL+WTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VN+ NFT SWR GL F A++HKHRPDL+DF S  + +   NL  AF++AE  LG+  LLDPEDVNV  PDE+S+ITYVA+YYHYF+ +KA +V  KR+ K+L+  +E E++++ Y+SL S+LL+WI  TI  LN RQ +NS+ G+Q Q+ +FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA +F++KAA+RE+W+++N  L+ + + G  L  V AA++KHEAIETDI AY   +  +  ++  L  E Y+DI  I   ++ V  LW  L Q +  RRE L   L++  +  +   +   +  +  + +  + G+HL  VE+LL+ HEL+E+DI    +R+  + + A R   FC+  +++R      +  ++ E+     + +  L +    R+  L+ S  +W+F+ +    E W++E   ++ + D G DL+   RLL KH     E+S +   L+  L +G+ LV     G    +A+  ++Q  WE L    E R  +L +    YQ+ +D +D E W+ +  RL     LG     T+ L R+++   E + ++R  ++ +R QA + L  ++     V  ++  +E+ Y++L   A +    L  AL +Y +L+++ +   W+ EK+++L      + +E+LEV++ RFE  E E+   A ++  VN+++E L+    P    IVN Q+ LN+ W +   + D K+  L S     N+ ++C +T  W+REK K+IES   LG DL  V+  QR++   +RD+ AI A++  L  + + +   +   A  I  +L  V   WE L+  +R R+ +L     +  F++ LDDF  WLG+ QT +AS+  P +  EAE L+ ++ + R E+   + +      +G++  + + D  Q + L+ R+E++   W+ L  + E ++ RL +      F  DARQ E +L++QE  L         +       L + +  + + E F+  M ++ + +  +L+ G+ L+ E N++ D+++ K  +++ R KKN  AAQ    +L++       LQD  +L   + EK+    ++S    ++  +   + +A   E+ A +  +++++K G++ + + P  K  + + L +L+  W EL    + K ++L   NR +LF +S  ++  WL++++ Q+ +DD        +TS+   LKK      E+  ++K +E ++  ++ L Q++   A + E+    V+     L  P+  +           QF +D +DEI W+ E++ +    +  ME    L   Q L  ++++++ EI+    ++  L +E QR      L  A     + +L++  + L  E+E     L + L  Q+F  D +E  +W+ E+EL +MG    +KD+   +  ++K Q LE  + +Y   I +   S   +     P+  +  ++   V+  +  LK +  E++  +   +  C       ++E WI ER  +A S + G+D +  T+LRD+F  FS +T+ IG  +V+ AN   + LI G H    +++ WKD +NE WADLLEL+DTR Q+L +A++L R+   ++  L  +Q K+   ++ +  G+D  +   LQR+   +E D+  L   +       + L   Y  DK   + +  Q + +A+  L+     R+   L+  D   F   VREL+ W++EV +QM+ + +PRDVS  +L++ N + +K E++++ + FS C+++G+ LL   H  + EI  K  ++  +R    +KW   +D L L++EV  + RDA  AEAW+ SQE  + +  LG T+DE  +L+K+   FQK+ +  EE+F  L++LT +E R K+    R+           E TA     +++   T +  T++       P  Q         S++         +     Q++        P P S   +  P+ ++  R   P PS M +     S ST+   A+  P      P  +  M+G L RK + E   +KA+NR+W ++Y +L +  + F+KD +         Y  E+P+ L     + A DY KR  VF++  ++G EYLFQ     +M+ W+  +N        ++  P   V PS T   T       + ++PP
Sbjct:   40 ARLFERSRIKALADEREAVQKKTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGEILPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHAMEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAERYHDIKRIAARQHNVARLWDFLRQMVAARRERLLLNLELQKVFQDLLYLMDWMEEMKGRLQSQDLGRHLAGVEDLLQLHELVEADIAVQAERVRAVSASALR---FCNPGKEYRPC----DPQLVSERVAKLEQSYEALCELAAARRARLEESRRLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGASQASARAAELQAQWERLEALAEERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPELGHDEFSTQALARQHRALEEEIRSHRPTLDALREQA-AALPPTLSRTPEVQSRVPTLERHYEELQARAGERARALEAALALYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPEMNTLAAQITAVNDIAEQLLKANPPGKDRIVNTQEQLNHRWQQFRRLADGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAIAARVGELTREANALAAGHPAQAVAINARLREVQTGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRALGEEVTRDQADP-QCLFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVL---------SHTEMPGTLQAADAAIKKLEDFMSTMDANGERIHGLLEAGRQLVSEGNIHADKIREKADSIERRHKKNQDAAQQFLGRLRDNREQQHFLQDCHELKLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKALVSEKLRDLHRRWDELETTTQAKARSLFDANRAELFAQSCCALESWLESLQAQLHSDD----YGKDLTSVNILLKKQQMLEWEMAVREKEVEAIQAQAKALAQED-QGAGEVERTSRAVEEKFRALCQPMRERCRRLQASREQHQFHRDVEDEILWVTERLPM----ASSMEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADL-RERQRA-----LGAAAAGPELAELQEMWKRLGHELELRGKRLEDALRAQQFYRDAAEAEAWMGEQELHMMGQE-KAKDELSAQAEVKKHQVLEQALADYAQTIHQLAASSQDMIDHEHPESTRISIRQAQVDKLYAGLKELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSRDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALARVQHKQ--QQLPDGTGRDLNAAEALQRRHCAYEHDIQALSPQVQQVQDDGHRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDEVNLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGKELLARSHYAAEEISEKLSQLQARRQETAEKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESLIKRHEAFQKSAVAWEERFCALEKLTALEEREKERKRKREEEERRKQPPAPEPTASVPPGDLVGGQTASDTTWDGTQPRPPPSTQ-------APSVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRGPAPSAMPQ-----SRSTESAHAATLPPRG-PEPSAQEQMEGMLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAASAGVP--YHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEPVVPSTTRGMTR------AMTMPP 2357          
BLAST of Spectrin beta chain vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 1348.57 bits (3489), Expect = 0.000e+0
Identity = 843/2398 (35.15%), Postives = 1341/2398 (55.92%), Query Frame = 1
Query:  139 DYQNALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKD--IQSLINNFNTSKSNLLSLNEIVNENEIFIDKM-LSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLPDEYKGIVK-------DVEDNFNSLKIICAEKKTE----ISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRFFS 7290
            D  +    +DE    N ++++FERSRIKALADERE VQKKTFTKW+NS L+ V+ K++DLY+D+RDGK LL LL +LS E +PKPT G+MRIHCLENV+K L FL NQ VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI F++  +   +SAK+ALLLWCQMKTAGYP+VN++NF+ SWR GL F ALIHKHRPDL+D+ +  +++ + NL  AFD AEN LG+   LD EDVNV  PDE+S+ITYV +YYHYFN LK  ++  KR+ K++N+++E+++MI  Y++L S LLEWI   I+LLN R F N++ G+Q+Q+  FN YRT EKP KF EK +LEVLLFT++S    +  + + P E   ++ IN AW  L  AE+ RE  L++EL+RQEKL  LA +FN+KA +RE+W+T+N  L+ + + GN+L +V AA KKHEAIETDI+AYEE +  +  ++  LE E Y+D   I   K  VL LW  L Q L  RR  L+  + +  + ++      ++  I ++   ++ G HLM+VE+LL+ H L+ESDI  I +R+   I++A R+ +  D    S         I E+ +   K + ELLD   +RK  L+ +  + QF  D +  E  IKE   ++++ D G D+ +V  LL KHK  E  L      L+   + GK L D S  G + I  +  +I++    L + + SRK +L   ++YYQ+ +D DD + ++ +  R+   + +G      ++L++K+    + ++N+  +I+ +  +A+S L     +H  + ++LD   K+  +L +++   +++L+DAL++Y+L +D+DSV SWI EK K L   +P  DIEE+E++KHRF+  E ++  +  KV +VN+L+  L+   +PN   I++ Q+ LN  W ++ D+VD KR+EL   +    F +DCQ+T+ WI +K +++E  D L  DL  VM+ QRR++ M+RD+ AI+AK+D L  + D+I R   + A+ I   +  +HQ W+IL + +R+ ++ L    D+ RF++ LD F  WL   Q ++AS+  P+S +EAE+L+N++ + R+E+    +  ++   +G D +  +Q   Q++ L+ R+  + + W+ L  + + ++  L + L   MF  DA+Q E +L+ QE YL KD   QSL    N  K            ++ FI  M  +DEK+ A+ +  G  L  + +   D++  K +N+DER   N   AQ    KLK+ + L + L D D+L + + EK+    + +  + K+  S   + +A + E+ A +  +++L         D P +   I   ++ L + W EL K  EEK Q L   NR++L+ +S   M +W   +E ++  +D+P      +T++   ++K      E+  K + ++ L +    L++ +PD+    +     V+  +  L  PL+ +     +K  A QF +D DDE  W++E++ L    +K      +L    +LQ   + + NEI N    ++ +    Q +IDE H         + +L+   + L E ++  +  L       +FL D  E  +W+SE+EL +M      KD+   +  I+K + L+ +I  +   I           +E   + +        +E  +  L+ +  E++      + L+ ++ +  +L Q    WI ++  +A S ++G+D +   +L++RF  F+ +T  IGS +V  AN   D LI   H  A +I++WKD +NE W +LLEL+DTR Q+L+++  LH++Y D +  L  I EK  +M   +DLG+D  SV  L RK +N+ KD+  +   +      +  L   Y  DK   +  +  E++ A+R LR + + R    ++ +D   F++MVR+LL W++EV  +M  + +P+DVSG+ELL+ NH+SLK E+D++EENF+ C++LGR LL  KH  S EI+ K  ++T +R  + ++W +  ++L L++EVYQ+ARDAA AE+W+ +QE YL ++  G  L+ET+ L+KK   F+K+   QEE+F  L++LTT E++            E     E+TA+      I   + +       P     F               + D D++I                      S+L    +    KR   S  S    +L+ +    S  PK A            +G L RKH +E+ ++KA+NR+W  LY +L Q+ ++F+KD +H  E        E P+ L       A DY K+  V  +R   GAEYLFQ  S  DM RW+  +  A+   +    S             S +LP +    K    FFS
Sbjct:    5 DGNSGAYTQDEDYDDNSSARLFERSRIKALADERELVQKKTFTKWVNSHLVRVSCKVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRNQHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRF-RNPDGPDGSGYKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDESIPGSDNIPPRLAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQHIKVLHAKAES-LPQEAREHPDIRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMG-DRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKR-----------HQDFITTMDANDEKIRAVGMF-GDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEWATQLENEMTREDQP----GDLTTVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLEELHPDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLWISERLVL----AKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDEGHANGPAFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQ-DERGKDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTEQIQVRQAQIEKLYAGLQDLSKERRKRLEETLELYALHREIDDLLQ----WIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCLSRIMEKTHAM--PDDLGRDSSSVGALSRKHQNYLKDIAAIGEQVAQIERDAAELRDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEERFLALEKLTTFELK------------ETQHREEETAKRRGPAHIGSPSRST------PAAETSF--------------GAQDDDADIT--------------------HSSLEGHRKSSHEKRLAHSESSSWRKSLARAPKFDSKDPKGAKQGEA------FEGTLIRKHTYESLDRKAANRSWEKLYAVLRQNELSFYKDPKHRDES----VHGEPPMALPGCSVNVASDYQKKKNVLSLRLPIGAEYLFQCGSEEDMQRWLTELQVATGQAQLEEASR------------SQTLPAEGSATKKKGGFFS 2298          
BLAST of Spectrin beta chain vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 1332.78 bits (3448), Expect = 0.000e+0
Identity = 837/2398 (34.90%), Postives = 1332/2398 (55.55%), Query Frame = 1
Query:  139 DYQNALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKD--IQSLINNFNTSKSNLLSLNEIVNENEIFIDKM-LSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLPDEYKGIVKDV-------EDNFNSLKIICAEKKTEIS----LFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRFFS 7290
            D  +    +DE    N ++++FERSRIKALADERE VQKKTFTKW+NS L+ V+ K++DLY+D+RDGK LL LL +LS E +PKPT G+MRIHCLENV+K L FL NQ VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI F++  +   +SAK+ALLLWCQMKTAGYP+VN++NF+ SWR GL F ALIHKHRPDL+D+ +  +++ + NL  AFD AEN LG+   LD EDVNV  PDE+S+ITYV +YYHYFN LK  ++  KR+ K++N+++E+++MI  Y++L S LLEWI   I+LLN R F N++ G+Q+Q+  FN YRT EKP KF EK +LEVLLFT++S    +  + + P E   ++ IN AW  L  AE+ RE  L++EL+RQEKL  LA +FN+KA +RE+W+T+N  L+ + + GN+L +V AA KKHEAIETDI+AYEE +  +  ++  LE E Y+D   I   K  VL LW  L Q L  RR  L+  + +  + ++      ++  I ++   ++ G HLM+VE+LL+ H L+ESDI  I +R+   I++A R+ +  D    S         I E+ +   K + ELLD   +RK  L+ +  + QF  D +  E  IKE   ++++ D G D+ +V  LL KHK  E  L      L+   + GK L D S  G + I  +  +I++    L + + SRK +L   ++YYQ+ +D DD + ++ +  R+   + +G      ++L++K+    + ++N+  +I+ +  +A+SL      +H  + ++LD   K+  +L +++   +++L+DAL++Y+L +D+DSV SWI EK K L   +P  DIEE+E++KHRF+  E ++  +  KV +VN+L+  L+   +PN   I++ Q+ LN  W ++ D+VD KR+EL   +    F +DCQ+T+ WI +K +++E  D L  DL  VM+ QRR++ M+RD+ AI+AK+D L  + D+I R   + A+ I   +  +HQ W+IL + +R+ ++ L    D+ RF++ LD F  WL   Q ++AS+  P+S +EAE+L+N++ + R+E+    +  ++   +G D +  +Q   Q++ L+ R+  + + W+ L  + + ++  L + L   MF  DA+Q E +L+ QE YL KD   QSL    N  K +           + FI  M  +DEK+ A+ +  G  L  + +   D++  K +N+DER   N   AQ    KLK+ + L + L D D+L + + EK+    + +  + K+  S   + +A + E+ A +  +++L         D P +   I   ++ L + W EL K  EEK Q L   NR++L+ +S   M +W   +E ++  +D+P      +T++   ++K      E+  K + ++ L +    L++ +PD+    +     V+  +  L  PL+ +     +K  A QF +D DDE  W++E++ L    +K      +L    +LQ   + + NEI N    ++ +    Q +IDE H         + +L+   + L E ++  +  L       +FL D  E  +W+SE+EL +M      KD+   +  I+K + L+ +I  +   I           +E   + + +       E  +  L+ +  E++  +     L+ ++ +  +L Q    WI ++  +A S ++G+D +   +L++RF  F+ +T  IGS +V  AN   D LI   H  A +I++WKD +NE W +LLEL+DTR Q+L+++  LH++Y D +  L  I EK  +M   +DLG+D  SV  L RK +N+ KD+  +   +      +  L   Y  DK   +  +  E++ A+R LR + + R    ++ +D   F++MVR+LL W++EV  +M  + +P+DVSG+ELL+ NH+SLK E+D++EENF+ C++LGR LL  KH  S EI+ K  ++T +R  + ++W +  ++L L++EVYQ+ARDAA AE+W+ +QE YL ++  G  L+ET+ L+KK   F+K+       F Q +R   +                                     E + TFE K   HR  E  +   RR  +   S  + +   +T +  + +                        KR   S  S    +L+ +    S  PK A            +G L RKH +E+ ++KA+NR+W  LY +L Q+ ++F+KD +H  E        E P+ L       A DY K+  V  +R   GAEYLFQ  S  DM RW+  +  A+   +    S             S +LP +    K    FFS
Sbjct:    5 DGNSGAYTQDEDYDDNSSARLFERSRIKALADERELVQKKTFTKWVNSHLVRVSCKVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRNQHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRF-RNPDGPDGSGYKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDESIPGSDNIPPRLAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQHIKVLHAKAESL-PQEAREHPDIRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMG-DRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKRH-----------QDFITTMDANDEKIRAVGMF-GDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEWATQLENEMTREDQP----GDLTTVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLEELHPDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLWISERLVL----AKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDEGHANGPAFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQ-DERGKDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTEQIQVRQAQIEKLYAGLQDLSKERRKRLEETLELYALHREIDDLLQ----WIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCLSRIMEKTHAM--PDDLGRDSSSVGALSRKHQNYLKDIAAIGEQVAQIERDAAELRDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKS------AFAQEERFLAL-------------------------------------EKLTTFELKETQHREEETAK---RRGPAHIGSPSRSTPAAETSFGAQDDE-----------------------KRLAHSESSSWRKSLARAPKFDSKDPKGAKQGEA------FEGTLIRKHTYESLDRKAANRSWEKLYAVLRQNELSFYKDPKHRDES----VHGEPPMALPGCSVNVASDYQKKKNVLSLRLPIGAEYLFQCGSEEDMQRWLTELQVATGQAQLEEASR------------SQTLPAEGSATKKKGGFFS 2281          
BLAST of Spectrin beta chain vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 1294.26 bits (3348), Expect = 0.000e+0
Identity = 772/2101 (36.74%), Postives = 1236/2101 (58.83%), Query Frame = 1
Query:  139 DYQNALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKD--IQSLINNFNTSKSNLLSLNEIVNENEIFIDKM-LSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLPDEYKGIVK-------DVEDNFNSLKIICAEKKTE----ISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIR 6399
            D  +    +DE    N ++++FERSRIKALADERE VQKKTFTKW+NS L+ V+ K++DLY+D+RDGK LL LL +LS E +PKPT G+MRIHCLENV+K L FL NQ VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI F++  +   +SAK+ALLLWCQMKTAGYP+VN++NF+ SWR GL F ALIHKHRPDL+D+ +  +++ + NL  AFD AEN LG+   LD EDVNV  PDE+S+ITYV +YYHYFN LK  ++  KR+ K++N+++E+++MI  Y++L S LLEWI   I+LLN R F N++ G+Q+Q+  FN YRT EKP KF EK +LEVLLFT++S    +  + + P E   ++ IN AW  L  AE+ RE  L++EL+RQEKL  LA +FN+KA +RE+W+T+N  L+ + + GN+L +V AA KKHEAIETDI+AYEE +  +  ++  LE E Y+D   I   K  VL LW  L Q L  RR  L+  + +  + ++      ++  I ++   ++ G HLM+VE+LL+ H L+ESDI  I +R+   I++A R+ +  D    S         I E+ +   K + ELLD   +RK  L+ +  + QF  D +  E  IKE   ++++ D G D+ +V  LL KHK  E  L      L+   + GK L D S  G + I  +  +I++    L + + SRK +L   ++YYQ+ +D DD + ++ +  R+   + +G      ++L++K+    + ++N+  +I+ +  +A+S L     +H  + ++LD   K+  +L +++   +++L+DAL++Y+L +D+DSV SWI EK K L   +P  DIEE+E++KHRF+  E ++  +  KV +VN+L+  L+   +PN   I++ Q+ LN  W ++ D+VD KR+EL   +    F +DCQ+T+ WI +K +++E  D L  DL  VM+ QRR++ M+RD+ AI+AK+D L  + D+I R   + A+ I   +  +HQ W+IL + +R+ ++ L    D+ RF++ LD F  WL   Q ++AS+  P+S +EAE+L+N++ + R+E+    +  ++   +G D +  +Q   Q++ L+ R+  + + W+ L  + + ++  L + L   MF  DA+Q E +L+ QE YL KD   QSL    N  K            ++ FI  M  +DEK+ A+ +  G  L  + +   D++  K +N+DER   N   AQ    KLK+ + L + L D D+L + + EK+    + +  + K+  S   + +A + E+ A +  +++L         D P +   I   ++ L + W EL K  EEK Q L   NR++L+ +S   M +W   +E ++  +D+P      +T++   ++K      E+  K + ++ L +    L++ +PD+    +     V+  +  L  PL+ +     +K  A QF +D DDE  W++E++ L    +K      +L    +LQ   + + NEI N    ++ +    Q +IDE H         + +L+   + L E ++  +  L       +FL D  E  +W+SE+EL +M      KD+   +  I+K + L+ +I  +   I           +E   + +        +E  +  L+ +  E++      + L+ ++ +  +L Q    WI ++  +A S ++G+D +   +L++RF  F+ +T  IGS +V  AN   D LI   H  A +I++WKD +NE W +LLEL+DTR Q+L+++  LH++Y D +  L  I EK  +M   +DLG+D  SV  L RK +N+ KD+  +   +      +  L   Y  DK   +  +  E++ A+R LR + + R    ++ +D   F++MVR+LL W++EV  +M  + +P+DVSG+ELL+ NH+SLK E+D++EENF+ C++LGR LL  KH  S EI+ K  ++T +R  + ++W +  ++L L++EVYQ+ARDAA AE+W+ +QE YL ++  G  L+ET+ L+KK   F+K+   QEE+F  L++LTT E++
Sbjct:    5 DGNSGAYTQDEDYDDNSSARLFERSRIKALADERELVQKKTFTKWVNSHLVRVSCKVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRNQHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRF-RNPDGPDGSGYKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDESIPGSDNIPPRLAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQHIKVLHAKAES-LPQEAREHPDIRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMG-DRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKR-----------HQDFITTMDANDEKIRAVGMF-GDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEWATQLENEMTREDQP----GDLTTVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLEELHPDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLWISERLVL----AKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDEGHANGPAFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQ-DERGKDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTEQIQVRQAQIEKLYAGLQDLSKERRKRLEETLELYALHREIDDLLQ----WIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCLSRIMEKTHAM--PDDLGRDSSSVGALSRKHQNYLKDIAAIGEQVAQIERDAAELRDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEERFLALEKLTTFELK 2075          

HSP 2 Score: 88.9669 bits (219), Expect = 4.859e-17
Identity = 56/191 (29.32%), Postives = 84/191 (43.98%), Query Frame = 1
Query: 6718 SKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRFFS 7290
            +KR  P+++  P  +   +     A    A            +G L RKH +E+ ++KA+NR+W  LY +L Q+ ++F+KD +H  E        E P+ L       A DY K+  V  +R   GAEYLFQ  S  DM RW+  +  A+   +    S             S +LP +    K    FFS
Sbjct: 2085 AKRRGPAHIGSPSRSTPAAETSFGAQDDGAKQGEA------FEGTLIRKHTYESLDRKAANRSWEKLYAVLRQNELSFYKDPKHRDES----VHGEPPMALPGCSVNVASDYQKKKNVLSLRLPIGAEYLFQCGSEEDMQRWLTELQVATGQAQLEEASR------------SQTLPAEGSATKKKGGFFS 2253          
BLAST of Spectrin beta chain vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 1278.08 bits (3306), Expect = 0.000e+0
Identity = 771/2125 (36.28%), Postives = 1237/2125 (58.21%), Query Frame = 1
Query:   91 ICVPYLNGNYCDSLSSDYQNALSDEDEV-QYANVTSKVFERS-------RIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKD--IQSLINNFNTSKSNLLSLNEIVNENEIFIDKM-LSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLPDEYKGIVK-------DVEDNFNSLKIICAEKKTE----ISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIR 6399
            +  P +      +LSS   N L+DE+     A V+  V  +        R + L DERE VQKKTFTKW+NS L+ V+ K++DLY+D+RDGK LL LL +LS E +PKPT G+MRIHCLENV+K L FL NQ VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI F++  +   +SAK+ALLLWCQMKTAGYP+VN++NF+ SWR GL F ALIHKHRPDL+D+ +  +++ + NL  AFD AEN LG+   LD EDVNV  PDE+S+ITYV +YYHYFN LK  ++  KR+ K++N+++E+++MI  Y++L S LLEWI   I+LLN R F N++ G+Q+Q+  FN YRT EKP KF EK +LEVLLFT++S    +  + + P E   ++ IN AW  L  AE+ RE  L++EL+RQEKL  LA +FN+KA +RE+W+T+N  L+ + + GN+L +V AA KKHEAIETDI+AYEE +  +  ++  LE E Y+D   I   K  VL LW  L Q L  RR  L+  + +  + ++      ++  I ++   ++ G HLM+VE+LL+ H L+ESDI  I +R+   I++A R+ +  D    S         I E+ +   K + ELLD   +RK  L+ +  + QF  D +  E  IKE   ++++ D G D+ +V  LL KHK  E  L      L+   + GK L D S  G + I  +  +I++    L + + SRK +L   ++YYQ+ +D DD + ++ +  R+   + +G      ++L++K+    + ++N+  +I+ +  +A+S L     +H  + ++LD   K+  +L +++   +++L+DAL++Y+L +D+DSV SWI EK K L   +P  DIEE+E++KHRF+  E ++  +  KV +VN+L+  L+   +PN   I++ Q+ LN  W ++ D+VD KR+EL   +    F +DCQ+T+ WI +K +++E  D L  DL  VM+ QRR++ M+RD+ AI+AK+D L  + D+I R   + A+ I   +  +HQ W+IL + +R+ ++ L    D+ RF++ LD F  WL   Q ++AS+  P+S +EAE+L+N++ + R+E+    +  ++   +G D +  +Q   Q++ L+ R+  + + W+ L  + + ++  L + L   MF  DA+Q E +L+ QE YL KD   QSL    N  K            ++ FI  M  +DEK+ A+ +  G  L  + +   D++  K +N+DER   N   AQ    KLK+ + L + L D D+L + + EK+    + +  + K+  S   + +A + E+ A +  +++L         D P +   I   ++ L + W EL K  EEK Q L   NR++L+ +S   M +W   +E ++  +D+P      +T++   ++K      E+  K + ++ L +    L++ +PD+    +     V+  +  L  PL+ +     +K  A QF +D DDE  W++E++ L    +K      +L    +LQ   + + NEI N    ++ +    Q +IDE H         + +L+   + L E ++  +  L       +FL D  E  +W+SE+EL +M      KD+   +  I+K + L+ +I  +   I           +E   + +        +E  +  L+ +  E++      + L+ ++ +  +L Q    WI ++  +A S ++G+D +   +L++RF  F+ +T  IGS +V  AN   D LI   H  A +I++WKD +NE W +LLEL+DTR Q+L+++  LH++Y D +  L  I EK  +M   +DLG+D  SV  L RK +N+ KD+  +   +      +  L   Y  DK   +  +  E++ A+R LR + + R    ++ +D   F++MVR+LL W++EV  +M  + +P+DVSG+ELL+ NH+SLK E+D++EENF+ C++LGR LL  KH  S EI+ K  ++T +R  + ++W +  ++L L++EVYQ+ARDAA AE+W+ +QE YL ++  G  L+ET+ L+KK   F+K+   QEE+F  L++LTT E++
Sbjct:   51 VASPGIYPGSAGALSS-LSNGLADENRSPTSAEVSDSVCGQKSINSVDLRFRGLRDERELVQKKTFTKWVNSHLVRVSCKVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRNQHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRF-RNPDGPDGSGYKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDESIPGSDNIPPRLAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQHIKVLHAKAES-LPQEAREHPDIRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMG-DRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKR-----------HQDFITTMDANDEKIRAVGMF-GDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEWATQLENEMTREDQP----GDLTTVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLEELHPDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLWISERLVL----AKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDEGHANGPAFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQ-DERGKDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTEQIQVRQAQIEKLYAGLQDLSKERRKRLEETLELYALHREIDDLLQ----WIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCLSRIMEKTHAMP--DDLGRDSSSVGALSRKHQNYLKDIAAIGEQVAQIERDAAELRDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEERFLALEKLTTFELK 2144          

HSP 2 Score: 88.5817 bits (218), Expect = 6.134e-17
Identity = 56/191 (29.32%), Postives = 84/191 (43.98%), Query Frame = 1
Query: 6718 SKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRFFS 7290
            +KR  P+++  P  +   +     A    A            +G L RKH +E+ ++KA+NR+W  LY +L Q+ ++F+KD +H  E        E P+ L       A DY K+  V  +R   GAEYLFQ  S  DM RW+  +  A+   +    S             S +LP +    K    FFS
Sbjct: 2154 AKRRGPAHIGSPSRSTPAAETSFGAQDDGAKQGEA------FEGTLIRKHTYESLDRKAANRSWEKLYAVLRQNELSFYKDPKHRDES----VHGEPPMALPGCSVNVASDYQKKKNVLSLRLPIGAEYLFQCGSEEDMQRWLTELQVATGQAQLEEASR------------SQTLPAEGSATKKKGGFFS 2322          
BLAST of Spectrin beta chain vs. Ensembl Celegans
Match: sma-1 (SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3])

HSP 1 Score: 507.679 bits (1306), Expect = 1.272e-144
Identity = 304/812 (37.44%), Postives = 466/812 (57.39%), Query Frame = 1
Query:  157 SDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQF-DEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEK 2589
            +D+DE    N  +  FERSRI+ L DER ++QKKTFTKW NS L   +++I DL+ D+ DG  L+ LLE++S + + KP RGRMR+  +EN++K L FL  +K+ LEN+GA DI+D N RL LGLIWTIILRFQ+  I   DE+     K AKDALLLWCQ KTAGYP+V I NFT SWR GL F ALIH HRPDL+DF+  N N++++NL+ AFD+AE  L I  LLD EDV+V  PDE+S+ITYV+ YYH+F   K      +R+  ++ +++  E M   Y+ + S+LL WIR TI+ L  R+F NS+ G++++   FN +RT EKP K+ EK +LE L FTI++ +     K Y PP+   +  I SAW +L+ AE  R+ A+  EL RQEKL  LAQ+F+KKA LR+SW+     +L++   G +   V   LKK +AI TDI A E+    LT + + L  E Y++   +   + +++D W +LL  L +R+  L +   + +L+ +   +   +  +    R  + GKHL+ VE+LL  H+L+++ I +    L KL   AN Y++  ++ F          +++ K +     ++ L++    R+  L+ +  ++QF+ D   E  W+ E   +        D+S+V +    +K  E+E+ +     +  +  G+ LV  +   +E I  +   + + WE L  + ++    L E     QY  D ++AE WI E   L     LG      E L++++ +  E +  Y+ +I ++  + QS L  S     T ++ +   E+
Sbjct:   25 TDQDEF---NNETLYFERSRIRTLQDERVHIQKKTFTKWCNSFLNRASLEIVDLFEDVGDGIMLMKLLEIISGDKLGKPNRGRMRVQKVENLNKVLDFLKKKKIQLENIGAEDILDRNERLILGLIWTIILRFQIDTIVIEDEEERGERKHAKDALLLWCQRKTAGYPNVRIENFTTSWRNGLAFNALIHSHRPDLVDFNRLNPNEHVDNLNHAFDVAEKKLEIARLLDAEDVDVTRPDEKSIITYVSLYYHHFAKQKTEMTGARRIANIVGKLMVSETMEDDYEHIASELLNWIRVTIKTLESRRFPNSLNGMREEHAKFNQFRTSEKPPKYKEKGELEALFFTIQTKRKAMSRKQYQPPQGLFMHDIESAWAQLDYAENERQVAIIAELQRQEKLEQLAQRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQF---------DVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERLVQ-NGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSDISRL-EEMQSQLANSAFHTATTSQSVQETEE 822          

HSP 2 Score: 225.713 bits (574), Expect = 2.266e-58
Identity = 444/2160 (20.56%), Postives = 894/2160 (41.39%), Query Frame = 1
Query:  973 VLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFT---IKSNQFVSRLKVYNPPEEFSLSTIN------SAWDELNTAEYGRET--ALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDL-WKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRS---IN--QRLEKLISEANRYVQFCDQ---DFRSNINSGNKAMIKEKRNST-IKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEG--KTLVDISPVGQEFIAAKNNDIQN--LWEA--------LVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDE----FKRLFDLKFLGDKMSFTEILIR-KNQQNMEI-VENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFV-----RLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKII-AEQFLQ---DCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVIN---SKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-PDEYKGIV------KDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVN--DLGK-DPKSV-SLLQR------KLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNE-NLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTME-----IRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALS--PVPQMKQSKRPQ------PSNM--------SKPVHNLSVSTDMLSASPKPATTRTIPPEE---------VLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAI 7155
             LED   +  Y    + L + I   +R+    +F+     +++  + F+         +F +KV      FT     +N  + R    NPP  F+   +       +AW+ L      R++  A+ +EL R          F++     E W+ D M  + +  LG ++  V +  + HEA++ +I+  +  L  L + ++ L++         I  + + L+  W++L     +R++ L     ++T                        GK    V +LL   +L  SDI+S   IN  Q+ E L +E +R     D    +F   +N G K +  +   S  IK+   LL S  +R  +     L   F+  A     + +E   I+ +  +G   +++  L     V ++E  +KR+    K +    +    +     E + A++ + +N  +W++        L    E+R   L +      + SD    E WIDE     ++  DL    + +S  E + R +  Q +E  V   +  ++QI  +   L   ++  +  +A + D +  K+  L          L +A  + R     ++V +WI EK+  +       D+E   +L  R +   S+     + +  +N L E LV  G  +   +   Q +LN  W  +   +   R ELL+      F  D + T E I EK+  ++S D+ G+D  SV    R+ + ++RD+ AI  K+        +IL       + +   L  + + WE L +    R+  L     +++++  +     W  Q++ +M S   P+  + A K++ +++ ++ E+    ++L    + G+   + + +    V     R+QN    + Q W+        ++  L+K L+ +++ ++A Q E+ L+ +E  + +       +         ++  ++  +  F + +    + +  + K    L+   N Y+  +  + + +  R      + + R + L++    HE ++   +L   +  K+Q+  + S L++ +  S L +  A + E+      +  + ++G+Q   D     +++   L  L S W EL      K Q L         +   + + KWL  +EG++ +DD        I S    +KKLD+   E+  +   +  +   +  L+ Q    A    +   QV+    GL  P++    I  + ++ A+ F Q     +++++W+++++ L    +   E+  +L     LQ +H +++ E+  R   ++   Q  + MI + H     +   +++L      L E     +++L   +   E+  + +E   W+ E+    M L ++    +D       +R+   L+ E++ +  +I+  KK    L   E+   +      + +E  F  L   CA ++T+I     Y        ++  W+ E+ + A ++D G+DL+ C  + ++F     E    G  +V    +  ++L++  HP+  SI+     +  +W  + E+ + R Q L  A  +HR+  ++  +L  +Q+K+++   +   DL + D  SV + LQR       +K  EK + +L    + A  + N+  P      E   +   ++L D   + +K LE  KL +++     ++    RE++ W++ +   M     PRDV+  E L+  H    +EM  ++         GR ++++ H+ S EI+ K   +     +L + W +  +     ++V +W ++A   ++W+  +   L ++  +  +++     L+ F  F      Q EK + +KRLT +E     +RSK+++  R                 + E  Q   + ++  E   I+     + Q+  RR         +  EI             S++RP P     S   +P+ ++  R +      P  +        S  V  L    +M + +P   T RT    +         + MKG   RK   ++  ++A+ R+W + Y +L    + FFKDE+ F E          P+ +         +Y KR   FR+  ++G+E++F       M  WV  I
Sbjct: 1767 ALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFD---------EFKQKVKNGSERFTSCETAANAILRR----NPP--FARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHR----------FHRDVDEFEQWMADKMANMPR-DLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTF----------------------NGK----VRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALER--LRSEWALRNGFLSQAVQWHAFQREAKQIIAS--IGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLS--SESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQL--KNLHRNPKIANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKS-DDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWE-------SEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTD---------AVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHG----RDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQ----IRRENLVDAQAFFQWVKAAEEDLEWLSDRMML----ASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQ----MPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGE-RVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAEL---CHEAERLWNSF-PDTRHHLEVRRLDMEEQLKDILEAAKKHLE--KLRHMQ--SLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLGDDWRMVDSVEMAETHLRDFDDFLVTLEAQSEKCDMVKRLTLVEQNFSRLRSKEIDRAR-----------------IAEDDQKRRDTIKIVEKGNIL---ANRRQERERR---------KTQEI-------------SLLRPSPSGEEFSTHTMPRKERKDRAKTTADLAPGAIQIGDILASSSTVAPLQSGVEM-TKTPSFNTRRTQSIRKGSRWEDMGAIDMKGFFDRKQCQQSGGKRATIRSWKNYYGILCGQLLCFFKDEQQFLEN----VAAAPPVYIYGAQCEQYPEYAKRKNSFRLLLQDGSEFIFSCPDERQMLEWVAKI 3777          

HSP 3 Score: 131.339 bits (329), Expect = 8.287e-30
Identity = 337/1717 (19.63%), Postives = 720/1717 (41.93%), Query Frame = 1
Query: 1390 SWITDNMELLQKQSLGNNLPTVLA-ALKKHEAIETDIYAYEENLIGLTKISDNL------EEEIYNDIISIINTKNKVL--DLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILR-HNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNW----LGQMQTEMASQNIPES---QSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNL--LSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTL-ILENNLYKDR-MQNKCQNLDERWKKNT-----LAAQN---RKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTD-----SCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEP-------------DGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQ--QNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIR--NRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL---PDEYKGIV----KDVEDNFNSLKIIC-AEKKTEISL--FVIYCDTYELYQNIEAWIVER-TKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEK------KSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQK 6336
             W+ +  +L+         P+ +   L KHEA E +I A E  +  +    D L      E      I+  +N +   L   +W K L+     R+  D       L +   ++  + T + +K    + G  L  V++LL+ H ++E ++     +L  + +   +     D  + ++        I       ++ +  +     +RK  L  S L  Q + D   E QWI E   I ++ D G  L+    +++K +  E E++     ++  L++   L+         I AK+++++  W  L      R+  +   +   QY+ D  + E W++E +     +  G+       L+ K++   E +  YR  +E++  +   L+  +    +   K+ D + +++  L  +A   +  L DA+ +Y  + +S  +   I E  +   +   ++D E L+ L+ +F+ F+ ++   +E+       +  ++    P  + +V  Q+ L  +WN + + ++++  +L        F  D  +  +W+ +K+  +    +LG D++ V    +    + ++I   + ++  LV + + + + +   +A+ I  +   + QEWE L+    DR   L    D+H F  K+ D   W    +  +Q+++   ++ ++   Q+E  +L ++ +++  E A +    E+   I      SE+ K++   L++ +E +  +W + N                  F   A         Q     ++ + +I +  + ++ L  L++   V + E    ++ + EK L+ + ++  TL    N L K R M++K  ++   W+ N      L  Q+   R   LK+   L     D+  ++  + EK   + +   L+++S         L   +ALE E+ A +P+++++ +RG Q      H   +I +  D L+  W +LS A  ++   L        F++  ++++ W+   E  +   D               DG+RS   SI ++ + LD  N                 +L+KQ   + D+  K +Q   +    + G      ++L  A +      F +D +D  + ++EK+  ++  +  K   ++  L++ Q    R  S    I  + +  D   ++AQ+++++    R  V+D++ +L+++ E L++  E     L+    + ++L DV +V  W ++   + M      KD    R+++ +    + EI     ++    +   +L     E+K  V    K V+++ + L+    +EK T   L  ++++CD  E  Q  E W+ ++ T++AR  + G   D   +L      F  ET +  S K++   K  D L+ G + +   I    + +    A LL+ ++ R  +L+ +   H +      L+  I  K      +S ++  N   K  K ++     ++N EK L  ++      +T  N  +    K   A L++ R    D  R+ +  L+ ++L   E  + H+    V ++  W+++V  ++      RD+   ELL+    +L+ E+  + +     +   R L       + +   + +++  +   L +      ++L      +QW + A     W+  +    ++   G +L   L+L KK    +K
Sbjct: 1361 GWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRL----RQAADQKGLDRILEDAHAKLDEMQTALNSK----DQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMA--VDGHYDAD-------RIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMPR--DLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKM--ITAQHYASEEIKNKTHLLKSALERLRSEWALRNG-----------------FLSQA--------VQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNISM---WQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLKN--LHRNPKIANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRS--DSIVDE-QTLDEINRLG-------------EKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAME---VHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSA---IHQKLIAHD---KDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVR-NKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCD--EAVQ-CEQWLSDKETQVARG-ELGDTTDAVEMLIKGHSAF-EETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSELVEN-EKRLSTVERQGEQLVT-DNHFMSEQVK---AQLVELRSGW-DELRT-KSALKTQRLR--EAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEK 2986          

HSP 4 Score: 123.635 bits (309), Expect = 1.639e-27
Identity = 131/615 (21.30%), Postives = 267/615 (43.41%), Query Frame = 1
Query: 4552 GLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYY------------------PKIEEFKKSCVSLPDEYKGIVKDVEDNFNSLK-IICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKA 6339
             +  P + +    ++  +  Q + D D E+ W+ EK  +    +   +   TL +   +  + + ++ E+     ++D ++ +A  +I  +H   + +    ++L+     L + +   + ++   +  Q++L D +EV SW++EK  + +       D+   R+++ K + L  ++  Y                   P +E F+K    L  E+  + K  ED  N+L+  +C        L+    ++ +L Q+IE    E  ++A S++  +D +    L+ +F  F  +  K GS +        + +++   PFA  +   ++ +   W  L E I+ R   L  A +LHR++ D     + + +K ++M    DLG+D K V  L +  +  +K++      +   +  +  L   Y       +  ++Q L   +  L+   +DRK       D H F   VR+LL W +     ++      D+   E L   H  L  EMD++E  F+  +N G  ++  +H  S EIK+K   +    + L  +W      LS  V+ + + R+A    A + S+ + L +  +G ++ +  +  K+   F+KA
Sbjct: 1544 AMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPI----ASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKR-NALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVC--------LYEYMRESADLGQSIE----ENLRVAMSEEFAEDYEHLKELQSKFDEFKQKV-KNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMP--RDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKA 2138          

HSP 5 Score: 101.293 bits (251), Expect = 1.060e-20
Identity = 147/684 (21.49%), Postives = 295/684 (43.13%), Query Frame = 1
Query: 1357 QKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRI----DNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEI----LKHSHLVWQFIVDASLEEQWIK--ELVDIMNNPDLGYDLSSVDRLLRKHKVFELEL---SSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLD-ALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDEL---LSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEM 3357
            Q FN+++   ++    +   L+  +LG+++ +V   LK+H  +E  + A E  L   ++ +D++ +  + D   I   +  VL   + + +   +R++ L+  L+   +  E  EV   +  +  K ++    D+       +   L  HE  E++I +   R++++ SE +  V       + +  S N   I  + N+   D          +K++    L+      Q  +D  LE+   K  E+   +N+ D G DL SV  LL+KH V E E+    +K   +EN+   GK +        + I +    +   + A+    + RK  L E   ++Q V D D    WI E K +   +  G  ++    +++K +Q    V  +   I+++  QA  L+         +  K   +E  + +L  +  +++  ++D  +   + L D+  V SW+ EK+  L +    +D +    L  +      ++T   + +  +      LV +  P+ +     QD L   ++ ++ + + +R+ L   +  Y Y     D  Q+IE   E +++  S +E  ED E + + Q + +  ++ +     +        + ILR N   A+D+  + + +   W  L + I  RDS LA   ++HRF + +D+F  W+      M
Sbjct: 1244 QLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEV---VGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVS------KKHYESPNVEKIVRQVNAQWGDL---------KKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENR---GKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLL-RLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIE---ENLRVAMS-EEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANM 1901          
BLAST of Spectrin beta chain vs. Ensembl Fly
Match: beta-Spec (gene:FBgn0250788 transcript:FBtr0074454)

HSP 1 Score: 1299.26 bits (3361), Expect = 0.000e+0
Identity = 780/2103 (37.09%), Postives = 1245/2103 (59.20%), Query Frame = 1
Query:  148 NALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLK--SEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQL---ETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKI-------EEFKKSCVSLPDEYKGIVKDVEDNFNSLKIICAEKKTEIS----LFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKK 6408
            N   DE E    N +S++FERSRIKALA+ERE+VQKKTFTKW+NS L  V  +I DLYVD+RDGK L+ LLE+LS E +PKPT+G+MRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN  L LGLIWTIILRFQ+QDI  +E  +   KSAKDALLLWCQMKTAGY +VN+RNFT SWR GL F A+IHKHRPDL+ F   ++ + I+NL+ AFD+AE+ LG+  LLD EDV V  PDE+S+ITYV +YYHYF+ LK  +V  KR+ K++   +E+++M+  Y++  S LL+WI  TI+ L  R+F NS+ G+Q Q+  F+ YRT EKP KFVEK +LEVLLFT++S    +  K Y P E   +S IN AW+ L  AE+ RE ALR+EL+RQEKL  LA +F++KA++RE+W+++N  L+ + + G +L  V AA KKHEAIETDI+AYEE +  +  + D LE E Y+D+  I+  K+ V+ LW  LL+ L  RR  L+  LQ+     E   +   +  I      D+YGKHLM VE+LL+ H L+E+DI  + +R++ ++  + +++     D   +    +  +I  +       + EL+    +R+  L+ S  +WQF  D + EE WIKE   I++  ++G+DL++V+ +L KHK  E E++S    L+N    G  L+     G + I  +  +I N W+ L+D T+ R+ +L   ++Y+Q  +D DD + W+ +  R+   + +G   +  + L++K++   + ++NY + I+ +  QA+S L  +  +   V K+L+ I+ +Y++L ++A   +++LLDAL++Y+L++++D V  WI EK K L    P  DIE++E++KHRFE F+ E+   A +V  VN L+  L+   +PN   I+  Q++LN  W+ + +  ++K D+L S +    F+++C++TI WI +K +++   D L  DL  VM  QRR++ M RD+ AI+AK+  L  + + I   +   AK I  ++  +   WE L Q++++RDS L    D+HRF++ LD F  WL + QT++AS++ P S  EAEKL+N++ S R+E+    +  +  M+ G+      S  D  Q++ L+ R+ ++   W+ L+ + E ++  L + L   +F  DARQ E +L+ QE +L KD          +  NL      +  +E F+  M +++  +  +L+   TL+ +++   D++  + +N+  R   N   A ++  KLK QV LHE LQD+++L + + EK     + S  + K+  S   + +A E EI A +  + E  K  ++ S + P FK  I   L  L   + +L    +EK   L   NRE L +++   +  ++ ++E QIV+ D    + + +TS+   ++K      ++  K + +E +   +E L++  P++  K E +   +T V    + +  PL  +     +K  A QF +D +DE  W++EK+ +    +   +   +L     L+ +++S+  EI N   +++++    +++IDE H         ++ L +  + L + +E  +  L     VQ++  D  E  SW+SE+EL +M +    KD+   + +++K +NLE  +++Y   I        +F    +S  D        ++  +  LK +  E++  ++    LF++  +      ++E WI +R  +A S + G+D D  TLL +RF  F+ +T  +G  +V + N   D LIQ  H  + +I+ WKD +NE W DLLELI+TR Q+L ++ +LH+++ D + +L  I EK+    V ++LG+D  SVS LQRK  NF +DL+ L S +      S  L   Y  DK   +  + QE++ A+ +L+ + + RK    +  D   F +MVR L+ W+E++  QM    KPRDVSG+ELL+ NH+SLK E+D++E+NF  C++LG+ LL   H  S +IK +   +++ R+ L ++W    ++L L++EVYQ+ARDAA AEAW+I+QE YL +  LG T+DE   L+KK   F+K+   QEE+F  L+RLTT E++  K
Sbjct:   18 NEYIDEYEYDGGNSSSRLFERSRIKALAEERESVQKKTFTKWVNSHLCRVNCRIADLYVDMRDGKHLIKLLEVLSGERLPKPTKGKMRIHCLENVDKALQFLREQRVHLENIGSHDIVDGNASLNLGLIWTIILRFQIQDITIEEVDNKETKSAKDALLLWCQMKTAGYHNVNVRNFTTSWRDGLAFNAIIHKHRPDLVQFEKLSKTNAIHNLNNAFDVAEDKLGLAKLLDAEDVFVEHPDEKSIITYVVTYYHYFSKLKQETVQGKRIGKVVGIAMENDKMVHDYENFTSDLLKWIETTIQSLGEREFENSLAGVQGQLAQFSNYRTIEKPPKFVEKGNLEVLLFTLQSKMRANNQKPYTPKEGKMISDINKAWERLEKAEHERELALREELIRQEKLEQLAARFDRKASMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIFAYEERVQAVVAVCDELESERYHDVKRILLRKDNVMRLWTYLLELLRARRMRLEISLQLQQNFQEMLYILDNMEEIKQLLMTDDYGKHLMGVEDLLQKHSLVEADINILGERVKVVVQNSQKFL----SDDPESYKPCDPEIIVSRVQQLEDAYAELVRLAVERRSRLEESRKLWQFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLSKHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKEILNKWDHLLDLTKYRRQRLENAVEYFQLFADADDVDNWMLDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAEVIDALHKQAES-LKLNEAEKANVDKRLEAIDNRYKELTELAKLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEMNANASRVAVVNQLARQLLHVEHPNSDEILERQNHLNQEWSTLREKAEAKMDDLKSAHGVQTFYIECRETISWIEDKKRILTETDSLEMDLTGVMTLQRRLSGMDRDLAAIQAKLSSLEREANSIEDEHPEEAKIIRERIAQIELIWEQLTQMLKERDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDNYTEDYKNMMEYGERLTSEGSTSDDPQYMFLRERLNALKDGWEELHQMWENRQVLLSQSLDQQLFNRDARQTEVLLSQQEHFLSKD---------DTPVNLEQAENQLKRHEAFLTTMEANDDKINTLLQVADTLVEKDHFDADKIGKRAENITGRRDDNRQRALDQHEKLKNQVKLHEFLQDLEELAEWVQEKYATSQDESYRSAKTIHSKWTRHQAFEAEIAANKERLFEAEKSAQELSKEKPEFKDVIEPKLKELAKQFDDLEVHTKEKGAMLFDANREVLVQQTCDDIDSYITDLEKQIVSGD----TANDLTSVNILMQKQQVIQTQMAVKARQVEEIDKQTEYLQKTVPEE--KIEPIVVKKTAVLERFEKIKAPLLERQKALEKKKEAFQFCRDVEDEKLWIDEKLPV----ANSPDYGNSLFNVHVLKKKNQSLATEIDNHEPRINAICNNGRKLIDEGHEDAKKFEALISDLTQKWQELKDAIENRRKHLLESEKVQQYFFDAQEAESWMSEQELYMM-VEDRGKDEISAQNLMKKHENLEQSVEDYANTIRQLGEVARQFSGDDISSGDAVAVKQSQLDKLYAGLKDLAGERRARLNEALQLFMLSREV----DDLEQWITDREVVAGSQELGQDFDHVTLLSERFNEFARDTEAVGGERVAKVNGIADNLIQAGHSDSATIAEWKDNLNESWQDLLELIETRTQMLAASRELHKFFHDCKDVLGRILEKQHG--VSDELGRDAGSVSTLQRKHYNFLQDLITLYSQVQQIQEESAKLQDAYAGDKAKEITNREQEVLHAWDNLQAMCDARKQKLADTGDLFRFFNMVRILMIWMEDLVRQMNTSEKPRDVSGVELLMNNHQSLKAEIDTREDNFGACISLGKELLTRNHYASADIKDRLMTLSNSRNALLRRWEERWENLQLILEVYQFARDAAVAEAWLIAQEPYLLSSELGHTIDEVENLIKKHEAFEKSAAAQEERFSALERLTTFELKEMK 2089          

HSP 2 Score: 131.724 bits (330), Expect = 6.665e-30
Identity = 140/618 (22.65%), Postives = 280/618 (45.31%), Query Frame = 1
Query: 4612 QFLQDCDDEIDWMNEKIDLIRNR--SKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVIN---SKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLP---DEYKGIVKDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ---NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELID-AFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRS-PE---IKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNT 6417
            QF  D  DE +W+ EK  ++        + T+  +L       +HK++++EI +   ++ ++ +    +I E H     + D + ++    ++L +  +  +  L N +   +   D  +V +W+    LD + +V +    +D+  ++ +++K +++  E+KNY   I+   K   SL     E   + K +E   N  K +    K      +     Y+L      +E WI E+TK+  +   GKD++   +++ RF  F  E N   +S+V   N+   +L+  +HP +  I   ++ +N+ W+ L E  + ++  LKSA  +  +Y + +  +  I++KK  +   + L  D   V  LQR+L   ++DL  + + +++    +N++   + +  EA +I++R   I+  +  L ++L++R     E  D H FL  +     W+ +    +     P  +   E LL  H+S++ E+D+  E++   +  G  L         P+   ++ +   + D  + L Q W N    LS  ++   + RDA   E  +  QE +L+ ++  + L++    LK+   F                LTTME    K+NT
Sbjct:  639 QFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLS------KHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKEILNKWDHLLDLTKYRRQRLENAVEYFQLFADADDVDNWM----LDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAEVIDALHKQAESLKLNEAEKANVDKRLEAIDNRYKELTELAKLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEMN-ANASRVAVVNQLARQLLHVEHPNSDEILERQNHLNQEWSTLREKAEAKMDDLKSAHGVQTFYIECRETISWIEDKKRILTETDSLEMDLTGVMTLQRRLSGMDRDLAAIQAKLSSLEREANSIEDEHPE--EAKIIRERIAQIELIWEQLTQMLKERDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDNYTEDYKNMMEYGERLTSEGSTSDDPQYMFLRERLNALKDGWEELHQMWENRQVLLSQSLDQQLFNRDARQTEVLLSQQEHFLSKDDTPVNLEQAENQLKRHEAF----------------LTTMEANDDKINT 1227          

HSP 3 Score: 89.7373 bits (221), Expect = 3.736e-17
Identity = 47/174 (27.01%), Postives = 85/174 (48.85%), Query Frame = 1
Query: 6784 LSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRFFSSIRLK 7305
            + AS   +     P      +G + RKH+W++  +KASNR+W  +Y+     R++F+KD++ +K  P+  ++ E    L       A DY K+  V RV+  NGA +L Q     +M++WV ++ + S              +T    + S +LP  +Q  +  +R F +++ K
Sbjct: 2131 VGASHDDSERGGTPGAGEGHEGYVTRKHEWDSTTKKASNRSWDKVYMAAKAGRISFYKDQKGYKSNPELTFRGEPSYDLQNAAIEIASDYTKKKHVLRVKLANGALFLLQAHDDTEMSQWVTSLKAQS-------------DSTAVAASRSQTLPATSQKDEPKRRSFFTLKKK 2291          
BLAST of Spectrin beta chain vs. Ensembl Fly
Match: beta-Spec (gene:FBgn0250788 transcript:FBtr0334404)

HSP 1 Score: 1298.88 bits (3360), Expect = 0.000e+0
Identity = 780/2103 (37.09%), Postives = 1245/2103 (59.20%), Query Frame = 1
Query:  148 NALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLK--SEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQL---ETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKI-------EEFKKSCVSLPDEYKGIVKDVEDNFNSLKIICAEKKTEIS----LFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKK 6408
            N   DE E    N +S++FERSRIKALA+ERE+VQKKTFTKW+NS L  V  +I DLYVD+RDGK L+ LLE+LS E +PKPT+G+MRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN  L LGLIWTIILRFQ+QDI  +E  +   KSAKDALLLWCQMKTAGY +VN+RNFT SWR GL F A+IHKHRPDL+ F   ++ + I+NL+ AFD+AE+ LG+  LLD EDV V  PDE+S+ITYV +YYHYF+ LK  +V  KR+ K++   +E+++M+  Y++  S LL+WI  TI+ L  R+F NS+ G+Q Q+  F+ YRT EKP KFVEK +LEVLLFT++S    +  K Y P E   +S IN AW+ L  AE+ RE ALR+EL+RQEKL  LA +F++KA++RE+W+++N  L+ + + G +L  V AA KKHEAIETDI+AYEE +  +  + D LE E Y+D+  I+  K+ V+ LW  LL+ L  RR  L+  LQ+     E   +   +  I      D+YGKHLM VE+LL+ H L+E+DI  + +R++ ++  + +++     D   +    +  +I  +       + EL+    +R+  L+ S  +WQF  D + EE WIKE   I++  ++G+DL++V+ +L KHK  E E++S    L+N    G  L+     G + I  +  +I N W+ L+D T+ R+ +L   ++Y+Q  +D DD + W+ +  R+   + +G   +  + L++K++   + ++NY + I+ +  QA+S L  +  +   V K+L+ I+ +Y++L ++A   +++LLDAL++Y+L++++D V  WI EK K L    P  DIE++E++KHRFE F+ E+   A +V  VN L+  L+   +PN   I+  Q++LN  W+ + +  ++K D+L S +    F+++C++TI WI +K +++   D L  DL  VM  QRR++ M RD+ AI+AK+  L  + + I   +   AK I  ++  +   WE L Q++++RDS L    D+HRF++ LD F  WL + QT++AS++ P S  EAEKL+N++ S R+E+    +  +  M+ G+      S  D  Q++ L+ R+ ++   W+ L+ + E ++  L + L   +F  DARQ E +L+ QE +L KD          +  NL      +  +E F+  M +++  +  +L+   TL+ +++   D++  + +N+  R   N   A ++  KLK QV LHE LQD+++L + + EK     + S  + K+  S   + +A E EI A +  + E  K  ++ S + P FK  I   L  L   + +L    +EK   L   NRE L +++   +  ++ ++E QIV+ D    + + +TS+   ++K      ++  K + +E +   +E L++  P++  K E +   +T V    + +  PL  +     +K  A QF +D +DE  W++EK+ +    +   +   +L     L+ +++S+  EI N   +++++    +++IDE H         ++ L +  + L + +E  +  L     VQ++  D  E  SW+SE+EL +M +    KD+   + +++K +NLE  +++Y   I        +F    +S  D        ++  +  LK +  E++  ++    LF++  +      ++E WI +R  +A S + G+D D  TLL +RF  F+ +T  +G  +V + N   D LIQ  H  + +I+ WKD +NE W DLLELI+TR Q+L ++ +LH+++ D + +L  I EK+    V ++LG+D  SVS LQRK  NF +DL+ L S +      S  L   Y  DK   +  + QE++ A+ +L+ + + RK    +  D   F +MVR L+ W+E++  QM    KPRDVSG+ELL+ NH+SLK E+D++E+NF  C++LG+ LL   H  S +IK +   +++ R+ L ++W    ++L L++EVYQ+ARDAA AEAW+I+QE YL +  LG T+DE   L+KK   F+K+   QEE+F  L+RLTT E++  K
Sbjct:   18 NEYIDEYEYDGGNSSSRLFERSRIKALAEERESVQKKTFTKWVNSHLCRVNCRIADLYVDMRDGKHLIKLLEVLSGERLPKPTKGKMRIHCLENVDKALQFLREQRVHLENIGSHDIVDGNASLNLGLIWTIILRFQIQDITIEEVDNKETKSAKDALLLWCQMKTAGYHNVNVRNFTTSWRDGLAFNAIIHKHRPDLVQFEKLSKTNAIHNLNNAFDVAEDKLGLAKLLDAEDVFVEHPDEKSIITYVVTYYHYFSKLKQETVQGKRIGKVVGIAMENDKMVHDYENFTSDLLKWIETTIQSLGEREFENSLAGVQGQLAQFSNYRTIEKPPKFVEKGNLEVLLFTLQSKMRANNQKPYTPKEGKMISDINKAWERLEKAEHERELALREELIRQEKLEQLAARFDRKASMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIFAYEERVQAVVAVCDELESERYHDVKRILLRKDNVMRLWTYLLELLRARRMRLEISLQLQQNFQEMLYILDNMEEIKQLLMTDDYGKHLMGVEDLLQKHSLVEADINILGERVKVVVQNSQKFL----SDDPESYKPCDPEIIVSRVQQLEDAYAELVRLAVERRSRLEESRKLWQFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLSKHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKEILNKWDHLLDLTKYRRQRLENAVEYFQLFADADDVDNWMLDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAEVIDALHKQAES-LKLNEAEKANVDKRLEAIDNRYKELTELAKLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEMNANASRVAVVNQLARQLLHVEHPNSDEILERQNHLNQEWSTLREKAEAKMDDLKSAHGVQTFYIECRETISWIEDKKRILTETDSLEMDLTGVMTLQRRLSGMDRDLAAIQAKLSSLEREANSIEDEHPEEAKIIRERIAQIELIWEQLTQMLKERDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDNYTEDYKNMMEYGERLTSEGSTSDDPQYMFLRERLNALKDGWEELHQMWENRQVLLSQSLDQQLFNRDARQTEVLLSQQEHFLSKD---------DTPVNLEQAENQLKRHEAFLTTMEANDDKINTLLQVADTLVEKDHFDADKIGKRAENITGRRDDNRQRALDQHEKLKNQVKLHEFLQDLEELAEWVQEKYATSQDESYRSAKTIHSKWTRHQAFEAEIAANKERLFEAEKSAQELSKEKPEFKDVIEPKLKELAKQFDDLEVHTKEKGAMLFDANREVLVQQTCDDIDSYITDLEKQIVSGD----TANDLTSVNILMQKQQVIQTQMAVKARQVEEIDKQTEYLQKTVPEE--KIEPIVVKKTAVLERFEKIKAPLLERQKALEKKKEAFQFCRDVEDEKLWIDEKLPV----ANSPDYGNSLFNVHVLKKKNQSLATEIDNHEPRINAICNNGRKLIDEGHEDAKKFEALISDLTQKWQELKDAIENRRKHLLESEKVQQYFFDAQEAESWMSEQELYMM-VEDRGKDEISAQNLMKKHENLEQSVEDYANTIRQLGEVARQFSGDDISSGDAVAVKQSQLDKLYAGLKDLAGERRARLNEALQLFMLSREV----DDLEQWITDREVVAGSQELGQDFDHVTLLSERFNEFARDTEAVGGERVAKVNGIADNLIQAGHSDSATIAEWKDNLNESWQDLLELIETRTQMLAASRELHKFFHDCKDVLGRILEKQHG--VSDELGRDAGSVSTLQRKHYNFLQDLITLYSQVQQIQEESAKLQDAYAGDKAKEITNREQEVLHAWDNLQAMCDARKQKLADTGDLFRFFNMVRILMIWMEDLVRQMNTSEKPRDVSGVELLMNNHQSLKAEIDTREDNFGACISLGKELLTRNHYASADIKDRLMTLSNSRNALLRRWEERWENLQLILEVYQFARDAAVAEAWLIAQEPYLLSSELGHTIDEVENLIKKHEAFEKSAAAQEERFSALERLTTFELKEMK 2089          

HSP 2 Score: 131.724 bits (330), Expect = 6.911e-30
Identity = 140/618 (22.65%), Postives = 280/618 (45.31%), Query Frame = 1
Query: 4612 QFLQDCDDEIDWMNEKIDLIRNR--SKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVIN---SKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLP---DEYKGIVKDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ---NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELID-AFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRS-PE---IKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNT 6417
            QF  D  DE +W+ EK  ++        + T+  +L       +HK++++EI +   ++ ++ +    +I E H     + D + ++    ++L +  +  +  L N +   +   D  +V +W+    LD + +V +    +D+  ++ +++K +++  E+KNY   I+   K   SL     E   + K +E   N  K +    K      +     Y+L      +E WI E+TK+  +   GKD++   +++ RF  F  E N   +S+V   N+   +L+  +HP +  I   ++ +N+ W+ L E  + ++  LKSA  +  +Y + +  +  I++KK  +   + L  D   V  LQR+L   ++DL  + + +++    +N++   + +  EA +I++R   I+  +  L ++L++R     E  D H FL  +     W+ +    +     P  +   E LL  H+S++ E+D+  E++   +  G  L         P+   ++ +   + D  + L Q W N    LS  ++   + RDA   E  +  QE +L+ ++  + L++    LK+   F                LTTME    K+NT
Sbjct:  639 QFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLS------KHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKEILNKWDHLLDLTKYRRQRLENAVEYFQLFADADDVDNWM----LDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAEVIDALHKQAESLKLNEAEKANVDKRLEAIDNRYKELTELAKLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEMN-ANASRVAVVNQLARQLLHVEHPNSDEILERQNHLNQEWSTLREKAEAKMDDLKSAHGVQTFYIECRETISWIEDKKRILTETDSLEMDLTGVMTLQRRLSGMDRDLAAIQAKLSSLEREANSIEDEHPE--EAKIIRERIAQIELIWEQLTQMLKERDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDNYTEDYKNMMEYGERLTSEGSTSDDPQYMFLRERLNALKDGWEELHQMWENRQVLLSQSLDQQLFNRDARQTEVLLSQQEHFLSKDDTPVNLEQAENQLKRHEAF----------------LTTMEANDDKINT 1227          

HSP 3 Score: 88.9669 bits (219), Expect = 6.737e-17
Identity = 44/154 (28.57%), Postives = 80/154 (51.95%), Query Frame = 1
Query: 6844 KGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRFFSSIRLK 7305
            +G + RKH+W++  +KASNR+W  +Y+     R++F+KD++ +K  P+  ++ E    L       A DY K+  V RV+  NGA +L Q     +M++WV ++ + S              +T    + S +LP  +Q  +  +R F +++ K
Sbjct: 2168 EGYVTRKHEWDSTTKKASNRSWDKVYMAAKAGRISFYKDQKGYKSNPELTFRGEPSYDLQNAAIEIASDYTKKKHVLRVKLANGALFLLQAHDDTEMSQWVTSLKAQS-------------DSTAVAASRSQTLPATSQKDEPKRRSFFTLKKK 2308          
BLAST of Spectrin beta chain vs. Ensembl Fly
Match: beta-Spec (gene:FBgn0250788 transcript:FBtr0334405)

HSP 1 Score: 1298.49 bits (3359), Expect = 0.000e+0
Identity = 780/2103 (37.09%), Postives = 1245/2103 (59.20%), Query Frame = 1
Query:  148 NALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLK--SEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQL---ETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKI-------EEFKKSCVSLPDEYKGIVKDVEDNFNSLKIICAEKKTEIS----LFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKK 6408
            N   DE E    N +S++FERSRIKALA+ERE+VQKKTFTKW+NS L  V  +I DLYVD+RDGK L+ LLE+LS E +PKPT+G+MRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN  L LGLIWTIILRFQ+QDI  +E  +   KSAKDALLLWCQMKTAGY +VN+RNFT SWR GL F A+IHKHRPDL+ F   ++ + I+NL+ AFD+AE+ LG+  LLD EDV V  PDE+S+ITYV +YYHYF+ LK  +V  KR+ K++   +E+++M+  Y++  S LL+WI  TI+ L  R+F NS+ G+Q Q+  F+ YRT EKP KFVEK +LEVLLFT++S    +  K Y P E   +S IN AW+ L  AE+ RE ALR+EL+RQEKL  LA +F++KA++RE+W+++N  L+ + + G +L  V AA KKHEAIETDI+AYEE +  +  + D LE E Y+D+  I+  K+ V+ LW  LL+ L  RR  L+  LQ+     E   +   +  I      D+YGKHLM VE+LL+ H L+E+DI  + +R++ ++  + +++     D   +    +  +I  +       + EL+    +R+  L+ S  +WQF  D + EE WIKE   I++  ++G+DL++V+ +L KHK  E E++S    L+N    G  L+     G + I  +  +I N W+ L+D T+ R+ +L   ++Y+Q  +D DD + W+ +  R+   + +G   +  + L++K++   + ++NY + I+ +  QA+S L  +  +   V K+L+ I+ +Y++L ++A   +++LLDAL++Y+L++++D V  WI EK K L    P  DIE++E++KHRFE F+ E+   A +V  VN L+  L+   +PN   I+  Q++LN  W+ + +  ++K D+L S +    F+++C++TI WI +K +++   D L  DL  VM  QRR++ M RD+ AI+AK+  L  + + I   +   AK I  ++  +   WE L Q++++RDS L    D+HRF++ LD F  WL + QT++AS++ P S  EAEKL+N++ S R+E+    +  +  M+ G+      S  D  Q++ L+ R+ ++   W+ L+ + E ++  L + L   +F  DARQ E +L+ QE +L KD          +  NL      +  +E F+  M +++  +  +L+   TL+ +++   D++  + +N+  R   N   A ++  KLK QV LHE LQD+++L + + EK     + S  + K+  S   + +A E EI A +  + E  K  ++ S + P FK  I   L  L   + +L    +EK   L   NRE L +++   +  ++ ++E QIV+ D    + + +TS+   ++K      ++  K + +E +   +E L++  P++  K E +   +T V    + +  PL  +     +K  A QF +D +DE  W++EK+ +    +   +   +L     L+ +++S+  EI N   +++++    +++IDE H         ++ L +  + L + +E  +  L     VQ++  D  E  SW+SE+EL +M +    KD+   + +++K +NLE  +++Y   I        +F    +S  D        ++  +  LK +  E++  ++    LF++  +      ++E WI +R  +A S + G+D D  TLL +RF  F+ +T  +G  +V + N   D LIQ  H  + +I+ WKD +NE W DLLELI+TR Q+L ++ +LH+++ D + +L  I EK+    V ++LG+D  SVS LQRK  NF +DL+ L S +      S  L   Y  DK   +  + QE++ A+ +L+ + + RK    +  D   F +MVR L+ W+E++  QM    KPRDVSG+ELL+ NH+SLK E+D++E+NF  C++LG+ LL   H  S +IK +   +++ R+ L ++W    ++L L++EVYQ+ARDAA AEAW+I+QE YL +  LG T+DE   L+KK   F+K+   QEE+F  L+RLTT E++  K
Sbjct:   18 NEYIDEYEYDGGNSSSRLFERSRIKALAEERESVQKKTFTKWVNSHLCRVNCRIADLYVDMRDGKHLIKLLEVLSGERLPKPTKGKMRIHCLENVDKALQFLREQRVHLENIGSHDIVDGNASLNLGLIWTIILRFQIQDITIEEVDNKETKSAKDALLLWCQMKTAGYHNVNVRNFTTSWRDGLAFNAIIHKHRPDLVQFEKLSKTNAIHNLNNAFDVAEDKLGLAKLLDAEDVFVEHPDEKSIITYVVTYYHYFSKLKQETVQGKRIGKVVGIAMENDKMVHDYENFTSDLLKWIETTIQSLGEREFENSLAGVQGQLAQFSNYRTIEKPPKFVEKGNLEVLLFTLQSKMRANNQKPYTPKEGKMISDINKAWERLEKAEHERELALREELIRQEKLEQLAARFDRKASMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIFAYEERVQAVVAVCDELESERYHDVKRILLRKDNVMRLWTYLLELLRARRMRLEISLQLQQNFQEMLYILDNMEEIKQLLMTDDYGKHLMGVEDLLQKHSLVEADINILGERVKVVVQNSQKFL----SDDPESYKPCDPEIIVSRVQQLEDAYAELVRLAVERRSRLEESRKLWQFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLSKHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKEILNKWDHLLDLTKYRRQRLENAVEYFQLFADADDVDNWMLDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAEVIDALHKQAES-LKLNEAEKANVDKRLEAIDNRYKELTELAKLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEMNANASRVAVVNQLARQLLHVEHPNSDEILERQNHLNQEWSTLREKAEAKMDDLKSAHGVQTFYIECRETISWIEDKKRILTETDSLEMDLTGVMTLQRRLSGMDRDLAAIQAKLSSLEREANSIEDEHPEEAKIIRERIAQIELIWEQLTQMLKERDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDNYTEDYKNMMEYGERLTSEGSTSDDPQYMFLRERLNALKDGWEELHQMWENRQVLLSQSLDQQLFNRDARQTEVLLSQQEHFLSKD---------DTPVNLEQAENQLKRHEAFLTTMEANDDKINTLLQVADTLVEKDHFDADKIGKRAENITGRRDDNRQRALDQHEKLKNQVKLHEFLQDLEELAEWVQEKYATSQDESYRSAKTIHSKWTRHQAFEAEIAANKERLFEAEKSAQELSKEKPEFKDVIEPKLKELAKQFDDLEVHTKEKGAMLFDANREVLVQQTCDDIDSYITDLEKQIVSGD----TANDLTSVNILMQKQQVIQTQMAVKARQVEEIDKQTEYLQKTVPEE--KIEPIVVKKTAVLERFEKIKAPLLERQKALEKKKEAFQFCRDVEDEKLWIDEKLPV----ANSPDYGNSLFNVHVLKKKNQSLATEIDNHEPRINAICNNGRKLIDEGHEDAKKFEALISDLTQKWQELKDAIENRRKHLLESEKVQQYFFDAQEAESWMSEQELYMM-VEDRGKDEISAQNLMKKHENLEQSVEDYANTIRQLGEVARQFSGDDISSGDAVAVKQSQLDKLYAGLKDLAGERRARLNEALQLFMLSREV----DDLEQWITDREVVAGSQELGQDFDHVTLLSERFNEFARDTEAVGGERVAKVNGIADNLIQAGHSDSATIAEWKDNLNESWQDLLELIETRTQMLAASRELHKFFHDCKDVLGRILEKQHG--VSDELGRDAGSVSTLQRKHYNFLQDLITLYSQVQQIQEESAKLQDAYAGDKAKEITNREQEVLHAWDNLQAMCDARKQKLADTGDLFRFFNMVRILMIWMEDLVRQMNTSEKPRDVSGVELLMNNHQSLKAEIDTREDNFGACISLGKELLTRNHYASADIKDRLMTLSNSRNALLRRWEERWENLQLILEVYQFARDAAVAEAWLIAQEPYLLSSELGHTIDEVENLIKKHEAFEKSAAAQEERFSALERLTTFELKEMK 2089          

HSP 2 Score: 131.339 bits (329), Expect = 8.032e-30
Identity = 140/618 (22.65%), Postives = 280/618 (45.31%), Query Frame = 1
Query: 4612 QFLQDCDDEIDWMNEKIDLIRNR--SKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVIN---SKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLP---DEYKGIVKDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ---NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELID-AFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRS-PE---IKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNT 6417
            QF  D  DE +W+ EK  ++        + T+  +L       +HK++++EI +   ++ ++ +    +I E H     + D + ++    ++L +  +  +  L N +   +   D  +V +W+    LD + +V +    +D+  ++ +++K +++  E+KNY   I+   K   SL     E   + K +E   N  K +    K      +     Y+L      +E WI E+TK+  +   GKD++   +++ RF  F  E N   +S+V   N+   +L+  +HP +  I   ++ +N+ W+ L E  + ++  LKSA  +  +Y + +  +  I++KK  +   + L  D   V  LQR+L   ++DL  + + +++    +N++   + +  EA +I++R   I+  +  L ++L++R     E  D H FL  +     W+ +    +     P  +   E LL  H+S++ E+D+  E++   +  G  L         P+   ++ +   + D  + L Q W N    LS  ++   + RDA   E  +  QE +L+ ++  + L++    LK+   F                LTTME    K+NT
Sbjct:  639 QFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLS------KHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKEILNKWDHLLDLTKYRRQRLENAVEYFQLFADADDVDNWM----LDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAEVIDALHKQAESLKLNEAEKANVDKRLEAIDNRYKELTELAKLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEMN-ANASRVAVVNQLARQLLHVEHPNSDEILERQNHLNQEWSTLREKAEAKMDDLKSAHGVQTFYIECRETISWIEDKKRILTETDSLEMDLTGVMTLQRRLSGMDRDLAAIQAKLSSLEREANSIEDEHPE--EAKIIRERIAQIELIWEQLTQMLKERDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDNYTEDYKNMMEYGERLTSEGSTSDDPQYMFLRERLNALKDGWEELHQMWENRQVLLSQSLDQQLFNRDARQTEVLLSQQEHFLSKDDTPVNLEQAENQLKRHEAF----------------LTTMEANDDKINT 1227          
BLAST of Spectrin beta chain vs. Ensembl Fly
Match: kst (gene:FBgn0004167 transcript:FBtr0073071)

HSP 1 Score: 518.85 bits (1335), Expect = 5.385e-148
Identity = 364/1159 (31.41%), Postives = 580/1159 (50.04%), Query Frame = 1
Query:  202 FERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFD---EDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSC--NRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLL--GYSIVDHQTVAKKLDRIE--------------------------KKYQDLLDIAH-------KMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNG---------------------------NPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIG 3477
            FE  RIK L +ER ++QKKTFTKW+NS LI   M++EDL+ DL DG  LL LLE++S+E + KP  GRMR+H +ENV+K L FL   KV LE++GA DIVDGNPRL LGLIWTIILRFQ+Q+I+ D   E+ S   +SAKDALLLWCQ KT GYP VNI +FTNSWR+GLGF ALIH HRPDL ++S+   ++N N++NL+ AFD A N LGIPSLLD ED++   PDE+S++TYVASYYH F  +K      KR+  ++ Q+++ ++    Y+ L + LL WIR     L  R   NS+ GIQ+++  F  YRT EKP K+ E+ ++E L FTI +         YNP +   ++ I  AW  L  AE+ RE ALR EL+RQEKL  L  KF KK+ LRE ++    E++Q  S    L  V A LKKHEAI  DI A  E    LT +++ L+ E Y+    +   + +V+  W++LL+ L  +R +L     +  L+ E       +  +  +   ++ G HL+ VEELL++H L E  + +  + L++   +A  Y     +D          A++ ++     + + ELL     R+  L+ +     F+ D   EE W+ +   I        DL +V  L +KHK  E E+ S++         GK L+         I ++ + +   W+AL    E R+ +L +  + YQ+ +D ++AE W++E   L + +  G+     + L+++++     +  Y  +I  +  QA  L+  G   ++      +L  +E                          KK  +   + H       + Q   +D   V  LL    +   W   K   +  F+P++ + E+E          + +  +AEKV  +  + + ++V                             N N   +   Q  +N +++++ ++   +   L    H   F+ +C    +W++EK ++I+S     ++ E V   +R+      D+ A   +++ +    D   R        I  +   +HQ W+ L      R+ +L   + +  F +  D+   W+ +   ++ +  I       + L  ++ +   E+A +E ++     +G
Sbjct:   10 FENERIKTLQEERLHIQKKTFTKWMNSFLIKAKMEVEDLFTDLADGIKLLKLLEIISSEKLGKPNSGRMRVHKIENVNKSLAFLHT-KVRLESIGAEDIVDGNPRLILGLIWTIILRFQIQEIEIDVDEENESSEKRSAKDALLLWCQRKTHGYPGVNITDFTNSWRSGLGFNALIHSHRPDLFEYSTIVNSKNSNLDNLNHAFDTAANELGIPSLLDAEDIDSARPDEKSILTYVASYYHTFARMKNEQKSGKRIANIVGQLMDADRKKMQYEGLTTNLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLK---EMIQVLSDPRYLRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKD---------AALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLELSAAEPELPEVEQEEWVNETRLVPKEVWEDEWVEKLEHKKVTETKMLPHVKSLFPFEGQGMKMDKGEVM-LLKSKTNDDWWCVRKDNGVEGFVPANYVREVEPRP------VACIVPKAEKVKSLQKVKKTILVRQVVPVKRIKPVSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKS-----DEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLG 1143          

HSP 2 Score: 331.643 bits (849), Expect = 1.850e-90
Identity = 459/2016 (22.77%), Postives = 884/2016 (43.85%), Query Frame = 1
Query: 1426 QSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYV-QFCDQDFRSNINSGNKAM--IKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFE--LELSSKRISL----ENKLMEGKTL--VDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEIL--------IRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGN--PNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKID-HLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLK--SEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLK---QGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSEL---LKQQNPD--KASKYEQLETQVKVTM-----DGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNM-------LSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLPD----EYKGIVK---DVEDNFNSLKIICAEKKTEIS----LFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELAD-FHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEI---------RSKKLNTDRQFINEALINIEQ------TAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTG---YFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAIN-SASRPMRQVNPSNTNPSTTQSHPNLSSSLP 7248
            Q LG +L + LA L+KHE  E D+ A E  L  L + S  L+ +  ++  +I   ++KV+  W  L +    R + L     + T + +  ++ +  + + A  + + +         L   H+ I  +I +   +         RY+ +  D    S + +G+ A   ++EK  + + +  +L  + +K+K +L+    ++ F+ DA   +         +++ D G  +  V   +RKH  FE  ++   +++SL      KL+E +     +I  + Q  +A +        + + D    R+ KL + L Y ++V DC +A+ WI+E ++    K   D  S+ E+         ++K+Q     V   +  I++I++    LL         + + ++ + + +Q LL    +    L +A       +  D + +WI +K+  +       D+E    L  + +  +S++    ++V H+N L++ L+       + Q +   + + N +W ++   +++ R  L        F  D   T + I EK   + S D  G DL +V    RR   ++RD+ A++ KID H  A    I ++  R A+ IE +L+ +H+ W  LQ L   R S L      H+F+  + +   W+  M  +M +   P + ++ E  +  +  ++ E+   ++      + G+   K   +Q  D   +    +E ++Q    LN+   E+ + L +  +  +F     Q+E  L  +E +L  D   L +++   +  L   +E   E  +  D + + +K    +L+   +   LI E   Y  R + K   L E           RK +L +   L E L+ + ++D  L++K+QV  + +     +  S + +  A + E+ +  P ++ +   G++        K EI   +  L   W +L  A + K   L        F  S      W+  +E Q+ ++D        + +++N LKK +          +L  ++  H EL   LKQ++    +A  + + E   + T+     + L  PL  +       +  +QFL+D +DE+ W+ EK  L+   S+ + T  +LL  Q LQ +H S++ E+ ++   + +L+Q  Q+MI +NH           QL+   E L +++ + +++       L + +  Q F ++ +E  +W+ EK   ++      +D+  ++   +K + L+ E+  + P IE+  K    L +    +   I +    V   +  L  +  E+++ +     LF    +T EL++    W+ ++  +  S+D G+D++    L   F  F S  N    ++V    +R D LIQ  +P+  SI   +D   ++W +L +L+  R   L  A  +H +   +   ++ I EK +S+ +  D G+D +S+  L RK + FE +L+ +   +++ +  +  L  +Y   KE   +K R E ++A+  L++    RK N L  A+   ++    R+L+ WI E+  ++        V+G ELLLA+ +    E+ +++E F+     G+ L++ KH  + E++ K K +  + ++L        +   L ++   + +DA   E W+ S+E  L +  LG ++ +   LL++   F+K    QEEKF+ +KR+T +E          +  KL    +   E L  ++Q        E    E      +N  + E  PI   P     Q     +   S +       D       QK +S         + SA + V +  +S + QP    +     +          +      +PP E+  +G L RKH  ++  +KA  R+W   + +L    + FFKDE  F ++         P+ +       A DY K+  VFR++  +G+E+LF+  S+  +  WV  I+  AS P     P+    S  +S    SSS P
Sbjct: 1950 QELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKF--------RYLNELSD----SMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARR--------QKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQK----KLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTD-TGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQ---TLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNND--DLGDSYTAVERLLKKHDEF--EKLLHADHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSE----------ERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYG----KDLAAVSNLLKKHE----------RLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEK-QLVAG-SQDLGT--SLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHF-------ASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKR-PVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHE----WVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLN-ANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASL-ISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVK-RDETVEAWTDLKEKTAARK-NKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQLFRHQLEQEKISKLQEKERLEKERLEQLKQRELQRLADERRRAEKQHEHRQNAASQEKTPIFSSPMVTPAQTSGPQSPALSQVQLRPPFGDDNEHLALQKSSSSGMFGDRLRRGSADANVKRA-ESMKVQPKQAKRTPSFTTRRRAQSFRKNQKGEGFDLPPVEI--QGSLERKHGLQSGGKKAPVRSWKQFHTVLCGQLVCFFKDENDFLQQKTAT----APVNILGAKCERADDYTKKKYVFRLKLPDGSEFLFEAPSLDILNDWVRKISFHASLP-----PNMQLLSYDESMKQQSSSSP 3877          

HSP 3 Score: 225.328 bits (573), Expect = 3.094e-58
Identity = 274/1295 (21.16%), Postives = 587/1295 (45.33%), Query Frame = 1
Query: 2557 TVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHN----WLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFV----RLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGK---QTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXD---HSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQN-IEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLK 6375
            +V K+  RI + Y +L ++A K    L D++ ++    + D    W+ EK++     I SD+ E ++  K +FE F ++L+  +++V  ++   +     G+     I+  Q  ++  W ++ +    +   L        F   C +   W+ EK+  +++   +  DL +V   QRR  +++R++  +E K++ +   G+ + ++   + KD    ++   QE + + Q ++ R S L N+ +     Q  ++       W+  ++ ++ +         A  L+ K+N   D++ A + +  E +++GK     + +  + V    RL+   ++I++ W        EK+K L + +   MF  +A +I+    + E +L          +N   ++L  +  I+  +  F   +++ +K+L         LI  ++     + ++   +  + K     A  RK  L+     H+   + DDL   L +K ++  + +  +  +    L + +A E E+ A    +  + K G+   Q     P  +  + D    LN  W +L    E+K + L     ++    S +   K +  ++  + + D  +  RS    + N+ + L+S     + K   L +  D   H      QN +  +K  +L+ + K   D    P + + +   + +   +F+ + D E  W+NE +      +K  E    L Q Q L  +HK ++ EI+     ++  +   Q +I + H +R  V     QL++  ++L     +    L   L  Q++L D  E+ SW+ E+  +++      +D     +++ K + +E+E+  Y   + E   SC ++     PD      K   +E    SL  + ++++  + +  +Y   Y L  + +E WI E+ + A S+D G+D +   LL+++F        ++G+ +V++      +LI  + P+A+ +   ++++   W +LL+L++ R Q L +A ++HR++ D    L  IQ+K +++    +LG+D  S   L RK + FE DL+ L++ +   +  S  L   Y  +  A + +++ +++ A+  L++    R       +D   FL+ VR+++ W   +   ++      D +G   L   H ++  E++++E+ F     L  ++++T H  + +++ KC  + D+R  L   W      L   ++++ + RDA   +    SQ++ L++ + G T+++    ++K   F++    QEEK   L+
Sbjct:  948 SVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERM----IKSDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTA-VITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSV-KNAYPAEKD---NVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDAIHRGW-------AEKQKWLLQCVDLQMFNREADKIDATTKSHEAFL---------EYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPEVESRVAD----LNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRS-CKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTK--ELQQRFKDLRD----PTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPA----AKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERN-NVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRL-MESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRV-EVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALS--QELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASA-IAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQ 2196          

HSP 4 Score: 149.828 bits (377), Expect = 2.433e-35
Identity = 157/726 (21.63%), Postives = 325/726 (44.77%), Query Frame = 1
Query: 1297 GRETALRKELMRQEKLRNLAQKFNKKAALRES---WITDNMELLQKQSLGN--NLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDL---WKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLG-DKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAME 3447
            G+  A++     +++L   ++ F+K AA  +    W+ D   +   ++  +  NLP     L+KH+A E ++ A E  L  +TK    L +   N +  +   +++V DL   WK LL    ++   L+             + +  +  + +  R  + G  L   ++L+   +++ES+I   +Q++ +L+S  +        + + NI +G K + +         F +L D   +R+  L+ S    +F+ +   E QWI E +    + +LG +L     L +KHK  E E+   +  +   L+ G++L+      +E + +    ++  W+ L      R  KL   L   QY+ D  + E W+ E   +      G D+ S  ++L +     +E+ + Y   + ++ +   +++  +  D + +A K   IEK  + L  +A + Q +L+++L  +    +SD V  WI E+++   +     D E L++L+++F+  +  +   A++V     L++ L+ + +P    +   Q+ L  SW  +  +++ +  +L +      F  D  + +  I++K   +    ELG DL S +   R+    + D+ A+EA++  LV     +      +A  I  Q D V   W  L++    R   LA  +D+  F+  + D  +W   ++  + ++      + A  L  ++++   E+ A E
Sbjct: 1377 GKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPR---KLQKHQAFERELRANEGQLRNVTKDGQALVQ-AGNRVPEV---ESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQ-NIEAGTKELQQR--------FKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELEL-DTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQ--ELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEARE 2083          

HSP 5 Score: 112.079 bits (279), Expect = 7.477e-24
Identity = 114/498 (22.89%), Postives = 223/498 (44.78%), Query Frame = 1
Query: 1354 AQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEIL---KHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLS 2838
            +Q F  +A   ++W+ +   +L     G +  +V    KK E ++ ++ A++ ++  + K++  L E  + D  +I     +V   ++ LL+   ER   L    +++  + E  E+   +    A    ++YG+ +  VE+L+ + E   S++ +   R+E  +   +R +Q          N+  ++ IK KR+ T + + EL D +  R++ L   K  H V+  + D ++  Q I E    + + D G DL S+  L RKH+VFE EL   +  +++ L E   L +I P  +E I  K ++    W  L + T +RK KL +      Y  +  D   WI+E         L + ++  E+L+   + +   +    +   +     Q L+         V  K+  ++ +++ L    +K +E     L     L D++ +  WI+ ++  L +    D I ++E L  R E FE  +  + EK   +  ++
Sbjct: 3097 SQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQE---------NNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVH-VYDRVADETI--QLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRIT 3582          

HSP 6 Score: 98.2117 bits (243), Expect = 9.956e-20
Identity = 152/808 (18.81%), Postives = 335/808 (41.46%), Query Frame = 1
Query: 1033 WIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTG-EKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKT-----LVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEI--LIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQT----VAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNS 3420
            W++   R++     S+   G+      F  + T     SK VE++D  V  F  + +  + ++             I+  W  LN A+  RE +L           +  + FN+     + W+++ M  L    +  +L TV A  ++H+ +E ++   E+ +  +T + ++++     +  ++   + +V D+W+++ Q   + R  +++ +      N    + A I  +  +   D   + +     LL+ H  +  DIR+ +       +E    +Q   Q      N      + E+  +     H      +K+K +L+   L   F  +A   +   K     +   +LG  L  V+ +L++H  FE     K +  ++K+++G +     L+       ++I  + N +    +A+ D    RK  L    D++++ ++ DD + W+ +  R+      GD+ ++ ++  L RK Q++       R N  Q+RN  +   G ++V        V  ++  + K+++DLL ++     KL  A +        +  +  + E    L +    +D+   + L ++ ++ ESE+T   +KV  + +  +++   G+ N Q I      L   +  + D    +R +L    +Y  F  +     +WI E +   +S +ELG++L       ++   ++ +I   +  I+  +  G  ++       + +E     + Q W+ L++   +R   L       +++    +  +WLG+    + S      +  A KL+ K+ +
Sbjct:  993 WMKEKERMIK----SDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQ-------RQIHQIWQRLNNAKAQREKSLEGA--------SSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHD-------TEFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDAIHR--GWAEKQKWLLQCVDL-QMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFE-----KSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRI-----AGDE-NYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKD--GQALVQAGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKS-NELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKT 1757          

HSP 7 Score: 60.8474 bits (146), Expect = 2.363e-8
Identity = 175/929 (18.84%), Postives = 384/929 (41.33%), Query Frame = 1
Query: 2263 IQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLF---DLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDS-DSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVN-NQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEI------LRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNN-KSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHS-----ELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNR--SKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKE 4992
            I   ++ L +  + R   L + +  + +  +CDD E W+ E +R+    + + + +     E  I       + VE     ++  R Q  S L   I   + + +   R        L+ A   +EK L+  +   L N + D  + W++EK   L   + + D+  ++ L+ R +  E EL    +KV  V  L  N V N  P  +  VN  Q  + + W ++       R+ + S+     F    +  + WI + +K   + DE   D+E+     ++ N +  DI A + +   ++  G ++      +   +   + ++ + D +H+ W        ++   L    D+  F ++ D         +  +   N+  S  E E ++ ++      + A ++ L+ +       + ++    +++   +R   +    K + D + E+++ L+       F  +A  +        K  ++D   +  + N    +L +L   + +++ F  ++ ++E  L  V K G+ L+   N   + ++++  +L++RWK     ++++  KL++     E  + ++D    + E    L    + N+ +S    + + + LE EI  +   + EL   G    A   HF  +      N+ +   EL +  ++ L++     R KL E        +  + E Q + +  P    + +    +Q + L   + +LE + K  + + + +      L+ QQ+P++  + E L  Q++     L      +    +  + A+Q+L D  +   W+ E+ +++R+    +  ++   LL       +HK+++ E+   S  V  +      M+  NH    ++      ++K  ++L++   + Q  L   L   E+ L+  EV  WI E+E
Sbjct:  956 INQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKSDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQR--------LNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLG-NSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWI-DSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDAIHRGWA-------EKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYI--GDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDL--------KVWLQDKTRIAGDENY--RDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPE-VESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDM-AHGGHFNAQ------NIEAGTKELQQRFKD-LRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPER-EQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLL------TKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQE 1839          

HSP 8 Score: 60.8474 bits (146), Expect = 2.383e-8
Identity = 120/596 (20.13%), Postives = 248/596 (41.61%), Query Frame = 1
Query: 4489 QNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTL-LQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEE-------FKKSCVSLPDEYKGIVKDVEDNFNSLKIICAEKKTEISLFV---IYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQ-------GKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWD-LHRWYCDSQ-FLLECIQEKKSSMEV---------------VNDLGKDPKSVSLLQRKLKNFEKDLLKLD------SDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDK-RDIL 6150
            +N D   K +Q   ++  T D L    + + ++    I    F ++CDD   WM EK  +I  +S + E +     +F++      +    +      VD+  ++    +D+       ++    Q+ +  + LN    + +  L    +V+ F     E   W+SEK L L   VI + D + ++ + R+ QNLE E+     K+          K +  +  D      ++V+D +  ++   ++ +  I   V   ++ ++ ++   + AWI        +D+S +D++    L  +        N +G   +   +  F E+IQ       GK   A +++V                   I+ LK+  D +HR + + Q +LL+C+  +  + E                 N+LG     V  + ++  +FEK L+  D      SD  + +  ++     Y  D+   ++ KR+ + D     +++L+  K       DFH F +   +L  W+++ T ++      RD+S +   L  H++ + E+ + E         G+ L++  + R PE++S+  ++  + +D+L
Sbjct:  944 ENADSVEKRQQ---RINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMI--KSDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDK-------IIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVI-TPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKV---LLAWIDSVKDQLNADESARDVETANNLLKKH-------NDLGDD-IRAHDTEFVEVIQLGKQLSDGKPNMAETVAV-------------------IERLKAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASK-------DFHKFAAEADDLKVWLQDKT-RIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESRVADLNKRWKDLL 1487          

HSP 9 Score: 57.3806 bits (137), Expect = 2.236e-7
Identity = 52/188 (27.66%), Postives = 89/188 (47.34%), Query Frame = 1
Query: 5251 ELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSE--TNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVN--DLGKD-PKSVSLLQR------KLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKE 5781
            E Y N E+W+V++ +I ++  + KDL     L+ +      E  + K  S +++ A KR   LI  +HP +  I    D + E W  L  L++ R + L+ A + +++Y D+      + EK   + +VN  D G D P + +LLQR      +L  +  D+L L+   +  I      L L   + E
Sbjct:  612 EDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKR---LIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEK---IALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLELSAAEPE 793          
BLAST of Spectrin beta chain vs. Ensembl Fly
Match: kst (gene:FBgn0004167 transcript:FBtr0300017)

HSP 1 Score: 518.85 bits (1335), Expect = 6.317e-148
Identity = 367/1170 (31.37%), Postives = 585/1170 (50.00%), Query Frame = 1
Query:  181 ANVTSK----VFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFD---EDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSC--NRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLL--GYSIVDHQTVAKKLDRIE--------------------------KKYQDLLDIAH-------KMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNG---------------------------NPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIG 3477
            AN+T +     FE  RIK L +ER ++QKKTFTKW+NS LI   M++EDL+ DL DG  LL LLE++S+E + KP  GRMR+H +ENV+K L FL   KV LE++GA DIVDGNPRL LGLIWTIILRFQ+Q+I+ D   E+ S   +SAKDALLLWCQ KT GYP VNI +FTNSWR+GLGF ALIH HRPDL ++S+   ++N N++NL+ AFD A N LGIPSLLD ED++   PDE+S++TYVASYYH F  +K      KR+  ++ Q+++ ++    Y+ L + LL WIR     L  R   NS+ GIQ+++  F  YRT EKP K+ E+ ++E L FTI +         YNP +   ++ I  AW  L  AE+ RE ALR EL+RQEKL  L  KF KK+ LRE ++    E++Q  S    L  V A LKKHEAI  DI A  E    LT +++ L+ E Y+    +   + +V+  W++LL+ L  +R +L     +  L+ E       +  +  +   ++ G HL+ VEELL++H L E  + +  + L++   +A  Y     +D          A++ ++     + + ELL     R+  L+ +     F+ D   EE W+ +   I        DL +V  L +KHK  E E+ S++         GK L+         I ++ + +   W+AL    E R+ +L +  + YQ+ +D ++AE W++E   L + +  G+     + L+++++     +  Y  +I  +  QA  L+  G   ++      +L  +E                          KK  +   + H       + Q   +D   V  LL    +   W   K   +  F+P++ + E+E          + +  +AEKV  +  + + ++V                             N N   +   Q  +N +++++ ++   +   L    H   F+ +C    +W++EK ++I+S     ++ E V   +R+      D+ A   +++ +    D   R        I  +   +HQ W+ L      R+ +L   + +  F +  D+   W+ +   ++ +  I       + L  ++ +   E+A +E ++     +G
Sbjct:   50 ANMTQRDGIIKFENERIKTLQEERLHIQKKTFTKWMNSFLIKAKMEVEDLFTDLADGIKLLKLLEIISSEKLGKPNSGRMRVHKIENVNKSLAFLHT-KVRLESIGAEDIVDGNPRLILGLIWTIILRFQIQEIEIDVDEENESSEKRSAKDALLLWCQRKTHGYPGVNITDFTNSWRSGLGFNALIHSHRPDLFEYSTIVNSKNSNLDNLNHAFDTAANELGIPSLLDAEDIDSARPDEKSILTYVASYYHTFARMKNEQKSGKRIANIVGQLMDADRKKMQYEGLTTNLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLK---EMIQVLSDPRYLRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKD---------AALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLELSAAEPELPEVEQEEWVNETRLVPKEVWEDEWVEKLEHKKVTETKMLPHVKSLFPFEGQGMKMDKGEVM-LLKSKTNDDWWCVRKDNGVEGFVPANYVREVEPRP------VACIVPKAEKVKSLQKVKKTILVRQVVPVKRIKPVSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKS-----DEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLG 1194          

HSP 2 Score: 331.643 bits (849), Expect = 2.092e-90
Identity = 459/2016 (22.77%), Postives = 884/2016 (43.85%), Query Frame = 1
Query: 1426 QSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYV-QFCDQDFRSNINSGNKAM--IKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFE--LELSSKRISL----ENKLMEGKTL--VDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEIL--------IRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGN--PNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKID-HLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLK--SEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLK---QGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSEL---LKQQNPD--KASKYEQLETQVKVTM-----DGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNM-------LSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLPD----EYKGIVK---DVEDNFNSLKIICAEKKTEIS----LFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELAD-FHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEI---------RSKKLNTDRQFINEALINIEQ------TAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTG---YFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAIN-SASRPMRQVNPSNTNPSTTQSHPNLSSSLP 7248
            Q LG +L + LA L+KHE  E D+ A E  L  L + S  L+ +  ++  +I   ++KV+  W  L +    R + L     + T + +  ++ +  + + A  + + +         L   H+ I  +I +   +         RY+ +  D    S + +G+ A   ++EK  + + +  +L  + +K+K +L+    ++ F+ DA   +         +++ D G  +  V   +RKH  FE  ++   +++SL      KL+E +     +I  + Q  +A +        + + D    R+ KL + L Y ++V DC +A+ WI+E ++    K   D  S+ E+         ++K+Q     V   +  I++I++    LL         + + ++ + + +Q LL    +    L +A       +  D + +WI +K+  +       D+E    L  + +  +S++    ++V H+N L++ L+       + Q +   + + N +W ++   +++ R  L        F  D   T + I EK   + S D  G DL +V    RR   ++RD+ A++ KID H  A    I ++  R A+ IE +L+ +H+ W  LQ L   R S L      H+F+  + +   W+  M  +M +   P + ++ E  +  +  ++ E+   ++      + G+   K   +Q  D   +    +E ++Q    LN+   E+ + L +  +  +F     Q+E  L  +E +L  D   L +++   +  L   +E   E  +  D + + +K    +L+   +   LI E   Y  R + K   L E           RK +L +   L E L+ + ++D  L++K+QV  + +     +  S + +  A + E+ +  P ++ +   G++        K EI   +  L   W +L  A + K   L        F  S      W+  +E Q+ ++D        + +++N LKK +          +L  ++  H EL   LKQ++    +A  + + E   + T+     + L  PL  +       +  +QFL+D +DE+ W+ EK  L+   S+ + T  +LL  Q LQ +H S++ E+ ++   + +L+Q  Q+MI +NH           QL+   E L +++ + +++       L + +  Q F ++ +E  +W+ EK   ++      +D+  ++   +K + L+ E+  + P IE+  K    L +    +   I +    V   +  L  +  E+++ +     LF    +T EL++    W+ ++  +  S+D G+D++    L   F  F S  N    ++V    +R D LIQ  +P+  SI   +D   ++W +L +L+  R   L  A  +H +   +   ++ I EK +S+ +  D G+D +S+  L RK + FE +L+ +   +++ +  +  L  +Y   KE   +K R E ++A+  L++    RK N L  A+   ++    R+L+ WI E+  ++        V+G ELLLA+ +    E+ +++E F+     G+ L++ KH  + E++ K K +  + ++L        +   L ++   + +DA   E W+ S+E  L +  LG ++ +   LL++   F+K    QEEKF+ +KR+T +E          +  KL    +   E L  ++Q        E    E      +N  + E  PI   P     Q     +   S +       D       QK +S         + SA + V +  +S + QP    +     +          +      +PP E+  +G L RKH  ++  +KA  R+W   + +L    + FFKDE  F ++         P+ +       A DY K+  VFR++  +G+E+LF+  S+  +  WV  I+  AS P     P+    S  +S    SSS P
Sbjct: 2001 QELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKF--------RYLNELSD----SMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARR--------QKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQK----KLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTD-TGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQ---TLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNND--DLGDSYTAVERLLKKHDEF--EKLLHADHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSE----------ERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYG----KDLAAVSNLLKKHE----------RLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEK-QLVAG-SQDLGT--SLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHF-------ASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKR-PVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHE----WVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLN-ANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASL-ISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVK-RDETVEAWTDLKEKTAARK-NKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQLFRHQLEQEKISKLQEKERLEKERLEQLKQRELQRLADERRRAEKQHEHRQNAASQEKTPIFSSPMVTPAQTSGPQSPALSQVQLRPPFGDDNEHLALQKSSSSGMFGDRLRRGSADANVKRA-ESMKVQPKQAKRTPSFTTRRRAQSFRKNQKGEGFDLPPVEI--QGSLERKHGLQSGGKKAPVRSWKQFHTVLCGQLVCFFKDENDFLQQKTAT----APVNILGAKCERADDYTKKKYVFRLKLPDGSEFLFEAPSLDILNDWVRKISFHASLP-----PNMQLLSYDESMKQQSSSSP 3928          

HSP 3 Score: 226.868 bits (577), Expect = 1.370e-58
Identity = 274/1295 (21.16%), Postives = 587/1295 (45.33%), Query Frame = 1
Query: 2557 TVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHN----WLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFV----RLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGK---QTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXD---HSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQN-IEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLK 6375
            +V K+  RI + Y +L ++A K    L D++ ++    + D    W+ EK++     I SD+ E ++  K +FE F ++L+  +++V  ++   +     G+     I+  Q  ++  W ++ +    +   L        F   C +   W+ EK+  +++   +  DL +V   QRR  +++R++  +E K++ +   G+ + ++   + KD    ++   QE + + Q ++ R S L N+ +     Q  ++       W+  ++ ++ +         A  L+ K+N   D++ A + +  E +++GK     + +  + V    RL+   ++I++ W        EK+K L + +   MF  +A +I+    + E +L          +N   ++L  +  I+  +  F   +++ +K+L         LI  ++     + ++   +  + K     A  RK  L+     H+   + DDL   L +K ++  + +  +  +    L + +A E E+ A    +  + K G+   Q     P  +  + D    LN  W +L    E+K + L     ++    S +   K +  ++  + + D  +  RS    + N+ + L+S     + K   L +  D   H      QN +  +K  +L+ + K   D    P + + +   + +   +F+ + D E  W+NE +      +K  E    L Q Q L  +HK ++ EI+     ++  +   Q +I + H +R  V     QL++  ++L     +    L   L  Q++L D  E+ SW+ E+  +++      +D     +++ K + +E+E+  Y   + E   SC ++     PD      K   +E    SL  + ++++  + +  +Y   Y L  + +E WI E+ + A S+D G+D +   LL+++F        ++G+ +V++      +LI  + P+A+ +   ++++   W +LL+L++ R Q L +A ++HR++ D    L  IQ+K +++    +LG+D  S   L RK + FE DL+ L++ +   +  S  L   Y  +  A + +++ +++ A+  L++    R       +D   FL+ VR+++ W   +   ++      D +G   L   H ++  E++++E+ F     L  ++++T H  + +++ KC  + D+R  L   W      L   ++++ + RDA   +    SQ++ L++ + G T+++    ++K   F++    QEEK   L+
Sbjct:  999 SVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERM----IKSDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTA-VITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSV-KNAYPAEKD---NVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDAIHRGW-------AEKQKWLLQCVDLQMFNREADKIDATTKSHEAFL---------EYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPEVESRVAD----LNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRS-CKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTK--ELQQRFKDLRD----PTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPA----AKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERN-NVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRL-MESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRV-EVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALS--QELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASA-IAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQ 2247          

HSP 4 Score: 150.214 bits (378), Expect = 2.009e-35
Identity = 157/726 (21.63%), Postives = 325/726 (44.77%), Query Frame = 1
Query: 1297 GRETALRKELMRQEKLRNLAQKFNKKAALRES---WITDNMELLQKQSLGN--NLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDL---WKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLG-DKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAME 3447
            G+  A++     +++L   ++ F+K AA  +    W+ D   +   ++  +  NLP     L+KH+A E ++ A E  L  +TK    L +   N +  +   +++V DL   WK LL    ++   L+             + +  +  + +  R  + G  L   ++L+   +++ES+I   +Q++ +L+S  +        + + NI +G K + +         F +L D   +R+  L+ S    +F+ +   E QWI E +    + +LG +L     L +KHK  E E+   +  +   L+ G++L+      +E + +    ++  W+ L      R  KL   L   QY+ D  + E W+ E   +      G D+ S  ++L +     +E+ + Y   + ++ +   +++  +  D + +A K   IEK  + L  +A + Q +L+++L  +    +SD V  WI E+++   +     D E L++L+++F+  +  +   A++V     L++ L+ + +P    +   Q+ L  SW  +  +++ +  +L +      F  D  + +  I++K   +    ELG DL S +   R+    + D+ A+EA++  LV     +      +A  I  Q D V   W  L++    R   LA  +D+  F+  + D  +W   ++  + ++      + A  L  ++++   E+ A E
Sbjct: 1428 GKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPR---KLQKHQAFERELRANEGQLRNVTKDGQALVQ-AGNRVPEV---ESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQ-NIEAGTKELQQR--------FKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELEL-DTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQ--ELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEARE 2134          

HSP 5 Score: 112.079 bits (279), Expect = 6.474e-24
Identity = 114/498 (22.89%), Postives = 223/498 (44.78%), Query Frame = 1
Query: 1354 AQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEIL---KHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLS 2838
            +Q F  +A   ++W+ +   +L     G +  +V    KK E ++ ++ A++ ++  + K++  L E  + D  +I     +V   ++ LL+   ER   L    +++  + E  E+   +    A    ++YG+ +  VE+L+ + E   S++ +   R+E  +   +R +Q          N+  ++ IK KR+ T + + EL D +  R++ L   K  H V+  + D ++  Q I E    + + D G DL S+  L RKH+VFE EL   +  +++ L E   L +I P  +E I  K ++    W  L + T +RK KL +      Y  +  D   WI+E         L + ++  E+L+   + +   +    +   +     Q L+         V  K+  ++ +++ L    +K +E     L     L D++ +  WI+ ++  L +    D I ++E L  R E FE  +  + EK   +  ++
Sbjct: 3148 SQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQE---------NNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVH-VYDRVADETI--QLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRIT 3633          

HSP 6 Score: 98.2117 bits (243), Expect = 1.267e-19
Identity = 152/808 (18.81%), Postives = 335/808 (41.46%), Query Frame = 1
Query: 1033 WIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTG-EKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKT-----LVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEI--LIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQT----VAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNS 3420
            W++   R++     S+   G+      F  + T     SK VE++D  V  F  + +  + ++             I+  W  LN A+  RE +L           +  + FN+     + W+++ M  L    +  +L TV A  ++H+ +E ++   E+ +  +T + ++++     +  ++   + +V D+W+++ Q   + R  +++ +      N    + A I  +  +   D   + +     LL+ H  +  DIR+ +       +E    +Q   Q      N      + E+  +     H      +K+K +L+   L   F  +A   +   K     +   +LG  L  V+ +L++H  FE     K +  ++K+++G +     L+       ++I  + N +    +A+ D    RK  L    D++++ ++ DD + W+ +  R+      GD+ ++ ++  L RK Q++       R N  Q+RN  +   G ++V        V  ++  + K+++DLL ++     KL  A +        +  +  + E    L +    +D+   + L ++ ++ ESE+T   +KV  + +  +++   G+ N Q I      L   +  + D    +R +L    +Y  F  +     +WI E +   +S +ELG++L       ++   ++ +I   +  I+  +  G  ++       + +E     + Q W+ L++   +R   L       +++    +  +WLG+    + S      +  A KL+ K+ +
Sbjct: 1044 WMKEKERMIK----SDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQ-------RQIHQIWQRLNNAKAQREKSLEGA--------SSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHD-------TEFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDAIHR--GWAEKQKWLLQCVDL-QMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFE-----KSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRI-----AGDE-NYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKD--GQALVQAGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKS-NELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKT 1808          

HSP 7 Score: 61.6178 bits (148), Expect = 1.264e-8
Identity = 118/591 (19.97%), Postives = 246/591 (41.62%), Query Frame = 1
Query: 4504 ASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTL-LQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEE-------FKKSCVSLPDEYKGIVKDVEDNFNSLKIICAEKKTEISLFV---IYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQ-------GKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWD-LHRWYCDSQ-FLLECIQEKKSSMEV---------------VNDLGKDPKSVSLLQRKLKNFEKDLLKLD------SDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDK-RDIL 6150
            A   E+ + ++  T D L    + + ++    I    F ++CDD   WM EK  +I  +S + E +     +F++      +    +      VD+  ++    +D+       ++    Q+ +  + LN    + +  L    +V+ F     E   W+SEK L L   VI + D + ++ + R+ QNLE E+     K+          K +  +  D      ++V+D +  ++   ++ +  I   V   ++ ++ ++   + AWI        +D+S +D++    L  +        N +G   +   +  F E+IQ       GK   A +++V                   I+ LK+  D +HR + + Q +LL+C+  +  + E                 N+LG     V  + ++  +FEK L+  D      SD  + +  ++     Y  D+   ++ KR+ + D     +++L+  K       DFH F +   +L  W+++ T ++      RD+S +   L  H++ + E+ + E         G+ L++  + R PE++S+  ++  + +D+L
Sbjct:  997 ADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMI--KSDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDK-------IIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVI-TPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKV---LLAWIDSVKDQLNADESARDVETANNLLKKH-------NDLGDD-IRAHDTEFVEVIQLGKQLSDGKPNMAETVAV-------------------IERLKAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASK-------DFHKFAAEADDLKVWLQDKT-RIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESRVADLNKRWKDLL 1538          

HSP 8 Score: 61.2326 bits (147), Expect = 1.939e-8
Identity = 175/929 (18.84%), Postives = 384/929 (41.33%), Query Frame = 1
Query: 2263 IQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLF---DLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDS-DSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVN-NQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEI------LRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNN-KSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHS-----ELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNR--SKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKE 4992
            I   ++ L +  + R   L + +  + +  +CDD E W+ E +R+    + + + +     E  I       + VE     ++  R Q  S L   I   + + +   R        L+ A   +EK L+  +   L N + D  + W++EK   L   + + D+  ++ L+ R +  E EL    +KV  V  L  N V N  P  +  VN  Q  + + W ++       R+ + S+     F    +  + WI + +K   + DE   D+E+     ++ N +  DI A + +   ++  G ++      +   +   + ++ + D +H+ W        ++   L    D+  F ++ D         +  +   N+  S  E E ++ ++      + A ++ L+ +       + ++    +++   +R   +    K + D + E+++ L+       F  +A  +        K  ++D   +  + N    +L +L   + +++ F  ++ ++E  L  V K G+ L+   N   + ++++  +L++RWK     ++++  KL++     E  + ++D    + E    L    + N+ +S    + + + LE EI  +   + EL   G    A   HF  +      N+ +   EL +  ++ L++     R KL E        +  + E Q + +  P    + +    +Q + L   + +LE + K  + + + +      L+ QQ+P++  + E L  Q++     L      +    +  + A+Q+L D  +   W+ E+ +++R+    +  ++   LL       +HK+++ E+   S  V  +      M+  NH    ++      ++K  ++L++   + Q  L   L   E+ L+  EV  WI E+E
Sbjct: 1007 INQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKSDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQR--------LNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLG-NSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWI-DSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDAIHRGWA-------EKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYI--GDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDL--------KVWLQDKTRIAGDENY--RDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPE-VESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDM-AHGGHFNAQ------NIEAGTKELQQRFKD-LRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPER-EQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLL------TKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQE 1890          

HSP 9 Score: 57.7658 bits (138), Expect = 2.045e-7
Identity = 52/188 (27.66%), Postives = 89/188 (47.34%), Query Frame = 1
Query: 5251 ELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSE--TNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVN--DLGKD-PKSVSLLQR------KLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKE 5781
            E Y N E+W+V++ +I ++  + KDL     L+ +      E  + K  S +++ A KR   LI  +HP +  I    D + E W  L  L++ R + L+ A + +++Y D+      + EK   + +VN  D G D P + +LLQR      +L  +  D+L L+   +  I      L L   + E
Sbjct:  663 EDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKR---LIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEK---IALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLELSAAEPE 844          
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Match: sptbn1 (spectrin, beta, non-erythrocytic 1 [Source:ZFIN;Acc:ZDB-GENE-031006-3])

HSP 1 Score: 1285.4 bits (3325), Expect = 0.000e+0
Identity = 803/2341 (34.30%), Postives = 1314/2341 (56.13%), Query Frame = 1
Query:  322 VDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLS-----IANQKIIAEQFLQDCDDEIDWMNEKIDLIR--NRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PD-EYKGIVKD-VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSA-----------SRPMRQVNPSNTNPSTTQSHPNLSSSLPP 7251
            +DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   +SAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+SVITYV +YYHYF+ +KA  V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +L  V AA KKHEAIETDI AYEE +  +  ++  LE E Y+DI  I   K+ VL LW+ LL+ L  RR+ L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI     R++ + + A R+    D++        +  +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+   RLL +H+  E E+S +   L++ + EG+ + D    G+  I  +  D+Q  W AL      RK +L E    +Q+ +D DD + W  +  R+     +G     T+ L++K++     V +YR  I+ +  QAQ+L      +   V+++L  IE++Y+++ ++    ++ L DAL +Y++ +++D+   WI EK+++L +    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ +G+P+ + I   QD LN  W++  D+VD K++ L S     N+ +DC +T  WIREK K+IES  ELG DL  VM  QR++  M+RD+ AIEAK+  L  + D +   +   AK I  +L  +   WE +++ +R R+ +L   + + +F+++LDDF +WL + QT +AS+++P + +EAEKL+ ++   ++E+   E+  ++   +G + +  +Q   Q++ L+ R+++++  W  L+ + E ++  L +     +F  D +Q E  LN QE  L               + L      + + E F+  M ++E  +  V++ G+ L  + N+  DR+Q +  ++D+R KKN  AA     +LK+   L + LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K GKQ  ++ P  +  + + L  L   W EL    + K Q L   N+ +LF +S   + KWL  +EGQI +DD        +TS+   LKK      ++E +++ +E L+  + +L+Q+  D     ++++ + KV        L+  L      +A+++I   QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    + D + + +Q ++  +      +   ++ L+     + +E EK  + L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+   L     P+ E  G+ +  V+  +  LK +  E++ ++       + + L+Q      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N+  DELI   H  A +++ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +L  I +K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + ++  E+++A+RSL +  E R+   L+  D   F SMVR+L+ W+E+V   +E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++TDKR  +  KW +  + L L++EV+Q++RDA  AEAW++ QE YL++  LG ++DE   L+K+            E FE  K   T E R    +   +     L+ + +  E E      P  + VQ  +      R  EQ  QN          L  D +    G   ++N         P     SP+P     +R + S                 ++  P   +  P  +  ++G L+RKH+WE  N+KAS+R+WH++Y +++   M F+KD ++  +     Y +E+P+ L E V   A DY K+  VF++R  +G EYLFQ     +M  W+ AI +A           + P  Q  P+++   T  +  +++S   P
Sbjct:    1 MDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKRSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVAVARELETENYHDIKRITARKDNVLRLWEYLLELLKARRQRLEMNLSLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRVKAVNNNAQRFA--VDEE---GYKPCDPQVIRDRVAHMEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDCGKDLTGAVRLLSQHRALEDEMSGRSGHLQHTVREGQAMADAGHFGEAKIRERIADVQAQWAALEQLASVRKTRLEEACSLHQFQADADDVDTWTLDALRIVSTADVGHDEFSTQALVKKHKDASTEVASYRPVIDALHEQAQTLPPEQ-ANSANVSERLAGIEERYKEVSELTRLRKQALQDALALYKMFSEADACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLRGEADRLAGEHPDQAKAITGRLAEITAVWEEMKETLRTREESLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEINNYEEDYQKMRDMG-EMVTQDQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQIFLRDTKQAEAFLNNQEYVLA---------HTEMPTTLEGAEAAIKKQEDFMTTMDANEDKINGVVEAGRRLASDGNINADRIQERAASIDDRHKKNREAAVELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKEGKQLVSEKPETEAVVKEKLAALQKMWTELETTTQTKAQCLFDANKAELFTQSCADLDKWLVGLEGQIQSDDYG----KDLTSVNILLKKQQMLENQVEVRQREVEELQSQAHVLRQEGKDT----DEVDGRRKVVEQKFQELLDPLLKRKNFLMASREI--HQFNRDVEDEILWVEERMPLATSTDHGNNLQTVQLLIK------KNQTLQKEIQGHQPRCDDIFERSQSILKADSPNVEGIRTRLSDLQGLWSLIMQETEKRHSRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEE-KAKDEQSSVAMLKKHQILEQAVEDYAETVHQLSKTSRGLVAANHPESERIGMRQSQVDKLYAGLKDLSEERRGKLE------ERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDGVNRMADELINAGHADAATVAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEILGRILDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQDDAVRLQSAYAGDKADDIQRREGEVLEAWRSLLEACEGRRARLLDTGDKFRFFSMVRDLMLWMEDVIRLIETQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTDKRKDMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSRELGQSVDEVEKLIKRH-----------EAFE--KSAATWEER---FSALERLTTLELLEVRRLQEEEERRRKPPSPDPVQA-QDGETQQREGEQIAQN---------GLPSDQDSPRDGVDGEMNGVAERSSKEP-----SPIPSPGADRRGKGSQ----------------SATLPTKGQETPSAQ--LEGFLHRKHEWEGHNKKASSRSWHNVYCVINNHEMGFYKDNKNAGQGIP--YHNEIPISLKEAVCEVAVDYKKKKHVFKLRVTDGNEYLFQAKDDEEMNTWIQAIQNAGSGSSSSEKSETAPSNQSTPASSRAHTLPATVSMTSESSP 2249          
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Match: sptbn2 (spectrin, beta, non-erythrocytic 2 [Source:ZFIN;Acc:ZDB-GENE-030131-787])

HSP 1 Score: 1223.38 bits (3164), Expect = 0.000e+0
Identity = 731/2096 (34.88%), Postives = 1203/2096 (57.40%), Query Frame = 1
Query:  154 LSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXD-HSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKII----AEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRM-----IDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTM 6390
            ++ E E    N ++++FERSRIKALADERE VQKKTFTKW+NS L  VT +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  QKVHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VN+ NFT SWR GL F A++HKHR DLIDF +  R++   NL  AF++AE  LG+  LLDPEDVNV  PDE+S+ITYVA+YYHYF+ +KA +V  KR+ K+L+  +E +Q+I+ Y++L S+LL+WI  TI  LN RQ +NS+  +Q Q+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA +F++KAA+RE+W+++N  L+ + + G  L  V AA +KHEAIETDI AY E +  +  ++  LE E Y+++  ++  ++ VL LW+ L + L  RRE L  +  +  L+ E   +   +  + ++ +  + GKHL +VE+LL+ H L+E+DI +  +R++ + + A R+    +Q ++      + A+++EK +   + + EL      R+  L  S  +WQF+ +   E  WI+E   I++  D G DLSS   LL KH+ F  E++++   L N +  G+ LV    VG   +  +  D++  W  L ++++ R+  L E + ++Q+ +D +D E WI E  R    + +G     T+ L RK ++  E ++++R  I+ +  Q  SLL  +      V  +L  IE++Y++L  ++   ++ L  AL +YR+ +++ + + W+ EK+++L N      +E+LEV++ RF+  E E+     ++  VN +++ L+ + N N   I   Q+ LNN W+    + + ++  L S  +  N+ ++C +   W++EK K+IES   LG DL  VM  QR++  M+RD+ AI+ K+D L ++  +++  +    ++I+ QL  + + WE L+  ++ R+ +L   + +  F++ LDDF  WL + QT +AS++ P S +EAE+L+ ++ + ++E+   ++  E+    G +  + + D  Q + L  R+++++  W  L  + E +   L +         DA+Q E  LN+QE  L         +     S+L    E + ++E F+  M + E+ +  V++ G+ L+ + N Y D++Q K  ++ ER +KN  AA     KLK+   L   LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  +++++K G+    + P  ++ + + L  L   W EL    + K Q L   NR +LF +S  ++  WL+NI  Q+ +DD        +TS+   LKK   H M         + ++   S+ L     D  S   +++ + +   D  S  L+  L    Q ++    A QF +D +DEI W+ E++ L  +     +    L   Q L  ++++++ EI+    ++D +      M      + +  +RA +   + +L++    L  E E+    L+     Q+F  D +E  +W+ E+EL +M     +KD+Q    +++K Q LE  +++Y   I +   S   +     P+  +  ++   V+  +  LK +  E++ ++   +          ++E WI ER  +A S + G+D +  T+LRD+F  F+ +T+ IG  +V+  N + DELI+  HP   S++ WKD +NE WADLLELIDTR Q+L ++++LHR++ D++  L  I+EKK ++    +LG+D  +V    R+   +E D+  L   +      +  L   Y  +K   + +  + + +A+  L+   + R+L  L+  +   FL+MVR+L+ W+E + +Q++    PRDVS   L++ANH+ +K E++++ ++F+ C  +GRTL+   H  S EI+ K  ++  KR  + QKW   +DHL +++EV Q+ RDA+ AE+W+  QE  +    LG  +DE  +L+K+   F+K     E++F QL++LTT+
Sbjct:   27 IAAETEWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLGRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRSDLIDFDNLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIEKYETLASELLQWIEQTIVTLNDRQLANSLSAVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGVELGAVEAATRKHEAIETDIQAYGERVAAVEAVARELEAEGYHEVRRVLARRDNVLRLWEYLKELLAARRERLMAHRDLQRLLQELSYIMEWMEDMKSRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVKAVQATAKRFAS-NEQSYKPC----DPALVEEKVDLLGRAYGELGQLAADRRVRLDDSRRLWQFLWELGEEAAWIREQEQIISGGDYGKDLSSALHLLSKHEAFRDEMAARYGPLGNSIAGGEALVKEGHVGAPEVTERIKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQG-SLLPEAYAHSPQVEGRLPAIEQRYEELEGLSSSWRQALDGALALYRMFSEASACQLWVGEKEQWLHNMEIPTKLEDLEVIQQRFDTLEPEMNTLGGRISDVNQVAQQLLGSDNRNKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSEHPEQEEEIKGQLAEIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTVASEDTPTSLAEAERLLAQHEAIKNEVDNYKEDYEKMRATGAEVTQGQTDA-QHMFLAQRLQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQEYVL---------SHTEMPSSLQGAEEAIKKHEDFLTTMEASEEKINGVVESGRRLVSDGNTYADKIQEKTDSIQERHQKNKQAANELLAKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQVLVKEKPELEQTVSETLSGLQKQWVELENTTQAKAQCLFDANRAELFTQSCSALDSWLQNISSQLQSDD----FGKDLTSVNILLKK---HQMLEHQMDVREKEVQSLQSQALALAQED--SGIVEVDGEQRRVTDRFS-QLQDPLKERRQHLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKD----LPSVQLLMKKNQTLQKEIQGHQPRIDDIQAHGTNMSPGKESEMDRERRAALDGRLAELRELWALLISETEQRNVRLAEANRAQQFYTDAAEAEAWMGEQELHMMS-EEKAKDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEERRGKLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTSTIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLAASYELHRFHQDAREALGLIREKKETL-AGAELGRDLNTVQHFLRQHTAYEHDVQALSGQVTQVQDDAARLQKAYAGEKADDIHRHERAVTEAWEGLQSATQTRRLLLLDTVEKFRFLNMVRDLMLWMEGINLQIQSHDSPRDVSSAGLVIANHQDIKSEIETRADSFTACSEMGRTLINNNHYASDEIQEKLDQLQAKRTEINQKWQEKMDHLQIVLEVLQFGRDASMAESWLAGQEPLVRAAELGSNVDEVESLIKRHEAFEKLAAGWEDRFSQLEKLTTL 2090          

HSP 2 Score: 88.5817 bits (218), Expect = 1.278e-16
Identity = 45/134 (33.58%), Postives = 73/134 (54.48%), Query Frame = 1
Query: 6841 MKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSS 7242
            M+G L RK + E+ N+K++NR+W ++Y +L +  + F+KD +         Y  E+P+ L E V   A DY KR  VF++R  +G EYLFQ     +M+ W+ AI S+     +   ++   S   + P +S S
Sbjct: 2194 MEGILCRKQEMESHNKKSANRSWQNVYCVLRKGSLGFYKDNKSASNGIP--YHGEVPISLGEAVCEVAHDYKKRKHVFKLRLGDGKEYLFQAKDEAEMSSWIRAIQSSMSSSERSPGASRGLSRAMTMPPMSPS 2325          
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Match: sptbn1 (spectrin, beta, non-erythrocytic 1 [Source:ZFIN;Acc:ZDB-GENE-031006-3])

HSP 1 Score: 1219.14 bits (3153), Expect = 0.000e+0
Identity = 729/2034 (35.84%), Postives = 1192/2034 (58.60%), Query Frame = 1
Query:  322 VDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLS-----IANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PD-EYKGIVKD-VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKF 6363
            +DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   +SAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+SVITYV +YYHYF+ +KA  V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +L  V AA KKHEAIETDI AYEE +  +  ++  LE E Y+DI  I   K+ VL LW+ LL+ L  RR+ L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI     R++ + + A R+    D++        +  +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+   RLL +H+  E E+S +   L++ + EG+ + D    G+  I  +  D+Q  W AL      RK +L E    +Q+ +D DD + W  +  R+     +G     T+ L++K++     V +YR  I+ +  QAQ+L      +   V+++L  IE++Y+++ ++    ++ L DAL +Y++ +++D+   WI EK+++L +    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ +G+P+ + I   QD LN  W++  D+VD K++ L S     N+ +DC +T  WIREK K+IES  ELG DL  VM  QR++  M+RD+ AIEAK+  L  + D +   +   AK I  +L  +   WE +++ +R R+ +L   + + +F+++LDDF +WL + QT +AS+++P + +EAEKL+ ++   ++E+   E+  ++   +G + +  +Q   Q++ L+ R+++++  W  L+ + E ++  L +     +F  D +Q E  LN QE  L               + L      + + E F+  M ++E  +  V++ G+ L  + N+  DR+Q +  ++D+R KKN  AA     +LK+   L + LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K GKQ  ++ P  +  + + L  L   W EL    + K Q L   N+ +LF +S   + KWL  +EGQI +DD        +TS+   LKK      ++E +++ +E L+  + +L+Q+  D     ++++ + KV        L+  L      +A+++I   QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    + D + + +Q ++  +      +   ++ L+     + +E EK  + L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+   L     P+ E  G+ +  V+  +  LK +  E++ ++       + + L+Q      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N+  DELI   H  A +++ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +L  I +K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + ++  E+++A+RSL +  E R+   L+  D   F SMVR+L+ W+E+V   +E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++TDKR  +  KW +  + L L++EV+Q++RDA  AEAW++ QE YL++  LG ++DE   L+K+   F+K+    EE+F
Sbjct:    1 MDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKRSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVAVARELETENYHDIKRITARKDNVLRLWEYLLELLKARRQRLEMNLSLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRVKAVNNNAQRFA--VDEE---GYKPCDPQVIRDRVAHMEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDCGKDLTGAVRLLSQHRALEDEMSGRSGHLQHTVREGQAMADAGHFGEAKIRERIADVQAQWAALEQLASVRKTRLEEACSLHQFQADADDVDTWTLDALRIVSTADVGHDEFSTQALVKKHKDASTEVASYRPVIDALHEQAQTLPPEQ-ANSANVSERLAGIEERYKEVSELTRLRKQALQDALALYKMFSEADACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLRGEADRLAGEHPDQAKAITGRLAEITAVWEEMKETLRTREESLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEINNYEEDYQKMRDMG-EMVTQDQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQIFLRDTKQAEAFLNNQEYVLA---------HTEMPTTLEGAEAAIKKQEDFMTTMDANEDKINGVVEAGRRLASDGNINADRIQERAASIDDRHKKNREAAVELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKEGKQLVSEKPETEAVVKEKLAALQKMWTELETTTQTKAQCLFDANKAELFTQSCADLDKWLVGLEGQIQSDDYG----KDLTSVNILLKKQQMLENQVEVRQREVEELQSQAHVLRQEGKDT----DEVDGRRKVVEQKFQELLDPLLKRKNFLMASREI--HQFNRDVEDEILWVEERMPLATSTDHGNNLQTVQLLIK------KNQTLQKEIQGHQPRCDDIFERSQSILKADSPNVEGIRTRLSDLQGLWSLIMQETEKRHSRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEE-KAKDEQSSVAMLKKHQILEQAVEDYAETVHQLSKTSRGLVAANHPESERIGMRQSQVDKLYAGLKDLSEERRGKLE------ERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDGVNRMADELINAGHADAATVAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEILGRILDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQDDAVRLQSAYAGDKADDIQRREGEVLEAWRSLLEACEGRRARLLDTGDKFRFFSMVRDLMLWMEDVIRLIETQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTDKRKDMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSRELGQSVDEVEKLIKRHEAFEKSAATWEERF 1993          

HSP 2 Score: 125.946 bits (315), Expect = 5.228e-28
Identity = 132/636 (20.75%), Postives = 276/636 (43.40%), Query Frame = 1
Query: 4612 QFLQDCDDEIDWMNEKIDLIRNR--SKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINS---KDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLPDEYKGI------VKDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTK-HIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQ-WARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLN----TDRQFINEALINIEQTAE 6468
            +F  +  +E  W+ EK  ++ +    K +     LL       +H+++++E+  RS  +   ++E Q M D  H   A + + +  ++     L +     +  L    ++ +F  D  +V +W     LD + +V  +    D+   + +++K ++   E+ +Y P I+   +   +LP E          +  +E+ +  +  +   +K  +   +     +      E WI E+ +   S +  + L+   +++ RF     E N   +S+V   N+   +LI   HP    I   +D++N  W+   +L+D + + L SA  +  ++ D       I+EK   +E   +LG D   V  LQRKL   E+DL  +++ + +    ++ L   +  D+   +  +  E+   +  +++ L  R+ +  E +    FL  + +   W+      +     P  ++  E LLA H  +K E+++ EE++    ++G  + + +   +   ++ + + +    + L + W N  + LS     YQ + RD   AEA++ +QE  L +  +  TL+   A +KK           +E F     +TTM+    K+N      R+  ++  IN ++  E
Sbjct:  563 KFFWEMAEEEGWIREKEQILSSDDCGKDLTGAVRLLS------QHRALEDEMSGRSGHLQHTVREGQAMADAGHFGEAKIRERIADVQAQWAALEQLASVRKTRLEEACSLHQFQADADDVDTWT----LDALRIVSTADVGHDEFSTQALVKKHKDASTEVASYRPVIDALHEQAQTLPPEQANSANVSERLAGIEERYKEVSELTRLRKQALQDALALYKMFSEADACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNN-QASRVAVVNQIARQLIHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLRGEADRLAGEH-PDQAKAITGRLAEITAVWEEMKETLRTREESLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEINNYEEDYQKMRDMGEMVTQDQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLS-QSHAYQIFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKK-----------QEDF-----MTTMDANEDKINGVVEAGRRLASDGNINADRIQE 1169          
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Match: sptb (spectrin, beta, erythrocytic [Source:ZFIN;Acc:ZDB-GENE-000906-1])

HSP 1 Score: 1208.36 bits (3125), Expect = 0.000e+0
Identity = 735/2110 (34.83%), Postives = 1211/2110 (57.39%), Query Frame = 1
Query:  133 SSDYQNA--------------LSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDI-----QFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYE-QLETQ-VKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIR--NRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRM--IDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK---DVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKF 6363
            ++DY NA              LSDE E+   N ++++FERSRIKALADERE VQKKTFTKW+NS L  V+ +I DLY+DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  QKVHLEN+G+HDIVDGN RL LGLIWTIILRFQ+QDI     Q D+      +SAKDALLLWCQMKTAGYP++NI NFT SW+ G+ F ALIHKHRPDL+D+ +  R++  +NL  AF++AE  LG+  LLDPEDV    PDE+S+ITYV ++YHYF+ +KA +V  KR+ K+L+Q +E E+MI+ Y++L S LL WI  TI +LN R+ +NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AEY RE  LR EL+RQEKL  +A++F++KAA+RE+W+ +N  L+ + + G +LP V AA KKH+AIETDI AYEE +  L  +S  LE E Y+D   I   K+ +L LW  L + L  RR  LD  L +  +  E   + + +  +  +    ++GKHL+EVE+LL+ H L+E+DI    +R++   + A   ++F + D   +    +  +I+++       + EL     +RK  L+ S  +W F+ + +  E WI+E   I ++ D G DL+SV  L  KH VFE EL+++R +L+  + EG++++ I  +G   +  + ND+Q  W+ L +    RK  L +   ++Q+  D DD + W+ +  R      +G     T+ L++K++   +        I+ +  QA + L   + +   +  +L+ I   Y +LL ++   Q+KL D + +Y + +++D+   W+ +K+ +L      +++E+LE++++R  +   E+     +V +VN  ++ L  + +P  + + + Q  LN  W     +V+ K+  + S     N+ +DC +T  WI+EK ++IES  +LG DL +V+  QR++  M+RD+ AI+ K+D L  +  ++++ +  +A DI  + + +   W+ L++ ++DR+ +L   + +  F+Q +DDF  WL + Q  +AS+++P+   EAE+L+N +++ R +M   E+        G   ++ ++D  Q+ +L+ R+E +++ W  L+ + + ++  L++ L    F  DA+Q + ILN QE  L     + ++  +T    L    + + ++E F+  M ++++ +   L+ G+ L+   NLY  ++++K  +++ER KKN   A+    KLK+   L   LQ+  DL   + EK+    + S    ++  S   + +A   E+ + +  +  ++K G++     P F+  + D L  L+  W +L    +EK + L   NR +LF++S   + KWL  ++ Q+  D E +     +TS    LKK   H +     +     L++  E ++Q    +  + E ++E Q ++     L  PL  +           QF +D  DEI W+NE++ +    +    ++T+  LL+      +++S++ EI     ++D +++  +RM    E   +   + + + +L+     L EEM K +  L      Q++  D  +  +WI E+EL ++   + +KD+Q    ++++   L+  + +Y   I++       +     PD  + I++    V+  +  LK +  ++K ++     +       +++E WI ER  +A S + G+DLD  T+LRD+F  F+ ET  +G  +V+  N+  DELI+G H  + +++ WKD +NE WADLLELIDTR QLL S++DL +++ D + L+  I+EKK+  E+  DLG+D        R    FE+D+  L   +      +  L   Y  D+   +    +E+++A++ L      R+    E AD   F +MVR+L+ W+E +  Q+E + KPRDVS +ELL+  H+ ++ E++++   F+ C+ LG+ LL  KH  S EIK K  ++ +KR  +  KW +  D L L++EV Q+ARDA+ AEAW+I+QE Y+ ++++G T+DE   LLK+   F+K+    EE+F
Sbjct:    7 TTDYDNAEITQQYSRINTRFELSDE-ELDNDNSSARLFERSRIKALADEREAVQKKTFTKWVNSILARVSCRISDLYLDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDIIVETGQADQTGRQETRSAKDALLLWCQMKTAGYPNINITNFTTSWKDGMAFNALIHKHRPDLVDYGNLKRSNPTHNLQQAFNVAEKKLGVTKLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKALAVEGKRIGKVLDQAIETEKMIEKYETLSSDLLTWIEQTIVVLNNRKLANSLTGVQQQLQAFNSYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPKEGALVSDINKAWERLEKAEYDRERVLRDELIRQEKLEQMARRFDRKAAMRETWLMENQRLVSQDNFGYDLPAVEAAKKKHDAIETDIAAYEERVQALVALSKELESERYHDAKRIDARKDNILRLWDYLQELLKARRGRLDKNLTLQRIFQEMLHIISWMDEMKGRLLSPDFGKHLLEVEDLLQKHSLVEADIAVQAERVKSANAAA---LKFANGD---SYKPCDPQVIRDRVQHLDLCYQELCALAAQRKARLEQSRRLWNFLWEIAELESWIREREQIFSSLDYGKDLTSVLILQSKHSVFEDELAARRDNLKQVMDEGESMIQIKHLGSPKVQQRMNDVQRQWQQLEELAAFRKQNLQDTQRFFQFQGDADDLKAWLVDAMRQMSSDDVGHDEYTTQRLLKKHRDLRDEAAKNGATIDALSKQANA-LPEELRNTPDIQGRLNDIRDMYIELLTLSDLRQKKLDDTMALYTIFSETDACELWMGQKETWLVGLETPENLEDLEIVQNRLSILAQEMGNMQTRVDNVNKAAKQLEDSRHPQTKQVKDCQIRLNKRWEAFKAMVEDKKHRVDSALSLHNYDLDCDETESWIKEKTRVIESTQDLGNDLAAVITIQRKLFGMERDLAAIQDKLDSLRDEAQKLVKEHPENASDILARQEELDAAWDTLKRTLKDREDSLGEVSKLQTFLQDMDDFQAWLFKSQKAVASEDMPDGLPEAEQLLNLHDALRHDMDGHEEDYHRVKDTGAAVIQGQEDDPQYQQLEQRLEGLDKGWGELHKMWDSRKNFLDQGLGFQQFMRDAKQADAILNNQEYTL-----AHVDKPDT----LDGAEKALKKHEDFVTTMDANKEKILSTLETGQRLVDSENLYSGKVKDKMSSIEERNKKNQDKAKEVSGKLKDNRELQHFLQNTQDLTLWINEKMLTAQDTSYDEARNLHSKWQKHQAFMAELASNKDWLHNIDKEGQELMESKPEFEPIVKDRLAKLHELWDKLESTTQEKARLLFDANRSELFDQSLADLKKWLAELQQQLQGDVEEE--VKDLTSANILLKK---HQITENQVRDRARELEELQEAVEQHGSLREDQPELEIEQQNLQRDFQKLLTPLSQRKGKLEAAKAVHQFFRDLADEILWVNERLPMAMSDDHGNNLQTVQLLLK------KNQSLQKEIDGHQPRIDEVLERGRRMAAAAEGSPEEERMSEEMKKLQVVWAQLQEEMAKRRERLYGSNEAQQYYNDADDSEAWIGEQELYMIADEM-AKDEQSAMIMLKRHLVLKQTVDDYAYSIQQLADRAQKMLAEEHPD-GEAIIRRQGQVDKQYAGLKELAEDRKKKLDHTYHHFLLSREVEDLEQWIAERDVVASSQEMGQDLDHVTILRDKFREFARETGTVGQERVDTVNRIIDELIEGGHSESATLAEWKDGVNESWADLLELIDTRAQLLTSSYDLLKYFYDGKELVGHIEEKKN--ELPEDLGEDFSKAESFHRMHAAFERDISSLGKQVKQFQETAARLHAQYAGDQATAIQATEKEVVEAWKGLLDACAGRRKQLEETADKFRFFTMVRDLMAWMESILQQIETQEKPRDVSSVELLMKYHQGIRAEIETRGPKFNQCVQLGQALLERKHKDSAEIKEKLMQLVEKRKEMMLKWDDRWDWLRLLLEVCQFARDASVAEAWLIAQEPYVASKDVGQTVDEVEKLLKRHEAFEKSTATWEERF 2084          

HSP 2 Score: 91.6633 bits (226), Expect = 1.176e-17
Identity = 54/171 (31.58%), Postives = 88/171 (51.46%), Query Frame = 1
Query: 6751 PVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVL----CEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPP 7251
            P  ++ V+ +   A+  P  +  + P  VLM+G L RKH+ E  N+KA NR+W++LY +L    ++ +KD + F       +  E PL L    CE++     +Y K+  VF++R  +G+EYLFQ     ++  W  AI  A++   Q+      PS  +     + SLPP
Sbjct: 2176 PSTSIQVTKETEKAASLPTESTQVQP--VLMEGTLARKHELEGPNKKAPNRSWNNLYCVLKPGHLSIYKDAKSFSHSVT--FHGEEPLTLTNSSCEILT----NYKKKKQVFKLRLGDGSEYLFQCKDEEELQNWTQAIEQAAQV--QIEEPVAGPSGVK-----ALSLPP 2331          
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Match: sptb (spectrin, beta, erythrocytic [Source:ZFIN;Acc:ZDB-GENE-000906-1])

HSP 1 Score: 1208.36 bits (3125), Expect = 0.000e+0
Identity = 735/2110 (34.83%), Postives = 1211/2110 (57.39%), Query Frame = 1
Query:  133 SSDYQNA--------------LSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDI-----QFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYE-QLETQ-VKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIR--NRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRM--IDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK---DVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKF 6363
            ++DY NA              LSDE E+   N ++++FERSRIKALADERE VQKKTFTKW+NS L  V+ +I DLY+DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  QKVHLEN+G+HDIVDGN RL LGLIWTIILRFQ+QDI     Q D+      +SAKDALLLWCQMKTAGYP++NI NFT SW+ G+ F ALIHKHRPDL+D+ +  R++  +NL  AF++AE  LG+  LLDPEDV    PDE+S+ITYV ++YHYF+ +KA +V  KR+ K+L+Q +E E+MI+ Y++L S LL WI  TI +LN R+ +NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AEY RE  LR EL+RQEKL  +A++F++KAA+RE+W+ +N  L+ + + G +LP V AA KKH+AIETDI AYEE +  L  +S  LE E Y+D   I   K+ +L LW  L + L  RR  LD  L +  +  E   + + +  +  +    ++GKHL+EVE+LL+ H L+E+DI    +R++   + A   ++F + D   +    +  +I+++       + EL     +RK  L+ S  +W F+ + +  E WI+E   I ++ D G DL+SV  L  KH VFE EL+++R +L+  + EG++++ I  +G   +  + ND+Q  W+ L +    RK  L +   ++Q+  D DD + W+ +  R      +G     T+ L++K++   +        I+ +  QA + L   + +   +  +L+ I   Y +LL ++   Q+KL D + +Y + +++D+   W+ +K+ +L      +++E+LE++++R  +   E+     +V +VN  ++ L  + +P  + + + Q  LN  W     +V+ K+  + S     N+ +DC +T  WI+EK ++IES  +LG DL +V+  QR++  M+RD+ AI+ K+D L  +  ++++ +  +A DI  + + +   W+ L++ ++DR+ +L   + +  F+Q +DDF  WL + Q  +AS+++P+   EAE+L+N +++ R +M   E+        G   ++ ++D  Q+ +L+ R+E +++ W  L+ + + ++  L++ L    F  DA+Q + ILN QE  L     + ++  +T    L    + + ++E F+  M ++++ +   L+ G+ L+   NLY  ++++K  +++ER KKN   A+    KLK+   L   LQ+  DL   + EK+    + S    ++  S   + +A   E+ + +  +  ++K G++     P F+  + D L  L+  W +L    +EK + L   NR +LF++S   + KWL  ++ Q+  D E +     +TS    LKK   H +     +     L++  E ++Q    +  + E ++E Q ++     L  PL  +           QF +D  DEI W+NE++ +    +    ++T+  LL+      +++S++ EI     ++D +++  +RM    E   +   + + + +L+     L EEM K +  L      Q++  D  +  +WI E+EL ++   + +KD+Q    ++++   L+  + +Y   I++       +     PD  + I++    V+  +  LK +  ++K ++     +       +++E WI ER  +A S + G+DLD  T+LRD+F  F+ ET  +G  +V+  N+  DELI+G H  + +++ WKD +NE WADLLELIDTR QLL S++DL +++ D + L+  I+EKK+  E+  DLG+D        R    FE+D+  L   +      +  L   Y  D+   +    +E+++A++ L      R+    E AD   F +MVR+L+ W+E +  Q+E + KPRDVS +ELL+  H+ ++ E++++   F+ C+ LG+ LL  KH  S EIK K  ++ +KR  +  KW +  D L L++EV Q+ARDA+ AEAW+I+QE Y+ ++++G T+DE   LLK+   F+K+    EE+F
Sbjct:    7 TTDYDNAEITQQYSRINTRFELSDE-ELDNDNSSARLFERSRIKALADEREAVQKKTFTKWVNSILARVSCRISDLYLDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDIIVETGQADQTGRQETRSAKDALLLWCQMKTAGYPNINITNFTTSWKDGMAFNALIHKHRPDLVDYGNLKRSNPTHNLQQAFNVAEKKLGVTKLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKALAVEGKRIGKVLDQAIETEKMIEKYETLSSDLLTWIEQTIVVLNNRKLANSLTGVQQQLQAFNSYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPKEGALVSDINKAWERLEKAEYDRERVLRDELIRQEKLEQMARRFDRKAAMRETWLMENQRLVSQDNFGYDLPAVEAAKKKHDAIETDIAAYEERVQALVALSKELESERYHDAKRIDARKDNILRLWDYLQELLKARRGRLDKNLTLQRIFQEMLHIISWMDEMKGRLLSPDFGKHLLEVEDLLQKHSLVEADIAVQAERVKSANAAA---LKFANGD---SYKPCDPQVIRDRVQHLDLCYQELCALAAQRKARLEQSRRLWNFLWEIAELESWIREREQIFSSLDYGKDLTSVLILQSKHSVFEDELAARRDNLKQVMDEGESMIQIKHLGSPKVQQRMNDVQRQWQQLEELAAFRKQNLQDTQRFFQFQGDADDLKAWLVDAMRQMSSDDVGHDEYTTQRLLKKHRDLRDEAAKNGATIDALSKQANA-LPEELRNTPDIQGRLNDIRDMYIELLTLSDLRQKKLDDTMALYTIFSETDACELWMGQKETWLVGLETPENLEDLEIVQNRLSILAQEMGNMQTRVDNVNKAAKQLEDSRHPQTKQVKDCQIRLNKRWEAFKAMVEDKKHRVDSALSLHNYDLDCDETESWIKEKTRVIESTQDLGNDLAAVITIQRKLFGMERDLAAIQDKLDSLRDEAQKLVKEHPENASDILARQEELDAAWDTLKRTLKDREDSLGEVSKLQTFLQDMDDFQAWLFKSQKAVASEDMPDGLPEAEQLLNLHDALRHDMDGHEEDYHRVKDTGAAVIQGQEDDPQYQQLEQRLEGLDKGWGELHKMWDSRKNFLDQGLGFQQFMRDAKQADAILNNQEYTL-----AHVDKPDT----LDGAEKALKKHEDFVTTMDANKEKILSTLETGQRLVDSENLYSGKVKDKMSSIEERNKKNQDKAKEVSGKLKDNRELQHFLQNTQDLTLWINEKMLTAQDTSYDEARNLHSKWQKHQAFMAELASNKDWLHNIDKEGQELMESKPEFEPIVKDRLAKLHELWDKLESTTQEKARLLFDANRSELFDQSLADLKKWLAELQQQLQGDVEEE--VKDLTSANILLKK---HQITENQVRDRARELEELQEAVEQHGSLREDQPELEIEQQNLQRDFQKLLTPLSQRKGKLEAAKAVHQFFRDLADEILWVNERLPMAMSDDHGNNLQTVQLLLK------KNQSLQKEIDGHQPRIDEVLERGRRMAAAAEGSPEEERMSEEMKKLQVVWAQLQEEMAKRRERLYGSNEAQQYYNDADDSEAWIGEQELYMIADEM-AKDEQSAMIMLKRHLVLKQTVDDYAYSIQQLADRAQKMLAEEHPD-GEAIIRRQGQVDKQYAGLKELAEDRKKKLDHTYHHFLLSREVEDLEQWIAERDVVASSQEMGQDLDHVTILRDKFREFARETGTVGQERVDTVNRIIDELIEGGHSESATLAEWKDGVNESWADLLELIDTRAQLLTSSYDLLKYFYDGKELVGHIEEKKN--ELPEDLGEDFSKAESFHRMHAAFERDISSLGKQVKQFQETAARLHAQYAGDQATAIQATEKEVVEAWKGLLDACAGRRKQLEETADKFRFFTMVRDLMAWMESILQQIETQEKPRDVSSVELLMKYHQGIRAEIETRGPKFNQCVQLGQALLERKHKDSAEIKEKLMQLVEKRKEMMLKWDDRWDWLRLLLEVCQFARDASVAEAWLIAQEPYVASKDVGQTVDEVEKLLKRHEAFEKSTATWEERF 2084          

HSP 2 Score: 91.6633 bits (226), Expect = 1.176e-17
Identity = 54/171 (31.58%), Postives = 88/171 (51.46%), Query Frame = 1
Query: 6751 PVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVL----CEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPP 7251
            P  ++ V+ +   A+  P  +  + P  VLM+G L RKH+ E  N+KA NR+W++LY +L    ++ +KD + F       +  E PL L    CE++     +Y K+  VF++R  +G+EYLFQ     ++  W  AI  A++   Q+      PS  +     + SLPP
Sbjct: 2176 PSTSIQVTKETEKAASLPTESTQVQP--VLMEGTLARKHELEGPNKKAPNRSWNNLYCVLKPGHLSIYKDAKSFSHSVT--FHGEEPLTLTNSSCEILT----NYKKKKQVFKLRLGDGSEYLFQCKDEEELQNWTQAIEQAAQV--QIEEPVAGPSGVK-----ALSLPP 2331          
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1355.12 bits (3506), Expect = 0.000e+0
Identity = 844/2400 (35.17%), Postives = 1371/2400 (57.12%), Query Frame = 1
Query:  163 EDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQN--PDKASKYEQLETQVKVTMDGLSVPL--ESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEIS----LFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFE-----------QLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQ------TFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPS-TTQSHPNLS--SSLPP 7251
            +DE    N ++++FERSRIKALADERE VQKKTFTKW+NS L  V+ +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA +V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +LP V AA KKHEAIETDI AYEE ++ +  ++  LE E Y+DI  I   K+ V+ LW+ LL+ L  RR  L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI     R+  + + A R+    +          +  +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+SV RL  KHK FE E+S +   L   + EG+ ++     G E I  +  DIQ  W  L   +  RK +L +    YQ+ +D DD + W+ +  R+     +G     T+ L++K++   E + NYR  I+ +  QA + L     +   V  +L  IE++Y++L ++A   ++ L DALT+Y++ +++D+   WI EK+++L N    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ +G+P+ + I   QD LN  W++  ++VD  +D L S     N+ ++C +T  WIREK K+IES  ELG DL  VM  QR++  M+RD+ AIEAK+  L  + +++   +   A+ I  +L  ++  WE ++  +++R+ +L   + + +F++ LDDF +WL + QT +AS+++P + +EAEKL+ ++ + ++E+   E+  ++   +G+   + + D  Q++ L+ R+++++  W  L+ + E ++  L +     +F  D +Q E  LN QE Y++   + L NN   +++        +   E F+  M + E+ +  V+  G+ L+ + N+  D+++ K  ++D R KKN   A +   +LK+   + + LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K G Q  A+ P  +  + + +  L++ W EL    + K Q L   N+ +LF +S   + KWL  +E QI +DD        +TS+   LKK      +++ +KK +E L+  ++ L Q+    D+     Q+   V+V    L  PL    K  +A+++I   QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    + D + + ++ ++D++ L    +   +  L+     L EE EK    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+  +L     P+  +  ++   V+  +  LK +  E++ ++     LF +  +      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N   D+LI   H  A +I+ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +   IQ+K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + K+  E+++A+++L    + R+L  ++  D   F SMVR+L+ W+E+V  Q+E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++T+KR  +  KW +  + L L++EV+Q++RDA+ AEAW+  QE YL++  +G ++DE   L+K+   F+K+    +E+F            +++RL   E R +K  T                     E+   ++E+        T E + I        Q++ R   + D+     +E+ +    Q+ +S++S   P P     SP    K     QP                 +A+  PA T+ +P  +   +G L+RKH+WE  N+KAS+R+WH++Y +++   M F+KD ++        Y +E+P  L E V   A DY K+  VF+++  +G EYLFQ     +M  W+ AI +A      +    T  S +TQS P  S   +LP 
Sbjct:   25 DDEWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGE-----GYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQA-AALPEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDA-QYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQE-YVLAHTE-LPNNLEAAEA-------AIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYG----KDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALSQEGKSTDEVDGQRQV---VEVRFIELLAPLNERKKYLLASKEI--HQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMK------KNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEE-KAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREV----DDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRLQEEEERKRKPPTP--------------------ELSPKLSEDGSPQQWDGTKEGEQISQNGLPSDQESPRMAENADT-----NELVNGSTEQRSSSKES--SPIP-----SPTADRKSKSGMQPQ----------------TAATLPAKTQEMPSAQ--FEGFLHRKHEWEGHNKKASSRSWHNVYCVINNQEMGFYKDSKNAASGIA--YHNEIPANLKEAVCEVATDYKKKKHVFKLKLNDGNEYLFQAKDDEEMNTWIQAITNA------ITSDKTEVSLSTQSTPASSRAQTLPA 2328          
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1352.04 bits (3498), Expect = 0.000e+0
Identity = 839/2398 (34.99%), Postives = 1362/2398 (56.80%), Query Frame = 1
Query:  163 EDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPL--ESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEIS----LFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFE-----------QLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQ------TFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPS-TTQSHPNLS--SSLPP 7251
            +DE    N ++++FERSRIKALADERE VQKKTFTKW+NS L  V+ +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA +V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +LP V AA KKHEAIETDI AYEE ++ +  ++  LE E Y+DI  I   K+ V+ LW+ LL+ L  RR  L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI     R+  + + A R+    +          +  +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+SV RL  KHK FE E+S +   L   + EG+ ++     G E I  +  DIQ  W  L   +  RK +L +    YQ+ +D DD + W+ +  R+     +G     T+ L++K++   E + NYR  I+ +  QA + L     +   V  +L  IE++Y++L ++A   ++ L DALT+Y++ +++D+   WI EK+++L N    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ +G+P+ + I   QD LN  W++  ++VD  +D L S     N+ ++C +T  WIREK K+IES  ELG DL  VM  QR++  M+RD+ AIEAK+  L  + +++   +   A+ I  +L  ++  WE ++  +++R+ +L   + + +F++ LDDF +WL + QT +AS+++P + +EAEKL+ ++ + ++E+   E+  ++   +G+   + + D  Q++ L+ R+++++  W  L+ + E ++  L +     +F  D +Q E  LN QE Y++   + L NN   +++        +   E F+  M + E+ +  V+  G+ L+ + N+  D+++ K  ++D R KKN   A +   +LK+   + + LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K G Q  A+ P  +  + + +  L++ W EL    + K Q L   N+ +LF +S   + KWL  +E QI +DD        +TS+   LKK    N      +           + + ++ D+     Q+   V+V    L  PL    K  +A+++I   QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    + D + + ++ ++D++ L    +   +  L+     L EE EK    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+  +L     P+  +  ++   V+  +  LK +  E++ ++     LF +  +      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N   D+LI   H  A +I+ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +   IQ+K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + K+  E+++A+++L    + R+L  ++  D   F SMVR+L+ W+E+V  Q+E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++T+KR  +  KW +  + L L++EV+Q++RDA+ AEAW+  QE YL++  +G ++DE   L+K+   F+K+    +E+F            +++RL   E R +K  T                     E+   ++E+        T E + I        Q++ R   + D+     +E+ +    Q+ +S++S   P P     SP    K     QP                 +A+  PA T+ +P  +   +G L+RKH+WE  N+KAS+R+WH++Y +++   M F+KD ++        Y +E+P  L E V   A DY K+  VF+++  +G EYLFQ     +M  W+ AI +A      +    T  S +TQS P  S   +LP 
Sbjct:   25 DDEWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGE-----GYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQA-AALPEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDA-QYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQE-YVLAHTE-LPNNLEAAEA-------AIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYG----KDLTSVNILLKKQQVENGLCWRTRW----------IQEGKSTDEVDGQRQV---VEVRFIELLAPLNERKKYLLASKEI--HQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMK------KNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEE-KAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREV----DDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRLQEEEERKRKPPTP--------------------ELSPKLSEDGSPQQWDGTKEGEQISQNGLPSDQESPRMAENADT-----NELVNGSTEQRSSSKES--SPIP-----SPTADRKSKSGMQPQ----------------TAATLPAKTQEMPSAQ--FEGFLHRKHEWEGHNKKASSRSWHNVYCVINNQEMGFYKDSKNAASGIA--YHNEIPANLKEAVCEVATDYKKKKHVFKLKLNDGNEYLFQAKDDEEMNTWIQAITNA------ITSDKTEVSLSTQSTPASSRAQTLPA 2316          
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1349.34 bits (3491), Expect = 0.000e+0
Identity = 830/2343 (35.42%), Postives = 1345/2343 (57.41%), Query Frame = 1
Query:  163 EDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQN--PDKASKYEQLETQVKVTMDGLSVPL--ESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDM 7134
            +DE    N ++++FERSRIKALADERE VQKKTFTKW+NS L  V+ +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA +V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +LP V AA KKHEAIETDI AYEE ++ +  ++  LE E Y+DI  I   K+ V+ LW+ LL+ L  RR  L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI     R+  + + A R+    +          +  +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+SV RL  KHK FE E+S +   L   + EG+ ++     G E I  +  DIQ  W  L   +  RK +L +    YQ+ +D DD + W+ +  R+     +G     T+ L++K++   E + NYR  I+ +  QA + L     +   V  +L  IE++Y++L ++A   ++ L DALT+Y++ +++D+   WI EK+++L N    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ +G+P+ + I   QD LN  W++  ++VD  +D L S     N+ ++C +T  WIREK K+IES  ELG DL  VM  QR++  M+RD+ AIEAK+  L  + +++   +   A+ I  +L  ++  WE ++  +++R+ +L   + + +F++ LDDF +WL + QT +AS+++P + +EAEKL+ ++ + ++E+   E+  ++   +G+   + + D  Q++ L+ R+++++  W  L+ + E ++  L +     +F  D +Q E  LN QE Y++   + L NN   +++        +   E F+  M + E+ +  V+  G+ L+ + N+  D+++ K  ++D R KKN   A +   +LK+   + + LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K G Q  A+ P  +  + + +  L++ W EL    + K Q L   N+ +LF +S   + KWL  +E QI +DD        +TS+   LKK      +++ +KK +E L+  ++ L Q+    D+     Q+   V+V    L  PL    K  +A+++I   QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    + D + + ++ ++D++ L    +   +  L+     L EE EK    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+  +L     P+  +  ++   V+  +  LK +  E++ ++       +   L+Q      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N   D+LI   H  A +I+ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +   IQ+K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + K+  E+++A+++L    + R+L  ++  D   F SMVR+L+ W+E+V  Q+E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++T+KR  +  KW +  + L L++EV+Q++RDA+ AEAW+  QE YL++  +G ++DE   L+K+   F+K+    +E+F  L+RLTT+      L     F++        TA+     ++  + EN  T E                     ++ S +Q S  K++              P P     SP    K     QP                 +A+  PA T+ +P  +   +G L+RKH+WE  N+KAS+R+WH++Y +++   M F+KD ++        Y +E+P  L E V   A DY K+  VF+++  +G EYLFQ    V +
Sbjct:   25 DDEWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGE-----GYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQA-AALPEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDA-QYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQE-YVLAHTE-LPNNLEAAEA-------AIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYG----KDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALSQEGKSTDEVDGQRQV---VEVRFIELLAPLNERKKYLLASKEI--HQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMK------KNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEE-KAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLD------ERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTV------LTLCFSFLSTNSTRCSFTADDPETAVM--MAENADTNE--------------------LVNGSTEQRSSSKESS-------------PIP-----SPTADRKSKSGMQPQ----------------TAATLPAKTQEMPSAQ--FEGFLHRKHEWEGHNKKASSRSWHNVYCVINNQEMGFYKDSKNAASGIA--YHNEIPANLKEAVCEVATDYKKKKHVFKLKLNDGNEYLFQAKDDVSI 2261          
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1343.56 bits (3476), Expect = 0.000e+0
Identity = 831/2349 (35.38%), Postives = 1344/2349 (57.22%), Query Frame = 1
Query:  163 EDEVQYANVTSKVFERSRIKALA------DERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQN--PDKASKYEQLETQVKVTMDGLSVPL--ESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDM 7134
            +DE    N ++++FERSRIKALA      DERE VQKKTFTKW+NS L  V+ +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA +V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +LP V AA KKHEAIETDI AYEE ++ +  ++  LE E Y+DI  I   K+ V+ LW+ LL+ L  RR  L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI     R+  + + A R+    +          +  +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+SV RL  KHK FE E+S +   L   + EG+ ++     G E I  +  DIQ  W  L   +  RK +L +    YQ+ +D DD + W+ +  R+     +G     T+ L++K++   E + NYR  I+ +  QA + L     +   V  +L  IE++Y++L ++A   ++ L DALT+Y++ +++D+   WI EK+++L N    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ +G+P+ + I   QD LN  W++  ++VD  +D L S     N+ ++C +T  WIREK K+IES  ELG DL  VM  QR++  M+RD+ AIEAK+  L  + +++   +   A+ I  +L  ++  WE ++  +++R+ +L   + + +F++ LDDF +WL + QT +AS+++P + +EAEKL+ ++ + ++E+   E+  ++   +G+   + + D  Q++ L+ R+++++  W  L+ + E ++  L +     +F  D +Q E  LN QE Y++   + L NN   +++        +   E F+  M + E+ +  V+  G+ L+ + N+  D+++ K  ++D R KKN   A +   +LK+   + + LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K G Q  A+ P  +  + + +  L++ W EL    + K Q L   N+ +LF +S   + KWL  +E QI +DD        +TS+   LKK      +++ +KK +E L+  ++ L Q+    D+     Q+   V+V    L  PL    K  +A+++I   QF +D +DEI W+ E++ L    +    ++T+      Q L  ++++++ EI+    + D + + ++ ++D++ L    +   +  L+     L EE EK    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+  +L     P+  +  ++   V+  +  LK +  E++ ++       +   L+Q      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N   D+LI   H  A +I+ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +   IQ+K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + K+  E+++A+++L    + R+L  ++  D   F SMVR+L+ W+E+V  Q+E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++T+KR  +  KW +  + L L++EV+Q++RDA+ AEAW+  QE YL++  +G ++DE   L+K+   F+K+    +E+F  L+RLTT+      L     F++        TA+     ++  + EN  T E                     ++ S +Q S  K++              P P     SP    K     QP                 +A+  PA T+ +P  +   +G L+RKH+WE  N+KAS+R+WH++Y +++   M F+KD ++        Y +E+P  L E V   A DY K+  VF+++  +G EYLFQ    V +
Sbjct:   25 DDEWDNENSSARLFERSRIKALAGSAMLIDEREAVQKKTFTKWVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGE-----GYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQA-AALPEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDA-QYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQE-YVLAHTE-LPNNLEAAEA-------AIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYG----KDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALSQEGKSTDEVDGQRQV---VEVRFIELLAPLNERKKYLLASKEI--HQFNRDVEDEILWVEERMPLATSTDHGHNLQTV------QLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEE-KAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLD------ERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTV------LTLCFSFLSTNSTRCSFTADDPETAVM--MAENADTNE--------------------LVNGSTEQRSSSKESS-------------PIP-----SPTADRKSKSGMQPQ----------------TAATLPAKTQEMPSAQ--FEGFLHRKHEWEGHNKKASSRSWHNVYCVINNQEMGFYKDSKNAASGIA--YHNEIPANLKEAVCEVATDYKKKKHVFKLKLNDGNEYLFQAKDDVSI 2267          
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1336.24 bits (3457), Expect = 0.000e+0
Identity = 834/2384 (34.98%), Postives = 1356/2384 (56.88%), Query Frame = 1
Query:  211 SRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQN--PDKASKYEQLETQVKVTMDGLSVPL--ESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEIS----LFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFE-----------QLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQ------TFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPS-TTQSHPNLS--SSLPP 7251
             R K L DERE VQKKTFTKW+NS L  V+ +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA +V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +LP V AA KKHEAIETDI AYEE ++ +  ++  LE E Y+DI  I   K+ V+ LW+ LL+ L  RR  L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI     R+  + + A R+    +          +  +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+SV RL  KHK FE E+S +   L   + EG+ ++     G E I  +  DIQ  W  L   +  RK +L +    YQ+ +D DD + W+ +  R+     +G     T+ L++K++   E + NYR  I+ +  QA + L     +   V  +L  IE++Y++L ++A   ++ L DALT+Y++ +++D+   WI EK+++L N    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ +G+P+ + I   QD LN  W++  ++VD  +D L S     N+ ++C +T  WIREK K+IES  ELG DL  VM  QR++  M+RD+ AIEAK+  L  + +++   +   A+ I  +L  ++  WE ++  +++R+ +L   + + +F++ LDDF +WL + QT +AS+++P + +EAEKL+ ++ + ++E+   E+  ++   +G+   + + D  Q++ L+ R+++++  W  L+ + E ++  L +     +F  D +Q E  LN QE Y++   + L NN   +++        +   E F+  M + E+ +  V+  G+ L+ + N+  D+++ K  ++D R KKN   A +   +LK+   + + LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K G Q  A+ P  +  + + +  L++ W EL    + K Q L   N+ +LF +S   + KWL  +E QI +DD        +TS+   LKK      +++ +KK +E L+  ++ L Q+    D+     Q+   V+V    L  PL    K  +A+++I   QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    + D + + ++ ++D++ L    +   +  L+     L EE EK    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+  +L     P+  +  ++   V+  +  LK +  E++ ++     LF +  +      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N   D+LI   H  A +I+ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +   IQ+K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + K+  E+++A+++L    + R+L  ++  D   F SMVR+L+ W+E+V  Q+E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++T+KR  +  KW +  + L L++EV+Q++RDA+ AEAW+  QE YL++  +G ++DE   L+K+   F+K+    +E+F            +++RL   E R +K  T                     E+   ++E+        T E + I        Q++ R   + D+     +E+ +    Q+ +S++S   P P     SP    K     QP                 +A+  PA T+ +P  +   +G L+RKH+WE  N+KAS+R+WH++Y +++   M F+KD ++        Y +E+P  L E V   A DY K+  VF+++  +G EYLFQ     +M  W+ AI +A      +    T  S +TQS P  S   +LP 
Sbjct:   30 GRFKQLQDEREAVQKKTFTKWVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGE-----GYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQA-AALPEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDA-QYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQE-YVLAHTE-LPNNLEAAEA-------AIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYG----KDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALSQEGKSTDEVDGQRQV---VEVRFIELLAPLNERKKYLLASKEI--HQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMK------KNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEE-KAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREV----DDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRLQEEEERKRKPPTP--------------------ELSPKLSEDGSPQQWDGTKEGEQISQNGLPSDQESPRMAENADT-----NELVNGSTEQRSSSKES--SPIP-----SPTADRKSKSGMQPQ----------------TAATLPAKTQEMPSAQ--FEGFLHRKHEWEGHNKKASSRSWHNVYCVINNQEMGFYKDSKNAASGIA--YHNEIPANLKEAVCEVATDYKKKKHVFKLKLNDGNEYLFQAKDDEEMNTWIQAITNA------ITSDKTEVSLSTQSTPASSRAQTLPA 2317          
BLAST of Spectrin beta chain vs. Ensembl Mouse
Match: Sptbn1 (spectrin beta, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98388])

HSP 1 Score: 1345.1 bits (3480), Expect = 0.000e+0
Identity = 842/2391 (35.22%), Postives = 1367/2391 (57.17%), Query Frame = 1
Query:  160 DEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDI-------RSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDK---ASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMI-DENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLS--SSLP 7248
            D D+    N ++++FERSRIKALADERE VQKKTFTKW+NS L  V+ +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA +V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +LP V AA KKHEAIETDI AYEE +  +  ++  LE E Y+DI  I   K+ V+ LW+ LL+ L  RR+ L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI       R +N   +K  ++   Y + CD             +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+SV RLL KH+ FE E+S +    E  + EG+ ++     G E I  +   I+  W  L   +  RK +L E    +Q+ +D DD + W+ +  ++     +G     T+ L++K++   E + NYR  I+ +  QA S L  +  +   V  +L  IE++ +++ ++    ++ L D L +Y++ +++D+   WI EK+++L N    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ NG+P+ + I   QD LN  W++  ++VD K+D LLS     N+ ++C +T  WIREK K+IES  +LG DL  VM  QR++  M+RD+ AIEAK+  L  + +++   +   A+ I  +L  +   WE ++  +++R+++L   + + +F++ LDDF +WL + QT +AS+++P + +EAEKL+ ++ + ++E+   E+  ++   +G+   + + D  Q++ L+ R+++++  W  L+ + E ++  L +      F  D +Q E  LN QE  L               + L      + + E F+  M ++E+ +  V++ G+ L+ + N+  DR+Q K  ++D+R +KN  AA     +LK+   L + LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K G Q  ++ P  +  + + L  L+  W  L    + K Q L   N+ +LF +S   + KWL  +E QI +DD        +TS+   LKK      ++E +KK +E L+  ++ L Q+        SK   ++T+    ++ LS   E K ++   K I  QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    ++D + + +Q +I D + L    +   +  LK+    L EE EK    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+  +L     P+  +  ++   V+  +  LK +  E++ ++       + + L+Q      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N   DELI   H  A +I+ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +   IQ+K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + K+  E+++A++SL    E R++  ++  D   F SMVR+L+ W+E+V  Q+E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++T+KR  +  KW +  + L L++EV+Q++RDA+ AEAW++ QE YL++  +G ++DE   L+K+   F+K+    +E+F  L+RLTT+E+   +   + +       + +     +V E  +  ++   T +   +        Q + R   ++++S     E+ +    Q+ +S++S   P P       + +  +S  P  S  + P   L            PA           M+G L RKH+WE  N+KAS+R+WH++Y +++   M F+KD +         Y  E+P+ L E +   A DY K+  VF++R  +G EYLFQ     +M  W+ AI+SA       +  +   ++TQS P  S   +LP
Sbjct:   26 DVDDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGY-KPCD-----------PQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQA-SALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDA-QYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLA---------HTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYG----KDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLS---ERKHNLLASKEI-HQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIK------KNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEE-KAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLD------ERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPDPNT--KVSE--EAESQQWDTSKGDQVSQNGLPAEQGSPRMAGTMETS-----EMVNGAAEQRTSSKESSPVPSP------TLDRKAKSALPAQSAATLPARTLET----------PAAQ---------MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIP--YHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSAIS-----SDKHDTSASTQSTPASSRAQTLP 2329          
BLAST of Spectrin beta chain vs. Ensembl Mouse
Match: Sptbn1 (spectrin beta, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98388])

HSP 1 Score: 1345.1 bits (3480), Expect = 0.000e+0
Identity = 842/2391 (35.22%), Postives = 1367/2391 (57.17%), Query Frame = 1
Query:  160 DEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDI-------RSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDK---ASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMI-DENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLS--SSLP 7248
            D D+    N ++++FERSRIKALADERE VQKKTFTKW+NS L  V+ +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA +V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +LP V AA KKHEAIETDI AYEE +  +  ++  LE E Y+DI  I   K+ V+ LW+ LL+ L  RR+ L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI       R +N   +K  ++   Y + CD             +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+SV RLL KH+ FE E+S +    E  + EG+ ++     G E I  +   I+  W  L   +  RK +L E    +Q+ +D DD + W+ +  ++     +G     T+ L++K++   E + NYR  I+ +  QA S L  +  +   V  +L  IE++ +++ ++    ++ L D L +Y++ +++D+   WI EK+++L N    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ NG+P+ + I   QD LN  W++  ++VD K+D LLS     N+ ++C +T  WIREK K+IES  +LG DL  VM  QR++  M+RD+ AIEAK+  L  + +++   +   A+ I  +L  +   WE ++  +++R+++L   + + +F++ LDDF +WL + QT +AS+++P + +EAEKL+ ++ + ++E+   E+  ++   +G+   + + D  Q++ L+ R+++++  W  L+ + E ++  L +      F  D +Q E  LN QE  L               + L      + + E F+  M ++E+ +  V++ G+ L+ + N+  DR+Q K  ++D+R +KN  AA     +LK+   L + LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K G Q  ++ P  +  + + L  L+  W  L    + K Q L   N+ +LF +S   + KWL  +E QI +DD        +TS+   LKK      ++E +KK +E L+  ++ L Q+        SK   ++T+    ++ LS   E K ++   K I  QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    ++D + + +Q +I D + L    +   +  LK+    L EE EK    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+  +L     P+  +  ++   V+  +  LK +  E++ ++       + + L+Q      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N   DELI   H  A +I+ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +   IQ+K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + K+  E+++A++SL    E R++  ++  D   F SMVR+L+ W+E+V  Q+E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++T+KR  +  KW +  + L L++EV+Q++RDA+ AEAW++ QE YL++  +G ++DE   L+K+   F+K+    +E+F  L+RLTT+E+   +   + +       + +     +V E  +  ++   T +   +        Q + R   ++++S     E+ +    Q+ +S++S   P P       + +  +S  P  S  + P   L            PA           M+G L RKH+WE  N+KAS+R+WH++Y +++   M F+KD +         Y  E+P+ L E +   A DY K+  VF++R  +G EYLFQ     +M  W+ AI+SA       +  +   ++TQS P  S   +LP
Sbjct:   26 DVDDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGY-KPCD-----------PQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQA-SALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDA-QYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLA---------HTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYG----KDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLS---ERKHNLLASKEI-HQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIK------KNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEE-KAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLD------ERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPDPNT--KVSE--EAESQQWDTSKGDQVSQNGLPAEQGSPRMAGTMETS-----EMVNGAAEQRTSSKESSPVPSP------TLDRKAKSALPAQSAATLPARTLET----------PAAQ---------MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIP--YHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSAIS-----SDKHDTSASTQSTPASSRAQTLP 2329          
BLAST of Spectrin beta chain vs. Ensembl Mouse
Match: Sptbn1 (spectrin beta, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98388])

HSP 1 Score: 1276.15 bits (3301), Expect = 0.000e+0
Identity = 766/2094 (36.58%), Postives = 1235/2094 (58.98%), Query Frame = 1
Query:  160 DEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDI-------RSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDK---ASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMI-DENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKF 6363
            D D+    N ++++FERSRIKALADERE VQKKTFTKW+NS L  V+ +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA +V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +LP V AA KKHEAIETDI AYEE +  +  ++  LE E Y+DI  I   K+ V+ LW+ LL+ L  RR+ L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI       R +N   +K  ++   Y + CD             +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+SV RLL KH+ FE E+S +    E  + EG+ ++     G E I  +   I+  W  L   +  RK +L E    +Q+ +D DD + W+ +  ++     +G     T+ L++K++   E + NYR  I+ +  QA S L  +  +   V  +L  IE++ +++ ++    ++ L D L +Y++ +++D+   WI EK+++L N    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ NG+P+ + I   QD LN  W++  ++VD K+D LLS     N+ ++C +T  WIREK K+IES  +LG DL  VM  QR++  M+RD+ AIEAK+  L  + +++   +   A+ I  +L  +   WE ++  +++R+++L   + + +F++ LDDF +WL + QT +AS+++P + +EAEKL+ ++ + ++E+   E+  ++   +G+   + + D  Q++ L+ R+++++  W  L+ + E ++  L +      F  D +Q E  LN QE  L               + L      + + E F+  M ++E+ +  V++ G+ L+ + N+  DR+Q K  ++D+R +KN  AA     +LK+   L + LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K G Q  ++ P  +  + + L  L+  W  L    + K Q L   N+ +LF +S   + KWL  +E QI +DD        +TS+   LKK      ++E +KK +E L+  ++ L Q+        SK   ++T+    ++ LS   E K ++   K I  QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    ++D + + +Q +I D + L    +   +  LK+    L EE EK    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+  +L     P+  +  ++   V+  +  LK +  E++ ++       + + L+Q      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N   DELI   H  A +I+ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +   IQ+K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + K+  E+++A++SL    E R++  ++  D   F SMVR+L+ W+E+V  Q+E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++T+KR  +  KW +  + L L++EV+Q++RDA+ AEAW++ QE YL++  +G ++DE   L+K+   F+K+    +E+F
Sbjct:   26 DVDDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGY-KPCD-----------PQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQA-SALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDA-QYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLA---------HTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYG----KDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLS---ERKHNLLASKEI-HQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIK------KNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEE-KAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLD------ERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERF 2073          
BLAST of Spectrin beta chain vs. Ensembl Mouse
Match: Sptbn1 (spectrin beta, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98388])

HSP 1 Score: 1259.2 bits (3257), Expect = 0.000e+0
Identity = 756/2077 (36.40%), Postives = 1220/2077 (58.74%), Query Frame = 1
Query:  211 SRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDI-------RSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDK---ASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMI-DENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKF 6363
             R K L DERE VQKKTFTKW+NS L  V+ +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA +V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +LP V AA KKHEAIETDI AYEE +  +  ++  LE E Y+DI  I   K+ V+ LW+ LL+ L  RR+ L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI       R +N   +K  ++   Y + CD             +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+SV RLL KH+ FE E+S +    E  + EG+ ++     G E I  +   I+  W  L   +  RK +L E    +Q+ +D DD + W+ +  ++     +G     T+ L++K++   E + NYR  I+ +  QA S L  +  +   V  +L  IE++ +++ ++    ++ L D L +Y++ +++D+   WI EK+++L N    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ NG+P+ + I   QD LN  W++  ++VD K+D LLS     N+ ++C +T  WIREK K+IES  +LG DL  VM  QR++  M+RD+ AIEAK+  L  + +++   +   A+ I  +L  +   WE ++  +++R+++L   + + +F++ LDDF +WL + QT +AS+++P + +EAEKL+ ++ + ++E+   E+  ++   +G+   + + D  Q++ L+ R+++++  W  L+ + E ++  L +      F  D +Q E  LN QE  L               + L      + + E F+  M ++E+ +  V++ G+ L+ + N+  DR+Q K  ++D+R +KN  AA     +LK+   L + LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K G Q  ++ P  +  + + L  L+  W  L    + K Q L   N+ +LF +S   + KWL  +E QI +DD        +TS+   LKK      ++E +KK +E L+  ++ L Q+        SK   ++T+    ++ LS   E K ++   K I  QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    ++D + + +Q +I D + L    +   +  LK+    L EE EK    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+  +L     P+  +  ++   V+  +  LK +  E++ ++       + + L+Q      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N   DELI   H  A +I+ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +   IQ+K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + K+  E+++A++SL    E R++  ++  D   F SMVR+L+ W+E+V  Q+E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++T+KR  +  KW +  + L L++EV+Q++RDA+ AEAW++ QE YL++  +G ++DE   L+K+   F+K+    +E+F
Sbjct:   30 GRFKQLQDEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGY-KPCD-----------PQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQA-SALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDA-QYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLA---------HTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYG----KDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLS---ERKHNLLASKEI-HQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIK------KNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEE-KAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLD------ERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERF 2060          
BLAST of Spectrin beta chain vs. Ensembl Mouse
Match: Sptbn2 (spectrin beta, non-erythrocytic 2 [Source:MGI Symbol;Acc:MGI:1313261])

HSP 1 Score: 1244.18 bits (3218), Expect = 0.000e+0
Identity = 785/2397 (32.75%), Postives = 1293/2397 (53.94%), Query Frame = 1
Query:  193 SKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCD--QDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKK--LDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLN-------------TDRQFINE---ALIN---IEQTAEHEVHEIIQPITEN-------VQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDM--LSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSS--LPPQAQ 7260
            +++FERSRIKALADERE VQKKTFTKW+NS L  VT ++ DLY DLRDG+ LL LLE+LS E +PKPT+GRMRIHCLENVDK L FL  QKVHLEN+G+HDIVDGN RLTLGL+WTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VN+ NFT SWR GL F A++HKHRPDL+DF S  + +   NL  AF++AE  LG+  LLDPEDVNV  PDE+S+ITYVA+YYHYF+ +KA +V  KR+ K+L+  +E E +++ Y+SL S+LL+WI  TI  LN RQ +NS+ G+Q Q+ +FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA +F++KAA+RE+W+++N  L+ + + G  L  V AA++KHEAIETDI AY   +  +  ++  L  E Y+DI  I   +N V  LW  L Q +  RRE L   L++  +  +   +   +  +  + +  + GKHL  VE+LL+ HEL+E+DI    +R+  + + A R   FCD  +++R      +  ++ E+  +  + +  L +    R+  L+ S  +W+F+ +    E W++E   ++ + D G DL+ V RLL KH     E+S +   L+  L +G+ LV     G    + +  ++Q  WE L    E R  +L +    YQ+ +D +D E W+ +  RL     +G     T+ L R+++   E +  +R  ++ +R QA + L  ++     V  ++  +E+ Y++L   A +    L  AL  Y +L+++ +   W+ EK+++L      + +E+LEV++ RFE  E E+   A +V  VN+++E L+    P    I+  Q+ LN  W +   + D K+  L S     N+ ++C +T  W+REK K+IES   LG DL  V+  QR++   +RD+ AI A++  L  + + +   +   A  I  +L  V   WE L+  +R R+ +L     +  F++ LDDF  WLG+ QT +AS+  P +  EAE L+ ++ + R E+   + +      +G++  + + D  Q + L+ R+E++   W+ L  + E ++ RL +      F  DARQ E +L++QE  L         +       L + +  + + E F+  M ++ + +  +L+ G+ L+ + N++ +++Q K  ++++R +KN  A Q    +L++       LQD  +L   + EK+    ++S    ++  +   + +A   E+ A +  +++++K G++ + + P  K  + + L++L+  W EL    + K ++L   NR +LF +S  ++  WL++++ Q+ +DD        +TS+   LKK  +    M +  K+      +  +   + Q+   A + E+    V+     L  P++ +    +      QF +D +DEI W+ E++ +    +  +E    L   Q L  ++++++ EI+    ++  L +E QR      L  A     + +L++  + L+ E+E     L   L  Q+F  D +E  +W+ E+EL +MG    +KD+   +  ++K Q LE  + +Y   I++   S   +     P+  +  ++   V+  + SLK +  E++  +   +  C       ++E WI ER  +A S + G+D +  T+LRD+F  FS +T+ IG  +V+ AN   + LI G H    +++ WKD +NE WADLLEL+DTR Q+L +A++L R+   ++  L  +Q K+   ++ +  G+D  +   LQR+   +E D+  L + +         L   Y  DK   + +  Q + +A+  L+     R+   L+  D   F   VREL+ W++ + +QM+ + +PRDVS  +L++ N + +K E++++ + FS C+++G+ LL   H  + EI  K  ++  +R     KW   +D L L++EV  + RDA  AEAW+ SQE  + +  LG T+DE  +L+K+   FQK+ +  EE+F  L++LT +E R  +               T     ++   +L++   +  TA       + P T+          T   +P++       QQ + + N          E   +G   + +  +   +  P+  A SP+PQ         S  S+  H  ++ T    LSA  +             M+G L RK + E  N+KA+NR+W ++Y +L +  + F+KD R         Y  E+P+ L     + A DY KR  VF++  ++G EYLFQ     +M+ W+  +N+A          +  P    +   L+ +  +PP +Q
Sbjct:   40 ARLFERSRIKALADEREAVQKKTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHAMEAEHLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAEHYHDIKRIAARQNNVARLWDFLRQMVAARRERLLLNLELQKVFQDLLYLMDWMAEMKGRLQSQDLGKHLAGVEDLLQLHELVEADIAVQAERVRAVSASALR---FCDPGKEYRPC----DPQLVSERVATLEQSYEALCELAATRRARLEESRRLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGVLRLLNKHAALRGEMSGRLGPLKLTLEQGQQLVAEGHPGANQASTRAAELQAQWERLEALAEERAQQLAQAASLYQFQADANDMEAWLVDALRLVSSPEVGHDEFSTQALARQHRALEEEIRAHRPTLDALREQA-AALPPALSHTPEVQGRVPTLEQHYEELQARAGERARALEAALAFYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPEMNALAARVTAVNDIAEQLLKASPPGKDRIIGTQEQLNQRWQQFRSLADGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAISARVGELTQEANALAAGHPAQAPAINTRLGEVQAGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRTLGEEVTRDQADP-QCLFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVL---------SHTEMPGTLQAADAAIKKLEDFMSTMDANGERIRGLLEAGRQLVSKGNIHAEKIQEKADSIEKRHRKNQEAVQQLLGRLRDNREQQHFLQDCQELRLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKVVVSEKLEDLHRRWDELETTTQAKARSLFDANRAELFAQSCSALESWLESLQAQLHSDD----YGKDLTSVNILLKKQQMLEREMAVREKEVEAIQAQAQALAQEDQS---AGEVERTSRAVEEKFRALCQPMKERCRRLHASREQHQFHRDVEDEILWVTERLPM----ASSLEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADL-KERQRT-----LGTAAAGPELAELQEMWKRLSHELELRGKRLEEALRAQQFYRDAAEAEAWMGEQELHMMGQE-KAKDELSAQAEVKKHQVLEQALADYAQTIKQLAASSQDMIDHEHPESTRLTIRQAQVDKLYASLKELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSKDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALARVQHKQ--QQLPDGTGRDLNAAEALQRRHCAYEHDIQALSTQVQQVQDDGQRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDGINLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGQELLARSHYAAEEISEKLSQLQSRRQETADKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESLIKRHEAFQKSAVAWEERFSALEKLTALEERENERKRKREEEERRKQPPTSEPMASQPEGSLVDGQRVPDTAWDGTQSKLPPSTQAPSVNGVCTDTDSSQPLLE------QQRLEQSNV--------PEGPGSGTGDESSGPRGERQTLPRGPAPSPMPQ---------SRSSEAAHGATLPTRGPELSAQEQ-------------MEGMLCRKQEMEAFNKKAANRSWQNVYCVLRRGSLGFYKDARAASAGVP--YHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSAPGESEEPVVPSASRGLTRAMTMPPVSQ 2360          
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Match: sp|Q01082|SPTB2_HUMAN (Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2)

HSP 1 Score: 1352.42 bits (3499), Expect = 0.000e+0
Identity = 842/2393 (35.19%), Postives = 1368/2393 (57.17%), Query Frame = 1
Query:  160 DEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDI-------RSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKAS-KYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMI-DENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFIN------EALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSA-SRPMRQVNPSNTNPSTTQSHPNLSSSL 7245
            D D+    N ++++FERSRIKALADERE VQKKTFTKW+NS L  V+ +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA +V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +LP V AA KKHEAIETDI AYEE +  +  ++  LE E Y+DI  I   K+ V+ LW+ LL+ L  RR+ L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI       R +N   +K  ++   Y + CD             +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+SV RLL KH+ FE E+S +    E  + EG+ ++     G E I  +   I+  W  L   +  RK +L E    +Q+ +D DD + W+ +  ++     +G     T+ L++K++   E + NYR  ++ +  QA S L     +   V  +L  IE++Y+++ ++    ++ L D L +Y++ +++D+   WI EK+++L N    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ +G+P+ + I   QD LN  W++  ++VD K+D LLS     N+ ++C +T  WIREK K+IES  +LG DL  VM  QR++  M+RD+ AIEAK+  L  + +++   +   A+ I  +L  +   WE ++  +++R+++L   + + +F++ LDDF +WL + QT +AS+++P + +EAEKL+ ++ + ++E+   E+  ++   +G+   + + D  Q++ L+ R+++++  W  L+ + E ++  L +      F  D +Q E  LN QE  L               + L      + + E F+  M ++E+ +  V++ G+ L+ + N+  DR+Q K  ++D+R +KN   A     +LK+   L + LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K G Q  ++ P  +  + + L  L+  W  L    + K Q L   N+ +LF +S   + KWL  +E QI +DD        +TS+   LKK      ++E +KK +E L+  ++ L Q+         ++L  Q K  M+ L    E K ++   K I  QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    ++D + + +Q ++ D + L    +   +  LK+    L EE EK    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+  +L     P+  +  ++   V+  +  LK +  E++ ++       + + L+Q      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N   DELI   H  A +I+ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +   IQ+K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + K+  E+++A++SL    E R++  ++  D   F SMVR+L+ W+E+V  Q+E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++T+KR  +  KW +  + L L++EV+Q++RDA+ AEAW++ QE YL++  +G ++DE   L+K+   F+K+    +E+F  L+RLTT+E+   +   + +         E    + + AE +         +   T + + +        Q + R   ++D+     SE+ +    Q+ +S++S   P P S         +++K   P+                SA+  PA T+  P  +  M+G L RKH+WE  N+KAS+R+WH++Y +++   M F+KD +         Y  E+P+ L E V   A DY K+  VF++R  +G EYLFQ     +M  W+ AI+SA S    +V+ S  +   +     L +S+
Sbjct:   26 DVDDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGY-KPCD-----------PQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQA-SALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDA-QYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLA---------HTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYG----KDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKF-MELLEPLNERKHNLLASKEI-HQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIK------KNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEE-KAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLD------ERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPEPSTKVSEEAESQ---------QQWDTSKGEQVSQNGLPAEQGSPRMAETVDT-----SEMVNGATEQRTSSKESSPIPSPTSD--------RKAKTALPAQ---------------SAATLPARTQETPSAQ--MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKTAASGIP--YHSEVPVSLKEAVCEVALDYKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAISSDKHEVSASTQSTPASSRAQTLPTSV 2333          
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Match: sp|Q62261|SPTB2_MOUSE (Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus OX=10090 GN=Sptbn1 PE=1 SV=2)

HSP 1 Score: 1345.1 bits (3480), Expect = 0.000e+0
Identity = 842/2391 (35.22%), Postives = 1367/2391 (57.17%), Query Frame = 1
Query:  160 DEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDI-------RSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDK---ASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMI-DENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLS--SSLP 7248
            D D+    N ++++FERSRIKALADERE VQKKTFTKW+NS L  V+ +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA +V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +LP V AA KKHEAIETDI AYEE +  +  ++  LE E Y+DI  I   K+ V+ LW+ LL+ L  RR+ L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI       R +N   +K  ++   Y + CD             +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+SV RLL KH+ FE E+S +    E  + EG+ ++     G E I  +   I+  W  L   +  RK +L E    +Q+ +D DD + W+ +  ++     +G     T+ L++K++   E + NYR  I+ +  QA S L  +  +   V  +L  IE++ +++ ++    ++ L D L +Y++ +++D+   WI EK+++L N    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ NG+P+ + I   QD LN  W++  ++VD K+D LLS     N+ ++C +T  WIREK K+IES  +LG DL  VM  QR++  M+RD+ AIEAK+  L  + +++   +   A+ I  +L  +   WE ++  +++R+++L   + + +F++ LDDF +WL + QT +AS+++P + +EAEKL+ ++ + ++E+   E+  ++   +G+   + + D  Q++ L+ R+++++  W  L+ + E ++  L +      F  D +Q E  LN QE  L               + L      + + E F+  M ++E+ +  V++ G+ L+ + N+  DR+Q K  ++D+R +KN  AA     +LK+   L + LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K G Q  ++ P  +  + + L  L+  W  L    + K Q L   N+ +LF +S   + KWL  +E QI +DD        +TS+   LKK      ++E +KK +E L+  ++ L Q+        SK   ++T+    ++ LS   E K ++   K I  QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    ++D + + +Q +I D + L    +   +  LK+    L EE EK    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+  +L     P+  +  ++   V+  +  LK +  E++ ++       + + L+Q      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N   DELI   H  A +I+ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +   IQ+K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + K+  E+++A++SL    E R++  ++  D   F SMVR+L+ W+E+V  Q+E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++T+KR  +  KW +  + L L++EV+Q++RDA+ AEAW++ QE YL++  +G ++DE   L+K+   F+K+    +E+F  L+RLTT+E+   +   + +       + +     +V E  +  ++   T +   +        Q + R   ++++S     E+ +    Q+ +S++S   P P       + +  +S  P  S  + P   L            PA           M+G L RKH+WE  N+KAS+R+WH++Y +++   M F+KD +         Y  E+P+ L E +   A DY K+  VF++R  +G EYLFQ     +M  W+ AI+SA       +  +   ++TQS P  S   +LP
Sbjct:   26 DVDDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGY-KPCD-----------PQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQA-SALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDA-QYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLA---------HTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYG----KDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLS---ERKHNLLASKEI-HQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIK------KNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEE-KAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLD------ERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPDPNT--KVSE--EAESQQWDTSKGDQVSQNGLPAEQGSPRMAGTMETS-----EMVNGAAEQRTSSKESSPVPSP------TLDRKAKSALPAQSAATLPARTLET----------PAAQ---------MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIP--YHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSAIS-----SDKHDTSASTQSTPASSRAQTLP 2329          
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Match: sp|Q00963|SPTCB_DROME (Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2)

HSP 1 Score: 1299.26 bits (3361), Expect = 0.000e+0
Identity = 780/2103 (37.09%), Postives = 1245/2103 (59.20%), Query Frame = 1
Query:  148 NALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLK--SEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQL---ETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKI-------EEFKKSCVSLPDEYKGIVKDVEDNFNSLKIICAEKKTEIS----LFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKK 6408
            N   DE E    N +S++FERSRIKALA+ERE+VQKKTFTKW+NS L  V  +I DLYVD+RDGK L+ LLE+LS E +PKPT+G+MRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN  L LGLIWTIILRFQ+QDI  +E  +   KSAKDALLLWCQMKTAGY +VN+RNFT SWR GL F A+IHKHRPDL+ F   ++ + I+NL+ AFD+AE+ LG+  LLD EDV V  PDE+S+ITYV +YYHYF+ LK  +V  KR+ K++   +E+++M+  Y++  S LL+WI  TI+ L  R+F NS+ G+Q Q+  F+ YRT EKP KFVEK +LEVLLFT++S    +  K Y P E   +S IN AW+ L  AE+ RE ALR+EL+RQEKL  LA +F++KA++RE+W+++N  L+ + + G +L  V AA KKHEAIETDI+AYEE +  +  + D LE E Y+D+  I+  K+ V+ LW  LL+ L  RR  L+  LQ+     E   +   +  I      D+YGKHLM VE+LL+ H L+E+DI  + +R++ ++  + +++     D   +    +  +I  +       + EL+    +R+  L+ S  +WQF  D + EE WIKE   I++  ++G+DL++V+ +L KHK  E E++S    L+N    G  L+     G + I  +  +I N W+ L+D T+ R+ +L   ++Y+Q  +D DD + W+ +  R+   + +G   +  + L++K++   + ++NY + I+ +  QA+S L  +  +   V K+L+ I+ +Y++L ++A   +++LLDAL++Y+L++++D V  WI EK K L    P  DIE++E++KHRFE F+ E+   A +V  VN L+  L+   +PN   I+  Q++LN  W+ + +  ++K D+L S +    F+++C++TI WI +K +++   D L  DL  VM  QRR++ M RD+ AI+AK+  L  + + I   +   AK I  ++  +   WE L Q++++RDS L    D+HRF++ LD F  WL + QT++AS++ P S  EAEKL+N++ S R+E+    +  +  M+ G+      S  D  Q++ L+ R+ ++   W+ L+ + E ++  L + L   +F  DARQ E +L+ QE +L KD          +  NL      +  +E F+  M +++  +  +L+   TL+ +++   D++  + +N+  R   N   A ++  KLK QV LHE LQD+++L + + EK     + S  + K+  S   + +A E EI A +  + E  K  ++ S + P FK  I   L  L   + +L    +EK   L   NRE L +++   +  ++ ++E QIV+ D    + + +TS+   ++K      ++  K + +E +   +E L++  P++  K E +   +T V    + +  PL  +     +K  A QF +D +DE  W++EK+ +    +   +   +L     L+ +++S+  EI N   +++++    +++IDE H         ++ L +  + L + +E  +  L     VQ++  D  E  SW+SE+EL +M +    KD+   + +++K +NLE  +++Y   I        +F    +S  D        ++  +  LK +  E++  ++    LF++  +      ++E WI +R  +A S + G+D D  TLL +RF  F+ +T  +G  +V + N   D LIQ  H  + +I+ WKD +NE W DLLELI+TR Q+L ++ +LH+++ D + +L  I EK+    V ++LG+D  SVS LQRK  NF +DL+ L S +      S  L   Y  DK   +  + QE++ A+ +L+ + + RK    +  D   F +MVR L+ W+E++  QM    KPRDVSG+ELL+ NH+SLK E+D++E+NF  C++LG+ LL   H  S +IK +   +++ R+ L ++W    ++L L++EVYQ+ARDAA AEAW+I+QE YL +  LG T+DE   L+KK   F+K+   QEE+F  L+RLTT E++  K
Sbjct:   18 NEYIDEYEYDGGNSSSRLFERSRIKALAEERESVQKKTFTKWVNSHLCRVNCRIADLYVDMRDGKHLIKLLEVLSGERLPKPTKGKMRIHCLENVDKALQFLREQRVHLENIGSHDIVDGNASLNLGLIWTIILRFQIQDITIEEVDNKETKSAKDALLLWCQMKTAGYHNVNVRNFTTSWRDGLAFNAIIHKHRPDLVQFEKLSKTNAIHNLNNAFDVAEDKLGLAKLLDAEDVFVEHPDEKSIITYVVTYYHYFSKLKQETVQGKRIGKVVGIAMENDKMVHDYENFTSDLLKWIETTIQSLGEREFENSLAGVQGQLAQFSNYRTIEKPPKFVEKGNLEVLLFTLQSKMRANNQKPYTPKEGKMISDINKAWERLEKAEHERELALREELIRQEKLEQLAARFDRKASMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIFAYEERVQAVVAVCDELESERYHDVKRILLRKDNVMRLWTYLLELLRARRMRLEISLQLQQNFQEMLYILDNMEEIKQLLMTDDYGKHLMGVEDLLQKHSLVEADINILGERVKVVVQNSQKFL----SDDPESYKPCDPEIIVSRVQQLEDAYAELVRLAVERRSRLEESRKLWQFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLSKHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKEILNKWDHLLDLTKYRRQRLENAVEYFQLFADADDVDNWMLDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAEVIDALHKQAES-LKLNEAEKANVDKRLEAIDNRYKELTELAKLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEMNANASRVAVVNQLARQLLHVEHPNSDEILERQNHLNQEWSTLREKAEAKMDDLKSAHGVQTFYIECRETISWIEDKKRILTETDSLEMDLTGVMTLQRRLSGMDRDLAAIQAKLSSLEREANSIEDEHPEEAKIIRERIAQIELIWEQLTQMLKERDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDNYTEDYKNMMEYGERLTSEGSTSDDPQYMFLRERLNALKDGWEELHQMWENRQVLLSQSLDQQLFNRDARQTEVLLSQQEHFLSKD---------DTPVNLEQAENQLKRHEAFLTTMEANDDKINTLLQVADTLVEKDHFDADKIGKRAENITGRRDDNRQRALDQHEKLKNQVKLHEFLQDLEELAEWVQEKYATSQDESYRSAKTIHSKWTRHQAFEAEIAANKERLFEAEKSAQELSKEKPEFKDVIEPKLKELAKQFDDLEVHTKEKGAMLFDANREVLVQQTCDDIDSYITDLEKQIVSGD----TANDLTSVNILMQKQQVIQTQMAVKARQVEEIDKQTEYLQKTVPEE--KIEPIVVKKTAVLERFEKIKAPLLERQKALEKKKEAFQFCRDVEDEKLWIDEKLPV----ANSPDYGNSLFNVHVLKKKNQSLATEIDNHEPRINAICNNGRKLIDEGHEDAKKFEALISDLTQKWQELKDAIENRRKHLLESEKVQQYFFDAQEAESWMSEQELYMM-VEDRGKDEISAQNLMKKHENLEQSVEDYANTIRQLGEVARQFSGDDISSGDAVAVKQSQLDKLYAGLKDLAGERRARLNEALQLFMLSREV----DDLEQWITDREVVAGSQELGQDFDHVTLLSERFNEFARDTEAVGGERVAKVNGIADNLIQAGHSDSATIAEWKDNLNESWQDLLELIETRTQMLAASRELHKFFHDCKDVLGRILEKQHG--VSDELGRDAGSVSTLQRKHYNFLQDLITLYSQVQQIQEESAKLQDAYAGDKAKEITNREQEVLHAWDNLQAMCDARKQKLADTGDLFRFFNMVRILMIWMEDLVRQMNTSEKPRDVSGVELLMNNHQSLKAEIDTREDNFGACISLGKELLTRNHYASADIKDRLMTLSNSRNALLRRWEERWENLQLILEVYQFARDAAVAEAWLIAQEPYLLSSELGHTIDEVENLIKKHEAFEKSAAAQEERFSALERLTTFELKEMK 2089          

HSP 2 Score: 131.724 bits (330), Expect = 6.681e-29
Identity = 140/618 (22.65%), Postives = 280/618 (45.31%), Query Frame = 1
Query: 4612 QFLQDCDDEIDWMNEKIDLIRNR--SKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVIN---SKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLP---DEYKGIVKDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ---NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELID-AFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRS-PE---IKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNT 6417
            QF  D  DE +W+ EK  ++        + T+  +L       +HK++++EI +   ++ ++ +    +I E H     + D + ++    ++L +  +  +  L N +   +   D  +V +W+    LD + +V +    +D+  ++ +++K +++  E+KNY   I+   K   SL     E   + K +E   N  K +    K      +     Y+L      +E WI E+TK+  +   GKD++   +++ RF  F  E N   +S+V   N+   +L+  +HP +  I   ++ +N+ W+ L E  + ++  LKSA  +  +Y + +  +  I++KK  +   + L  D   V  LQR+L   ++DL  + + +++    +N++   + +  EA +I++R   I+  +  L ++L++R     E  D H FL  +     W+ +    +     P  +   E LL  H+S++ E+D+  E++   +  G  L         P+   ++ +   + D  + L Q W N    LS  ++   + RDA   E  +  QE +L+ ++  + L++    LK+   F                LTTME    K+NT
Sbjct:  639 QFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLS------KHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKEILNKWDHLLDLTKYRRQRLENAVEYFQLFADADDVDNWM----LDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAEVIDALHKQAESLKLNEAEKANVDKRLEAIDNRYKELTELAKLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEMN-ANASRVAVVNQLARQLLHVEHPNSDEILERQNHLNQEWSTLREKAEAKMDDLKSAHGVQTFYIECRETISWIEDKKRILTETDSLEMDLTGVMTLQRRLSGMDRDLAAIQAKLSSLEREANSIEDEHPE--EAKIIRERIAQIELIWEQLTQMLKERDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDNYTEDYKNMMEYGERLTSEGSTSDDPQYMFLRERLNALKDGWEELHQMWENRQVLLSQSLDQQLFNRDARQTEVLLSQQEHFLSKDDTPVNLEQAENQLKRHEAF----------------LTTMEANDDKINT 1227          

HSP 3 Score: 89.7373 bits (221), Expect = 3.745e-16
Identity = 47/174 (27.01%), Postives = 85/174 (48.85%), Query Frame = 1
Query: 6784 LSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRFFSSIRLK 7305
            + AS   +     P      +G + RKH+W++  +KASNR+W  +Y+     R++F+KD++ +K  P+  ++ E    L       A DY K+  V RV+  NGA +L Q     +M++WV ++ + S              +T    + S +LP  +Q  +  +R F +++ K
Sbjct: 2131 VGASHDDSERGGTPGAGEGHEGYVTRKHEWDSTTKKASNRSWDKVYMAAKAGRISFYKDQKGYKSNPELTFRGEPSYDLQNAAIEIASDYTKKKHVLRVKLANGALFLLQAHDDTEMSQWVTSLKAQS-------------DSTAVAASRSQTLPATSQKDEPKRRSFFTLKKK 2291          
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Match: sp|O15020|SPTN2_HUMAN (Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3)

HSP 1 Score: 1252.65 bits (3240), Expect = 0.000e+0
Identity = 792/2375 (33.35%), Postives = 1295/2375 (54.53%), Query Frame = 1
Query:  193 SKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCD--QDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEAL--INIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKR---PQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAIN--------SASRPMRQVNPSNTNPSTTQSHPNLSSSLPP 7251
            +++FERSRIKALADERE VQKKTFTKW+NS L  VT ++ DLY DLRDG+ LL LLE+LS EI+PKPT+GRMRIHCLENVDK L FL  QKVHLEN+G+HDIVDGN RLTLGL+WTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VN+ NFT SWR GL F A++HKHRPDL+DF S  + +   NL  AF++AE  LG+  LLDPEDVNV  PDE+S+ITYVA+YYHYF+ +KA +V  KR+ K+L+  +E E++++ Y+SL S+LL+WI  TI  LN RQ +NS+ G+Q Q+ +FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA +F++KAA+RE+W+++N  L+ + + G  L  V AA++KHEAIETDI AY   +  +  ++  L  E Y+DI  I   ++ V  LW  L Q +  RRE L   L++  +  +   +   +  +  + +  + G+HL  VE+LL+ HEL+E+DI    +R+  + + A R   FC+  +++R      +  ++ E+     + +  L +    R+  L+ S  +W+F+ +    E W++E   ++ + D G DL+   RLL KH     E+S +   L+  L +G+ LV     G    +A+  ++Q  WE L    E R  +L +    YQ+ +D +D E W+ +  RL     LG     T+ L R+++   E + ++R  ++ +R QA + L  ++     V  ++  +E+ Y++L   A +    L  AL +Y +L+++ +   W+ EK+++L      + +E+LEV++ RFE  E E+   A ++  VN+++E L+    P    IVN Q+ LN+ W +   + D K+  L S     N+ ++C +T  W+REK K+IES   LG DL  V+  QR++   +RD+ AI A++  L  + + +   +   A  I  +L  V   WE L+  +R R+ +L     +  F++ LDDF  WLG+ QT +AS+  P +  EAE L+ ++ + R E+   + +      +G++  + + D  Q + L+ R+E++   W+ L  + E ++ RL +      F  DARQ E +L++QE  L         +       L + +  + + E F+  M ++ + +  +L+ G+ L+ E N++ D+++ K  +++ R KKN  AAQ    +L++       LQD  +L   + EK+    ++S    ++  +   + +A   E+ A +  +++++K G++ + + P  K  + + L +L+  W EL    + K ++L   NR +LF +S  ++  WL++++ Q+ +DD        +TS+   LKK      E+  ++K +E ++  ++ L Q++   A + E+    V+     L  P+  +           QF +D +DEI W+ E++ +    +  ME    L   Q L  ++++++ EI+    ++  L +E QR      L  A     + +L++  + L  E+E     L + L  Q+F  D +E  +W+ E+EL +MG    +KD+   +  ++K Q LE  + +Y   I +   S   +     P+  +  ++   V+  +  LK +  E++  +   +  C       ++E WI ER  +A S + G+D +  T+LRD+F  FS +T+ IG  +V+ AN   + LI G H    +++ WKD +NE WADLLEL+DTR Q+L +A++L R+   ++  L  +Q K+   ++ +  G+D  +   LQR+   +E D+  L   +       + L   Y  DK   + +  Q + +A+  L+     R+   L+  D   F   VREL+ W++EV +QM+ + +PRDVS  +L++ N + +K E++++ + FS C+++G+ LL   H  + EI  K  ++  +R    +KW   +D L L++EV  + RDA  AEAW+ SQE  + +  LG T+DE  +L+K+   FQK+ +  EE+F  L++LT +E R K+    R+           E TA     +++   T +  T++       P  Q         S++         +     Q++        P P S   +  P+ ++  R   P PS M +     S ST+   A+  P      P  +  M+G L RK + E   +KA+NR+W ++Y +L +  + F+KD +         Y  E+P+ L     + A DY KR  VF++  ++G EYLFQ     +M+ W+  +N        ++  P   V PS T   T       + ++PP
Sbjct:   40 ARLFERSRIKALADEREAVQKKTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGEILPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHAMEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAERYHDIKRIAARQHNVARLWDFLRQMVAARRERLLLNLELQKVFQDLLYLMDWMEEMKGRLQSQDLGRHLAGVEDLLQLHELVEADIAVQAERVRAVSASALR---FCNPGKEYRPC----DPQLVSERVAKLEQSYEALCELAAARRARLEESRRLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGASQASARAAELQAQWERLEALAEERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPELGHDEFSTQALARQHRALEEEIRSHRPTLDALREQA-AALPPTLSRTPEVQSRVPTLERHYEELQARAGERARALEAALALYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPEMNTLAAQITAVNDIAEQLLKANPPGKDRIVNTQEQLNHRWQQFRRLADGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAIAARVGELTREANALAAGHPAQAVAINARLREVQTGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRALGEEVTRDQADP-QCLFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVL---------SHTEMPGTLQAADAAIKKLEDFMSTMDANGERIHGLLEAGRQLVSEGNIHADKIREKADSIERRHKKNQDAAQQFLGRLRDNREQQHFLQDCHELKLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKALVSEKLRDLHRRWDELETTTQAKARSLFDANRAELFAQSCCALESWLESLQAQLHSDD----YGKDLTSVNILLKKQQMLEWEMAVREKEVEAIQAQAKALAQED-QGAGEVERTSRAVEEKFRALCQPMRERCRRLQASREQHQFHRDVEDEILWVTERLPM----ASSMEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADL-RERQRA-----LGAAAAGPELAELQEMWKRLGHELELRGKRLEDALRAQQFYRDAAEAEAWMGEQELHMMGQE-KAKDELSAQAEVKKHQVLEQALADYAQTIHQLAASSQDMIDHEHPESTRISIRQAQVDKLYAGLKELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSRDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALARVQHKQ--QQLPDGTGRDLNAAEALQRRHCAYEHDIQALSPQVQQVQDDGHRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDEVNLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGKELLARSHYAAEEISEKLSQLQARRQETAEKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESLIKRHEAFQKSAVAWEERFCALEKLTALEEREKERKRKREEEERRKQPPAPEPTASVPPGDLVGGQTASDTTWDGTQPRPPPSTQ-------APSVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRGPAPSAMPQ-----SRSTESAHAATLPPRG-PEPSAQEQMEGMLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAASAGVP--YHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEPVVPSTTRGMTR------AMTMPP 2357          
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Match: sp|Q9QWN8|SPTN2_RAT (Spectrin beta chain, non-erythrocytic 2 OS=Rattus norvegicus OX=10116 GN=Sptbn2 PE=1 SV=2)

HSP 1 Score: 1251.5 bits (3237), Expect = 0.000e+0
Identity = 783/2393 (32.72%), Postives = 1299/2393 (54.28%), Query Frame = 1
Query:  193 SKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCD--QDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLN-------------TDRQFINE---ALINIEQ---TAEHEVHEIIQPITEN-------VQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSS--LPPQAQ 7260
            +++FERSRIKALADERE VQKKTFTKW+NS L  VT ++ DLY DLRDG+ LL LLE+LS E +PKPT+GRMRIHCLENVDK L FL  QKVHLEN+G+HDIVDGN RLTLGL+WTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VN+ NFT SWR GL F A++HKHRPDL+DF S  + +   NL  AF++AE  LG+  LLDPEDVNV  PDE+S+ITYVA+YYHYF+ +KA +V  KR+ K+L+  +E E +++ Y+SL S+LL+WI  TI  LN RQ +NS+ G+Q Q+ +FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA +F++KAA+RE+W+++N  L+ + + G  L  V AA++KHEAIETDI AY   +  +  ++  L  E Y+DI  I   +N V  LW  L + +  RRE L   L++  +  +   +   +  +  + +  + GKHL  VE+LL+ HEL+E+DI    +R+  + + A R   FCD  +++R      +  ++ E+  +  + +  L +    R+  L+ S  +W+F+ +    E W++E   ++ + + G DL+ V RLL KH     E+S +   L+  L +G+ LV     G    + +  ++Q  WE L    E R  +L +    YQ+ +D +D E W+ +  RL     +G     T+ L R+++   E +  +R  ++ +R QA + L  ++     V  ++  +E+ Y++L   A +    L  AL  Y +L+++ +   W+ EK+++L      + +E+LEV++ RFE  E E+   A +V  V++++E L+    P    I+  Q+ LN  W +   + D K+  L S     N+ ++C +T  W+REK K+IES  +LG DL  V+  QR++   +RD+ AI A++  L  + + +   +   A  I  +L  V   WE L+  +R R+ +L     +  F++ LDDF  WLG+ QT +AS+  P +  EAE L+ ++ + R E+   + +      +G++  + + D  Q + L+ R+E++   W+ L  + E ++ RL +      F  DARQ E +L++QE +L         +       L + +  + + E F+  M ++ + +  +L+ G+ L+ + N++ +++Q K  ++++R +KN  A Q    +L++       LQD  +L   + EK+    ++S    ++  +   + +A   E+ A +  +++++K G++ + + P  K  + + L++L+  W EL    + K ++L   NR +LF +S  ++  WL++++ Q+ +DD        +TS+   LKK      E+  ++K +E ++  ++ L Q++   A + E+    V+     L  P++ +           QF +D +DEI W+ E++ +    +  +E    L   Q L  ++++++ EI+    ++  L +E QR      L  A     + +L++  + L+ E+E     L   L  Q+F  D +E  +W+ E+EL +MG    +KD+   +  ++K Q LE  + +Y   I++   S   +     P+  +  ++   V+  +  LK +  E++  +   +  C       ++E WI ER  +A S + G+D +  T+LRD+F  FS +T+ IG  +V+ AN   + LI G H    +++ WKD +NE WADLLEL+DTR Q+L +A++L R+   ++  L  +Q K+   ++ +  G+D  +   LQR+   +E D+  L + +         L   Y  DK   + +  Q + +A+  L+     R+   L+  D   F   VREL+ W++ + +QM+ + +PRDVS  +L++ N + +K E++++ + FS C+++G+ LL   H  + EI  K  ++  +R    +KW   +D L L++EV  + RDA  AEAW+ SQE  + +  LG T+DE  +L+K+   FQK+ +  EE+F  L++LT +E R  +               T     ++   +L++ ++   TA       + P T+          T   +P++       QQ + + N          E   +G   + +  +   +  P+  A SP+PQ + S+       S  V  L      LSA  +             M+G L RK + E  N+KA+NR+W ++Y +L +  + F+KD R         Y  E+P+ L     + A DY KR  VF++  ++G EYLFQ     +M+ W+  +N+A       +     P    +   L+ +  +PP +Q
Sbjct:   40 ARLFERSRIKALADEREAVQKKTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHAMEAEHLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAEHYHDIKRIAARQNNVARLWDFLREMVAARRERLLLNLELQKVFQDLLYLMDWMAEMKGRLQSQDLGKHLAGVEDLLQLHELVEADIAVQAERVRAVSASALR---FCDPGKEYRPC----DPQLVSERVATLEQSYEALCELAATRRARLEESRRLWRFLWEVGEAEAWVREQQHLLASAETGRDLTGVLRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGANQASTRAAELQAQWERLEALAEERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPEVGHDEFSTQALARQHRALEEEIRAHRPTLDALREQA-AALPPALSHTPEVQGRVPTLEQHYEELQARAGERARALEAALAFYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPEMNALAARVTAVSDIAEQLLKASPPGKDRIIGTQEQLNQRWQQFRSLADGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQDLGNDLAGVLALQRKLAGTERDLEAISARVGELTQEANALAAGHPAQAPAINTRLGEVQTGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRTLGEEVTRDQADP-QCLFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYFL---------SHTEMPGTLQAADAAIKKLEDFMSTMDANGERIRGLLEAGRQLVSKGNIHAEKIQEKADSIEKRHRKNQEAVQQLLGRLRDNREQQHFLQDCQELKLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKVLVSEKLEDLHRRWDELETTTQAKARSLFDANRAELFAQSCSALESWLESLQAQLHSDD----YGKDLTSVNILLKKQQMLEREMAVREKEVEAIQAQAKALAQED-QSAGEVERTSRAVEEKFRALCQPMKDRCRRLQASREQHQFHRDVEDEILWVTERLPM----ASSLEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADL-KERQRT-----LGTAAAGPELAELQEMWKRLSHELELRGKRLEEALRAQQFYRDAAEAEAWMGEQELHMMGQE-KAKDELSAQAEVKKHQVLEQALADYAQTIKQLAASSQDMIDHEHPESTRLTIRQAQVDKLYAGLKELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSRDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALARVQHKQ--QQLPDGTGRDLNAAEALQRRHCAYEHDIQALSTQVQQVQDDGLRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDGINLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSACIDMGQELLARNHYAAEEISEKLSQLQSRRQETAEKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESLIKRHEAFQKSAVAWEERFSALEKLTALEERENEQKRKREEEERRKQPPTSEPMASQPEGSLVDGQRVLDTAWDGTQSKLPPSTQAPSINGVCTDTESSQPLLE------QQRLEQSNV--------PEGPGSGTGDESSGPRGERQTLPRGPAPSPMPQSRSSE-------SAHVATLPARGAELSAQEQ-------------MEGTLCRKQEMEAFNKKAANRSWQNVYCVLRRGSLGFYKDARAASAGVP--YHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEPVVPSASRGLTRAMTMPPVSQ 2360          
BLAST of Spectrin beta chain vs. TrEMBL
Match: A0A5J4NLG0 (Spectrin beta chain OS=Paragonimus westermani OX=34504 GN=DEA37_0004144 PE=3 SV=1)

HSP 1 Score: 1674.83 bits (4336), Expect = 0.000e+0
Identity = 975/2402 (40.59%), Postives = 1435/2402 (59.74%), Query Frame = 1
Query:  148 NALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEM-EKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEI-SLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTF--FKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHK-----GLKRFFSSIRLK 7305
            N  SDED+ +  N T+K++ERSRIKALADERE VQKKTFTKW+NS L  V+  IEDLY+DLRDGK LL LLE+LS E +P+PTRG+MRIHCLENVDK L FL +Q VHLENVGAHDIVDGNPRLTLGLIWTIILRFQ+QDI  +E  +   + AKDALLLWCQMKTAGY +VN+RNFT SWR GL F ALIHKHRPDLI +S  ++ D + NL  AF++AE  L +  LLDP DV V  PDE+S+ITYV +YYHYFN +KA +V +KR+ K++NQ +E E+MI  Y+ L S+LLEWI  TI LLN R FSNS+ G+Q Q+  FN YRT EKP KF EK  LEVLLFTI+S    +    YNPPE   ++ IN AW+ L  AE+ RE ALR EL+RQEKL  LA +F++KA LRE+W+TDN  L+ + + G +L  V AA KKHEAIETDI+AY+E +  +  +++ LE E Y+D   I   ++ V+ LW  LL +L  RR  LD  LQ+  +  E   +   I  I  + R  +YGKHLM VE+L++ H LIE+DIR +  R+E+++ +A  ++         +       +++E+       + +L D  D R + L+ S  +WQF  D   E++WIKE   +M++PDLG+DLSSV RLLRKHK  E E     + L+N L  G  L++   +  E IA +  ++  LW+ LVD    RK +L+E  +++Q+++DCDDA+ W+ E +R    + +G K++ TE L++ NQ+ +  +++Y+  I+Q+  QA  +  Y   D  T+A +LD I+K Y D+  +A   Q++LLDAL++Y+L + SD+VR W+TEK+K L   +PSD+I ELEV++HRFE FE ELT  AEKV  VN LSE ++   +P+   I+ +QD LN SWN++AD+VD ++ +L   Y Y+ F ++  +T  WI+EK KLIES DELG DL  +MQ QRR+  +QRD+ AIEAK++HL  Q DE+ +        +E +   +H+ W  L+++++DRD  L   +++ RF+Q LD F  WL + QT++AS++IP +  EAE L++K+     E++  E      M+ G+     + D  Q+  L  R++ I +DW  L+++ +++ + L++ +++  FF DA Q +  L   E+ L+K+            ++L +  E + + EI    +L ++  +  +L  G+ LI       ++MQ KC  L  R          RK  L+EQ+ L E  QD+DD ++ L EK   + E      K+      + KA E E++A +  I ++ + G+Q     P  + +I   L  L   W EL+    +K   +A  NRE LF+E+ +SMM W+  +  QIV   E      G+  +   LK  D  + EL +K+++LE++  H+E LK+Q P++  ++EQ+  +V++ +  L  PL ++     ++    QFL+D +DE DW+ +K+ LI + SK      +LL  QQL  RH+ + NE+ N   +++S+ QE ++MI ENH +     + +++L      L + + ++ + +L N++A Q++L D SE  +W+ E+EL LMG    +KD+Q     ++K +  +  ++NY  +I    +   ++     P+      K   V+  +  L+ +C E++  +  +  +YC   E+  ++EAWI ER  +A S + G D + C LLR+RF  F+ ETN++G  +V  AN+  D LI   H  A  I+ WKDR+NE WADLLELIDTRIQLLK+AWDLH++  D Q +L+ I EK SS  +  ++G+D K+V+ LQRK   FE DL +L + +   I  +NTLLP Y  DKE  +  +R E+I A+R L+   E RK++ L+ AD H F +MVREL  W+E +  +M  + KPRDVSG+ELL+ NHRSLK E+D++EENFSICL+LGRTLL  +H R  +++ KC ++  +R  L  +W    + L L++EVYQ+ARDA  A+AW+++QE YL +++LG TLDETLALLKK + F++A   QEE+F  L+RLTT+E++++                E+T          P TE  +  E +  I     +            S +D                     RP   S    PV Q+  +  P+    SK              S +P       P +   +G L RKH+W++  +KA +R+WH LY +LS S  T   +K++R  +EKP + Y+HE P+ L    AAPA +Y KR  VFR++  NG E LFQ  S   M  WV AIN+    +    P  +  +       L S + P++Q        G K+FF+  R K
Sbjct:   21 NYTSDEDDFESGNSTAKLYERSRIKALADEREVVQKKTFTKWVNSHLSVVSCNIEDLYLDLRDGKMLLKLLEILSGERLPQPTRGKMRIHCLENVDKSLNFLCDQHVHLENVGAHDIVDGNPRLTLGLIWTIILRFQIQDIIVEEYQTSETRCAKDALLLWCQMKTAGYHNVNVRNFTTSWRDGLAFNALIHKHRPDLIKYSELSKADPMKNLTNAFNVAEEKLHLTPLLDPSDVCVEQPDEKSIITYVVTYYHYFNKMKADTVHSKRIGKVVNQAIETEEMINQYEQLTSELLEWIEKTIELLNNRTFSNSLSGVQHQLAGFNTYRTIEKPPKFEEKGGLEVLLFTIRSKLRANNQTSYNPPEGRLIADINRAWEHLERAEHARELALRDELIRQEKLEQLASRFDRKAGLREAWLTDNQRLVAQDNFGQDLAAVEAATKKHEAIETDIFAYQERVNAMVNVAEELERENYHDQERIQLRRDNVMALWTNLLSSLSLRRHRLDLSLQLQHVFQEMAYLMDWIEEIKGRLRSVDYGKHLMGVEDLIQKHNLIEADIRVLGGRMEQVLQQAEPFITCAFPQEVGSYKPIEPEVVQERGRELRAAYEDLHDLKDTRLQGLQDSKKMWQFFWDMEDEKEWIKEKSQLMSSPDLGHDLSSVARLLRKHKALEEECKVHHVVLQNALKNGDKLIEEGNMSNEQIAQRIVEMNQLWDQLVDQIAERKQRLIESQEFFQFMADCDDADVWLSEQQRNASNEDVGLKLATTETLLKNNQEVINNLDDYQKTIDQLHQQAGIVSDYPDCDAATIASRLDAIDKHYADVQGLAKLRQQRLLDALSMYKLFDVSDTVRMWLTEKEKLLTTLVPSDEI-ELEVIRHRFECFEKELTANAEKVETVNKLSEGMLGTDHPDGSKILEHQDVLNASWNELADLVDRQKRQLDLAYQYNQFLIESTETANWIKEKAKLIESTDELGNDLSGIMQLQRRLGGLQRDLKAIEAKVEHLDNQADELRQAKPEHEPVVEAERQKIHELWNELKEMLKDRDDRLNYSSELQRFLQDLDHFQMWLRRTQTDVASEDIPNNLQEAEALVDKHKQLGAEISGYEDDFRRLMEFGRRETAGQTDA-QYEFLAKRLDLIEEDWDALHNMFDKRGEILDQNVEAHTFFRDALQADVNLAKLEQALVKE---------EIPTSLEAAQENIRQWEITQASLLMNDDKIDNILAHGQDLIDRKIFPMEKMQAKCDQLQNRRDSLKKRLDERKVVLEEQLKLLEFYQDVDDAEEWLTEKAVAVTEQPTPLAKNIALLYGRFKAFEGELDANKDKIAKVIEEGEQLMEVHPVLEPQIAPRLTALQHQWDELNTTAADKSAKMADANREILFDETAKSMMTWITEVSSQIVTTTEEVTEEIGLVELNEHLKDQDRKDQELLSKRRMLEDMATHAEKLKEQYPERQEEFEQVHQEVRIRLTELEAPLANRRDRLLKQKRVRQFLRDIEDEKDWIKDKLALIEDSSKLGN---SLLAAQQLLRRHRMLANEVENHRPRIESVCQEGEQMIQENHPRSDRFREAIDELWDLWGQLEQVVSDRHRKLLENEVA-QQYLFDASEAEAWMGEQELYLMGEE-RAKDEQGANNAMKKHEQRQKIVENYATEIRNLGERSRAMIETNHPEAEAVAAKQARVDKMYAGLRDLCVERRARLEEILKLYCLLREIL-DLEAWIAERIAVASSHELGADYEHCCLLRERFAEFARETNELGKCRVGAANELCDALIDQGHGEAAEIAGWKDRVNEAWADLLELIDTRIQLLKTAWDLHKFLSDCQDVLDRIAEKASS--IPEEVGRDAKAVATLQRKHGTFEYDLSRLGAQVEGLIEAANTLLPSYAADKERLICDRRDEVIHAWRQLQCSTEQRKVHLLDAADVHRFFAMVRELRMWMEVMRTEMATKEKPRDVSGVELLMNNHRSLKAEIDAREENFSICLSLGRTLLNRRHPREEDVREKCIQLVTERIQLTDQWTERWETLQLLLEVYQFARDAEVADAWLMAQEPYLASKDLGETLDETLALLKKHLAFERAVATQEERFVALQRLTTLELKAR----------------ERT----------PETEAARRAEKERRIAEAIREFLPPPVIPPVPVSEVD---------------------RPVSDSRISEPVSQIPST--PKRGRESKD-------------SGRP-------PRD--FEGVLTRKHEWQSGGKKAPSRSWHELYFILSASAGTLSAYKEQRLAREKPGELYRHESPVSLVGASAAPAFNYAKRRFVFRLKLSNGGETLFQARSEEAMHEWVQAINAVITSLPPGQPIESTSAAGGRAATLPSGVQPESQAGSSSVTTGKKKFFTLGRKK 2332          
BLAST of Spectrin beta chain vs. TrEMBL
Match: A0A0X3PMM5 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR158569 PE=4 SV=1)

HSP 1 Score: 1659.81 bits (4297), Expect = 0.000e+0
Identity = 956/2385 (40.08%), Postives = 1441/2385 (60.42%), Query Frame = 1
Query:   85 MEICVPYLNGNYCDSLSSDYQNALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGN-KAMIKEKRNSTIK-DFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNK-STDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPL-ESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLPDEYKGIVKD--------------VEDNFNSLKIICAEKKTEI-SLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEI---IQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTF--FKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSAS 7167
            MEI   + N ++  + ++   N  SDED+ +  N T+K++ERSRIKALADERE VQKKTFTKW+NS L  V   IEDLY+DLRDGK LL LLE+LS E +PKPTRG+MRIHCLENVDK L FL +Q VHLENVGAHDIVDGN RLTLGLIWTIILRFQ+QDI  +E  +   + AKDALLLWCQMKTAGY +VN+RNFT SWR GL F ALIHKHRPDLID++  ++   + NL  AF +AE  LGI  LLDP DV V  PDE+S+ITYV +YYH+FN LKA SV +KR+ K++NQ +E  ++   Y+ L S LL WI+NTI LLN R F+NS+P +Q Q+  FN YRT +KP KF EK  LEVLLFT++S    +  KVY P E  S++ IN AW+ L  AE+ RE ALR EL+RQEKL  LA +F++KA +RE+W+++N  LL + + G++L  V AA KKHEAIETDI AYEE +  +  +++ L+ E Y D   I   +  VL LW+ LL  L +RR  L   L++  +  E   +Q  I  I  + + ++YGKHLM VE+LL+ H L+E+DIR ++ RL  ++ +A     F D +F  NI+    +  + EKR   ++  + +L D    RK  L  S  +WQF  D   E++WIKE   +M++PDLG+DLSSV+RLLRKH+  E E  ++    +  L  GK L++    G+E +  + +++++LW+ L D T  RK +L E  +++Q ++DCDDA+ W+ + +R+   + +G KMS TE L++ NQ+ ME +E YR+ + Q+   A  +  Y  +D   +A +LD ++K Y   +++A   Q++LLDAL++Y+L + SD+VR+WITEK+K L    PSD+IEELEV++HRFE FE E+T  AEKV +VN LS +L+   +P+ Q IV +QD LN +WN++AD+V+ ++ +L   Y Y+ + ++C +T  WI+EK  LIES DELG DLE +MQ QRR++ +QRD+ AI+AKID++  Q D +      +++ I+ +   +H  W+ L+ +I++RD  L + +++ RF+Q  D F  WL +MQT +AS+++P + +EAEKL+  +   R E+          M++G+   +++ D  Q+V L  R++ I ++W  L  + +++EK L++ L++  FF DA Q + I+N QE ++ K++           ++  +L E +  +E F+  + + ++ +  V+  G+ L        +++Q KC  L++R       AQ R   L +Q  L    QD+DD+++ + EK  V        ++    +  ++ K  E E++A +  IE++ + G+Q   + P  + +I   ++ L   W +L+    ++   LA  NRE LF+E+ +SM+ W+  I  QIV   E      G+  +  Q+K  +    EL  K+K+LE++  H+E LK+Q P++  ++EQ+  +V++ +  L  P+ + +  +A QK I  QF +D +DE DW+ EK+ L+ + ++      +LL  QQL+ RH+ + NE+ N   +++++  E + MI+E H   A V + +++L     +L + +   Q+ L      Q++L D SE  +W+ E+EL LM     +KD+Q     ++K + L+  I+NY  +I        SL D  + +++               V+  +  L  +C E++  +  +  +Y    E+  ++EAWI ERT IA S + G D + C LLR+RF  FS ETN++G  +VN AN+  D LI   H  A  I+ WKDR+NE WADLLELI+TRIQLLK+AWDLH++ CD Q +L+ I EK  +  +  D+G+D K+V++LQRK   FE +L +L   +   +  + TLLP Y  DKE  +  +R E++ A+R L+   E RK++ L+ +D H F +MVREL  W+E +  +M  + KPRDVSG+ELL+ NHRSL+ E+D++EENFSICL+LGRTLL   H R  EI+ KC ++  +R +L ++W +  +HL L++EVYQ+ARDAA AEAW+I+QES++ + +LG +LDETLALLKK + F++A   QEE+F  L++LT +E+++                 E+T E E   +    Q I+E  + F                                             Q   +P P + A + V        P    +  P  + S+   + S  P P+           ++  L+RKH+WE+  +KAS R+WH LY +LS +  T   +KD++H  EKP   Y  E P+ L   VA PA +Y KR  VFR++  NG E LFQ  S  +M  W++AIN+ S
Sbjct:   29 MEIQTLHQNLHWDQNSAAQANNYTSDEDDFESGNSTAKLYERSRIKALADEREIVQKKTFTKWVNSHLAVVNDHIEDLYLDLRDGKVLLKLLEILSGERLPKPTRGKMRIHCLENVDKSLNFLCDQHVHLENVGAHDIVDGNQRLTLGLIWTIILRFQIQDIIVEEYQTSETRCAKDALLLWCQMKTAGYNNVNVRNFTTSWRDGLAFNALIHKHRPDLIDYAKLSKASPLQNLQNAFSVAEEKLGITPLLDPADVCVEQPDEKSIITYVVTYYHFFNKLKADSVHSKRIGKVVNQAIESSELTNQYERLTSDLLTWIQNTIELLNDRVFANSLPDVQHQLAGFNTYRTIDKPPKFAEKGALEVLLFTLQSKMRANNQKVYTPTEGKSIADINRAWENLERAEHARELALRDELIRQEKLAQLATRFDRKAGMREAWLSENQRLLAQYNFGSDLAAVEAATKKHEAIETDISAYEERVNAVVSVAEELQLENYYDNDRIQARRETVLRLWQNLLDLLRKRRSCLALSLELQHVFQEMSYLQDWIDEIGNRLKSEDYGKHLMGVEDLLQKHGLLEADIRVLDGRLNHVLEQAQ---VFIDCNFPDNIDYRPIEPDVVEKRGRDLRAAYDQLHDLAATRKHALDDSRKMWQFFWDMDDEKEWIKEKSQLMSSPDLGHDLSSVERLLRKHRALEEECQTRHGVFQASLDSGKKLIEEDNRGKENVQRRIDEMRDLWDQLADQTAERKQRLQESQEFFQLMADCDDADAWLLDQQRIASNEDVGVKMSTTESLLKINQELMENLEAYRETVNQLHATAAKVSDYPDIDGGMIASRLDGVDKNYSKAIELAKLRQQRLLDALSMYKLFDVSDTVRTWITEKEKLLTTLCPSDEIEELEVIRHRFECFEKEMTSNAEKVGNVNKLSASLLDKDHPDAQQIVVHQDTLNATWNELADLVEKQKGQLDLAYQYNQYLIECTETANWIKEKEHLIESTDELGNDLEGIMQLQRRLSGLQRDLQAIQAKIDYVDEQADLLEAAKPEASEVIQTERKKLHDLWDELKDMIKERDDRLNDSSELQRFLQDFDHFQMWLRRMQTTVASEDVPNTLTEAEKLVQDHEQVRMEIDGYADDFNRLMEMGRKVTENQTDP-QYVYLAQRLDVIAENWDALQKMCDDREKVLKQDLEAQTFFRDAIQSDVIINKQENFVSKEV----------PTSPEALQEAIQSHESFMAALPASDEKIDHVIAVGRELAARGVFPTEKIQLKCDQLEQRRAAVKQKAQERSALLAQQGQLQGFCQDVDDVEEWIAEKNIVAQAAPPPRDQFGIAAIYSKFKTFESELDANKDKIEKVIQAGEQLMLEQPELQAQIEPRVEVLRRQWDDLNTQAVDQSAKLADSNREALFDETAKSMLTWITEISSQIVTTTEEVTEEVGLVELNEQIKDQEKKEQELVAKRKMLEDMATHAEKLKEQYPERKDEFEQVHREVRIRLTELEAPMADRRERLAKQKRI-RQFFRDLEDEKDWVREKLQLLEDSNRLGN---SLLSCQQLKRRHRMLANEVDNHHPRIEAICNEGETMINEGHPHAANVREGIDELHALWADLQKAVAARQDALDLNEVAQQYLFDASEAEAWMGEQELYLMS-SEKAKDEQGANSAMKKHELLQKTIENYAGEIR-------SLGDRSRAMIEGNHPEAEAVASKQSRVDRMYAGLHDLCLERRLRLEEILKLYSLLREIL-DLEAWIAERTVIASSHEMGADYEHCCLLRERFAEFSRETNELGKHRVNAANELCDALITQGHGEAAEIASWKDRVNEAWADLLELIETRIQLLKAAWDLHKFLCDCQDVLDRIAEKAGA--IPEDVGRDAKAVAVLQRKHIAFESELTRLGQQVEEVVEFATTLLPSYAGDKERIICDRRDEVVQAWRQLQYSAEQRKVHLLDASDVHRFFAMVRELRLWMEMMQTEMSSKEKPRDVSGVELLMNNHRSLEAEIDAREENFSICLSLGRTLLNRNHPRQEEIREKCIQLVTERILLSEQWNDRWEHLKLILEVYQFARDAAVAEAWLIAQESFIKSSDLGESLDETLALLKKHLAFERAAATQEERFLALQKLTHLELKAS----------------ERTPESEAARLELRKQKISEATREF---------------------------------------------QPPKQPVPLTPAQASVAAAGVGSAPGRPGVETPT-SRSIRESIDSGRPPPSN----------LEALLHRKHEWESATKKASARSWHELYFVLSAATGTLSAYKDQKHAHEKPGDLYHKEAPVSLAGAVAVPATNYEKRMYVFRLKLENGGESLFQARSDDEMHNWIEAINAIS 2312          
BLAST of Spectrin beta chain vs. TrEMBL
Match: G4VDE6 (Spectrin beta chain OS=Schistosoma mansoni OX=6183 GN=Smp_143470.2 PE=3 SV=1)

HSP 1 Score: 1659.43 bits (4296), Expect = 0.000e+0
Identity = 950/2411 (39.40%), Postives = 1433/2411 (59.44%), Query Frame = 1
Query:  148 NALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKD--------IQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNI---EAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTF--FKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQ-----HHKGLKRFFSSIRLK 7305
            N  SDEDE +  N T+K++ERSRIKALADERE VQKKTFTKW+NS L  V+  IEDLY+DLRDGK LL LLE+LS E +P+PTRG+MRIHCLENVDK L FL +Q VHLENVGAHDIVDGN RLTLGLIWTIILRFQ+QDI  +E  +   + AKDALLLWCQMKTAGYP+VN+RNFT SWR GL F ALIHKHRPDLI++S  ++++ I NL  AF +AE  L +  LL+P DV V  PDE+S+ITYV +YYHYFN +KA +V +KR+ K++NQ +E + MI  Y+ L S LL+WI+ TI+LL+ R F+NS+ G+Q Q+  FN YRT EKP KF EK  LEVLLFTI+S    +  + YNPPE   ++ IN AW+ L  AE+ RE A+R EL+RQEKL  LA +F++KA +RE+W+TDN  L+ ++  G+NL  V AA KKHEAIETDIYAYEE +  +  +++ L+ E Y+   +I   ++KVL +W+ LL +L  RR+HL+  LQ+  +  E   +   I  I ++ +  +YGKHLM VE+LL+ H L+E+DIR +  R+ +++ +A  ++                 +++E+       + +L D  + R   L+ S  +WQF  D   E++WIKE   +M++PDLG+DLSSV RLLRKHK  E E    R  LE+ L  G+ L+     G E I+ +  ++  LW  LVD    RK +L+E  D++Q ++DCDDA+ W+ + +R+   + +G K + T  L++ NQ+ M+ ++NY++ I Q+   A  +  Y   D   +A +LD +++ Y  + ++     ++L DAL++Y+L +DSD+VR+WITEK+K L   +PSD+IEELEV++HRFE FE E+   A+KV  VN LSE ++   +P+ + I+ +QD LN SWN++AD+VD ++ +L   Y Y+ F ++  +T  WI++K KLIES DEL  +LE +MQ QRR+  +QRD+ AIEAK+ HL  Q  E+      +   +  + + +H  W  L++++++RD  L + +++ RF+Q LD F  WL + Q  +AS+ +P +  EAE L++++   + E+   E      M  G+   + + D  Q++ L  R++ I ++W+ L  + E +   L++ +++  FF DA Q E +L   EK + K+         Q  + NF T +++L+  +E        ID +L+D          G  L+       +++QNKC+ L +R             KLKEQ+ L E  QD+DD ++ L EK   + E      +S  +   + KA E E++A +  I ++ + G++     P  + ++   +  L   W +L+    +K   +A  NRE LF+E+ +SM+ W+  +  QIV   E      G+  I   LK  +  + EL  K+++L+++  H+E LK+Q P++  ++EQ+  +V++ +  L  PL  +     ++    QFL+D +DE DW+ EK+ LI +  K      +LL  QQL  RH+ + NE+ N   ++D++  E ++MI E H +     + +++L    E L   + + Q  L+     Q++L D SE  +W+ E+EL LMG    +KD+Q     I+K + L+  ++NY  +I    + C +L     P+    + K   ++  +  L+ +C+E++  +   +     Y L ++I   EAWI ER  +A S + G D + C LLR+RF  FS ETN++G  +++ AN+  + LI   H  A  I+ WKDRINE WADLLELIDTRIQLLK+AWDLH++  D Q +L+ I +K SS  +  ++G+D K+V+ LQRK   FE +L +L S +   +  +N+LLP Y  DKE  +  +R E+I A+R L+   E RK    + +D H F SMVREL  W++ + ++M  + KPRDVSG+ELL+ +HRSL  E+D++EENFSICL+LGRTLL  +H +  E+++KC ++  ++ +L  +W    + LSL++EVY++ARDA  A+ W+ SQE+YLNN +LG TLDETLALLKK   F++A   QEE+F +L++LTT+E++++                E+T          P TE  +  E +  I    ++ Q      +    +   +           V+ R   +R   Q S+  P     +  R   S++ KP     VS D                     +G L RKH+WE   +KAS+R+WH LY +LS +  T   +K++RH KE+P   Y+HE+P+ L    AAPA +Y KR  VFR++  NG E LFQ  S  DM  WV AIN+ +       P+ ++ S       L S + P++Q        G K+FF+  R K
Sbjct:   21 NYTSDEDEFESGNSTAKLYERSRIKALADEREVVQKKTFTKWVNSHLSVVSCNIEDLYLDLRDGKMLLKLLEILSGERLPRPTRGKMRIHCLENVDKSLNFLCDQHVHLENVGAHDIVDGNSRLTLGLIWTIILRFQIQDIIVEEYQTSETRCAKDALLLWCQMKTAGYPNVNVRNFTTSWRDGLAFNALIHKHRPDLIEYSKLSKSEPIKNLTTAFSVAEEKLNLHPLLEPSDVAVEQPDEKSIITYVVTYYHYFNKMKADTVHSKRIGKVVNQAIETDDMINQYEQLTSDLLDWIKKTIKLLDDRTFANSLSGVQHQLAGFNTYRTVEKPPKFREKGGLEVLLFTIRSKMRANNQRQYNPPEGKMIADINRAWEMLERAEHARELAVRDELIRQEKLEQLASRFDRKAGMRETWLTDNQRLVLQEFFGDNLAAVEAATKKHEAIETDIYAYEERVNAMVNVAEELKRENYHAHENIQLRRDKVLAMWRNLLDSLSIRRQHLELSLQLQHIFQEMTYLMDWIEEIKSRLKSQDYGKHLMGVEDLLQKHNLLEADIRVLGGRMNQVVDQATPFIVGSFTPDMGAYKPIEPEIVQERTEKLRAAYDDLHDLAEARLRGLRDSREMWQFFWDMEDEKEWIKEKSQLMSSPDLGHDLSSVSRLLRKHKALEEECQMHRAVLEDALKHGEQLITDGNQGYEQISQRIVEMNQLWGQLVDLITERKQRLIESQDFFQLMADCDDADVWLTDQQRIVSNEDVGLKQATTVSLLKNNQEVMDNLQNYQETISQLNQDASRVSDYPDSDATAIAHRLDAVDQHYALVKELCRLRHKRLNDALSMYKLFDDSDTVRTWITEKEKLLTTLVPSDEIEELEVIRHRFECFEKEMAGNAKKVGSVNLLSEEMLDKAHPDAEKILRHQDELNASWNELADLVDKQKRQLDLSYQYNQFLIESSETANWIKDKAKLIESTDELDNNLEGIMQLQRRLGGLQRDLNAIEAKVKHLDEQAQELTEAKPETQAVVIAEKEKIHDLWNELKEIVKERDDRLNDSSELQRFLQDLDHFQIWLRRTQITVASEEVPNNLEEAETLLDQHEQLKAEIDGYESDFHRLMDFGRRVTEVQTDA-QYMFLAQRLDGIEENWEALRRMYENRTSALQEGVEAQTFFRDALQAEVLLAKMEKVVSKEEAPTNLEMAQENLRNFETFRTSLVPTDEK-------IDNVLND----------GAKLVDRGIFPTEKIQNKCEQLKQRRDSLKRRTDEHGQKLKEQLHLQEFCQDVDDAEEWLSEKAMAITEQPAPIARSIAALYGRFKAFEGELDANKEKIAKVIEEGEELIVAHPMLQVQVEPKISALRKQWEDLNTTTADKSAKMADANRETLFDETAKSMLTWITEVSSQIVTTTEEVTEEIGLVEINEHLKDQERKDQELAAKRRMLQDMATHAEKLKEQYPERREEFEQVHQEVRIRLTELEAPLADRRDRLVKQKRVRQFLRDIEDEKDWIKEKLALIEDSCK---LGSSLLATQQLIRRHRMLSNEVDNHRPRIDAVCHEGEQMILEGHPRSDRFREAIDELWVLWEQLQHVVGERQEQLARNEVAQQYLFDASEAEAWMGEQELYLMGDE-RAKDEQGANNAIKKHEQLQKTVENYATEIRGLGERCQALLEANHPESEAVVAKQARIDKMYAGLRDLCSERRARLDEIL---KLYHLLRDILDLEAWIAERILVASSHEVGADYEHCCLLRERFAEFSRETNELGKYRISAANELCNALIGQGHSEAAEIASWKDRINEAWADLLELIDTRIQLLKTAWDLHKFLADCQDVLDRIVDKVSS--IPEEVGRDAKAVAALQRKHNTFECELARLGSRVEGIVEAANSLLPSYAADKERLICDRRDEVIHAWRQLQCSAEQRKARLHDASDVHRFFSMVRELRLWMDTIRMEMTTKEKPRDVSGVELLMNSHRSLMAEIDAREENFSICLSLGRTLLNRRHPQEEEVRNKCIQLVTEKILLNDQWAERWETLSLLMEVYEFARDAEIADTWLTSQEAYLNNTDLGETLDETLALLKKHFAFERAAATQEERFRELEKLTTLELKAR----------------ERT----------PETEAARQLEKERKIAEAVKEFQPPPPPVSVPVQTPVSE-----------VDRRAVDIRDAEQGSSRLPTVTTPRHGRG-SSDVGKP-----VSRD--------------------FEGVLTRKHEWETGTKKASSRSWHELYFVLSATSFTLSAYKEQRHAKERPGDLYRHELPVNLVGASAAPAYNYAKRRFVFRLKLSNGGESLFQAHSEEDMHSWVQAINAVASSA-SGQPTESSSSAGGRAATLPSGVAPESQVASSSSATGKKKFFTLGRKK 2340          
BLAST of Spectrin beta chain vs. TrEMBL
Match: A0A094ZSL4 (Spectrin beta chain OS=Schistosoma haematobium OX=6185 GN=MS3_05505 PE=3 SV=1)

HSP 1 Score: 1656.34 bits (4288), Expect = 0.000e+0
Identity = 948/2411 (39.32%), Postives = 1432/2411 (59.39%), Query Frame = 1
Query:  148 NALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKD--------IQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNI---EAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTF--FKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQ-----HHKGLKRFFSSIRLK 7305
            N  SDEDE +  N T+K++ERSRIKALADERE VQKKTFTKW+NS L  V+  IEDLY+DLRDGK LL LLE+LS E +P+PTRG+MRIHCLENVDK L FL +Q VHLENVGAHDIVDGN RLTLGLIWTIILRFQ+QDI  +E  +   + AKDALLLWCQMKTAGYP+VN+RNFT SWR GL F ALIHKHRPDLI++S  ++++ I NL  AF +AE  L +  LL+P DV V  PDE+S+ITYV +YYHYFN +KA +V +KR+ K++NQ +E + MI  Y+ L S LL+WI+ TI+LL+ R F+NS+ G+Q Q+  FN YRT EKP KF EK  LEVLLFTI+S    +  + YNPPE   ++ IN AW+ L  AE+ RE A+R EL+RQEKL  LA +F++KA +RE+W+TDN  L+ ++  G+NL  V AA KKHEAIETDIYAYEE +  +  +++ L+ E Y+   +I   ++KVL +W+ LL +L  RR+HL+  LQ+  +  E   +   I  I ++ +  +YGKHLM VE+LL+ H L+E+DIR +  R+ +++ +A  ++                 +++E+       + +L D  + R   L+ S  +WQF  D   E++WIKE   +M++PDLG+DLSSV RLLRKHK  E E    R  LE+ L  G+ L+     G E I+ +  ++  LW  LVD    RK +L+E  D++Q ++DCDDA+ W+ + +R+   + +G K + T  L++ NQ+ M+ ++NY++ I Q+   A  +  Y   D   +A +LD +++ Y  + ++     ++L DAL++Y+L +DSD+VR+WITEK+K L   +PSD+IEELEV++HRFE FE E+   A+KV  VN LSE ++   +P+ + I+ +QD LN SWN++AD+VD ++ +L   Y Y+ F ++  +T  WI++K KLIES DEL  +LE +MQ QRR+  +QRD+ AIEAK+ HL  Q  E+      +   +  + + +H  W  L++++++RD  L + +++ RF+Q LD F  WL + Q  +AS+ +P +  EAE L++++   + E+   E      M  G+   + + D  Q++ L  R++ I ++W+ L  + E +   L++ +++  FF DA Q E +L   EK + K+         Q  + NF T +++L+  +E        ID +L+D          G  L+       +++QNKC+ L +R       A     KLKEQ+ L E  QD+DD ++ L EK   + E      +S  +   + KA E E++A +  I ++ + G++     P  + ++   +  L   W +L+    +K   +A  NRE LF+E+ +SM+ W+  +  QIV   E      G+  I   LK  +  + EL  K+++L+++  H+E LK+Q P++  ++EQ+  +V++ +  L  PL  +     ++    QFL+D +DE DW+ EK+ LI +  K      +LL  QQL  RH+ + NE+ N   ++D++  E ++MI E H +     + +++L    E L   + + Q  L+     Q++L D SE  +W+ E+EL LMG    +KD+Q     I+K + L+  ++NY  +I    + C +L     P+    + K   ++  +  L+ +C+E++  +   +     Y L ++I   EAWI ER  +A S + G D + C LLR+RF  FS ETN++G  +++ AN+  + LI   H  A  I+ WKDRINE WADLLELIDTRIQLLK+AWDLH++  D Q +L+ I +K SS  +  ++G+D K+V+ LQRK   FE +L +L S +   +  +N+LLP Y  DKE  +  +R E+I A+R L+   E RK    + +D H F SMVREL  W++ + ++M  + KPRDVSG+ELL+ +HRSL  E+D++EENFSICL+LGRTLL  +H +  E++ KC ++  ++ +L  +W    + LSL++EVY++ARDA  A+ W+ SQE+YLNN +LG TLDETLALLKK   F++A   QEE+F +L++LTT+E++++                E+T          P TE  +  E +  I        + +R F      +    +   +    + + R   +R   Q S+  P     + +R   S++ KPV             P+              +G L RKH+WE   +KAS+R+WH LY +LS +  T   +K+++H KE+P   Y+HE+P+ L    AAPA +Y KR  VFR++  NG E LFQ  S   M  WV AIN  +       P  ++ S       L S + P++Q        G K+FF+  R K
Sbjct:   21 NYTSDEDEFESGNSTAKLYERSRIKALADEREVVQKKTFTKWVNSHLSVVSCNIEDLYLDLRDGKMLLKLLEILSGERLPRPTRGKMRIHCLENVDKSLNFLCDQHVHLENVGAHDIVDGNSRLTLGLIWTIILRFQIQDIIVEEYQTSETRCAKDALLLWCQMKTAGYPNVNVRNFTTSWRDGLAFNALIHKHRPDLIEYSKLSKSEPIKNLTTAFSVAEEKLNLHPLLEPSDVAVEQPDEKSIITYVVTYYHYFNKMKADTVHSKRIGKVVNQAIETDDMINQYEQLTSDLLDWIKKTIKLLDDRTFANSLSGVQHQLAGFNTYRTVEKPPKFREKGGLEVLLFTIRSKMRANNQRQYNPPEGKMIADINRAWEMLERAEHARELAVRDELIRQEKLEQLASRFDRKAGMRETWLTDNQRLVLQEFFGDNLAAVEAATKKHEAIETDIYAYEERVNAMVNVAEELKRENYHAHENIQLRRDKVLAMWRNLLDSLSIRRQHLELSLQLQHIFQEMTYLMDWIEEIKSRLKSQDYGKHLMGVEDLLQKHNLLEADIRVLGGRMNQVVDQATPFIVGSFTPDMGTYKPIEPEIVQERTEKLRAAYDDLHDLAEARLRGLRDSREMWQFFWDMEDEKEWIKEKSQLMSSPDLGHDLSSVSRLLRKHKALEEECQMHRAVLEDALKHGEQLITDGNQGGEQISQRIVEMNQLWGQLVDLITERKQRLIESQDFFQLMADCDDADVWLTDQQRIVSNEDVGLKQATTVSLLKNNQEVMDNLQNYQETISQLNQDASRVSDYPDSDATAIAHRLDAVDQHYALVKELCRLRHKRLNDALSMYKLFDDSDTVRTWITEKEKLLTTLVPSDEIEELEVIRHRFECFEKEMAGNAKKVGSVNLLSEEMLDKAHPDAEKILRHQDELNASWNELADLVDKQKRQLDLSYQYNQFLIESSETANWIKDKAKLIESTDELDNNLEGIMQLQRRLGGLQRDLNAIEAKVKHLDEQAQELTEAKPETQAVVIAEKEKIHDLWNELKEIVKERDDRLNDSSELQRFLQDLDHFQIWLRRTQITVASEEVPNNLEEAETLLDQHEQLKAEIDGYENDFHRLMDFGRRVTEVQTDA-QYMFLAQRLDGIEENWEALRRMYENRTAALQEGVEAQTFFRDALQAEVLLAKMEKVVSKEEAPINLEMAQENLRNFETFRTSLVPTDEK-------IDNVLND----------GAKLVGRGIFPTEKIQNKCEQLKQRRDSLKRRADEHGQKLKEQLHLQEFCQDVDDAEEWLAEKAMAITEQPAPIARSIAALYGRFKAFEGELDANKEKIAKVIEEGEELIVAHPMLQVQVEPKISALRKQWEDLNTTTADKSAKMADANRETLFDETAKSMLTWITEVSSQIVTTTEEVTEEIGLVEINEHLKDQERKDQELAAKRRMLQDMATHAEKLKEQYPERREEFEQVHQEVRIRLTELEAPLADRRDRLVKQKRVRQFLRDIEDEKDWIKEKLALIEDSCK---LGSSLLATQQLIRRHRMLSNEVDNHRPRIDAVCHEGEKMILEGHPRSDRFREAIDELWVLWEQLQHVVGERQEQLTRNEVAQQYLFDASEAEAWMGEQELYLMG-DERAKDEQGANNAIKKHEQLQKTVENYATEIRGLGERCQALLEANHPESEAVVAKQARIDKMYAGLRDLCSERRARLDEIL---KLYHLLRDILDLEAWIAERILVASSHEVGADYEHCCLLRERFAEFSRETNELGKYRISAANELCNALIGQGHSEAAEIASWKDRINEAWADLLELIDTRIQLLKTAWDLHKFLADCQDVLDRIVDKVSS--IPEEVGRDAKAVAALQRKHNTFECELARLGSRVEGIVEAANSLLPSYAADKERLICDRRDEVIHAWRQLQCAAEQRKARLHDASDVHRFFSMVRELRLWMDTIRMEMTTKEKPRDVSGVELLMNSHRSLMAEIDAREENFSICLSLGRTLLNRRHPQEEEVRKKCIQLVTEKILLNDQWAERWETLSLLMEVYEFARDAEIADTWLTSQEAYLNNTDLGETLDETLALLKKHFAFERAAATQEERFRELEKLTTLELKAR----------------ERT----------PETEAARQLEKERKI-------SEAVREFQPPPPPVSVPVQTPVS----EADRRAVDIRDAEQGSSRLPTVTTPRHERG-SSDVGKPV-------------PRD------------FEGVLTRKHEWETGTKKASSRSWHELYFVLSATSFTLSAYKEQKHAKERPGDLYRHELPVNLVGASAAPAYNYAKRSFVFRLKLSNGGESLFQAHSEKHMHSWVQAINVVASSA-SGQPMESSSSAGGRAATLPSGVAPESQVASSSSAPGKKKFFTLGRKK 2340          
BLAST of Spectrin beta chain vs. TrEMBL
Match: A0A5K3ET41 (Spectrin beta chain OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 1646.33 bits (4262), Expect = 0.000e+0
Identity = 952/2418 (39.37%), Postives = 1446/2418 (59.80%), Query Frame = 1
Query:   85 MEICVPYLNGNYCDSLSSDYQNALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKE---KRNSTIKDFHELLDSL-DKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVKD--VEDNFNSLKIICAEKKTEI-SLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHE---IIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTF--FKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQ--------SHPNLSSSLPPQAQH 7263
            MEI   + N ++  S  +   N +SD+D+ +  N T+K++ERSRIKALADERE VQKKTFTKW+NS L  V  ++EDLY+DLRDGK LL LLE+LS E +PKPTRG+MRIHCLENVDK L FL +Q VHLENVGAHDIVDGN RLTLGLIWTIILRFQ+QDI  +E  +   K AKDALLLWCQMKTAGY +VN+RNF+ SWR GL F ALIHKHRPDLI++    +   + NL  AF +A+  LGIP LLD  DV V  PDE+S+ITYVA+YYHYFN +KA +V +KR+ K++NQ +E  Q+I  Y+ L S+LL WI+ TI LLN R F+NS+P +Q Q+  FN YRT +KP KFVEK  LEVLLFT++S    +  KVY+PP+   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA +F++KA +RE+W+++N  L+ + + G++L  V AA KKHEAIETDI AY E +  +  +++ L+ E Y D   I   +  VL LW  LL  L +RR  L+  LQ+  +  E   +Q  I  I  + + ++YGKHLM V++LL+ H L+E+DIR ++ RL +++ +A  +V   D +F  N+  G + +  E   KR   ++  +E L  L D R++ L+ S  +WQF  D   E++WIKE   +M++PDLG+DL+SV+RLLRKH+  E E   ++    N ++ G  L++    G+E I  + +++  LW+ L D T  RK +L E  +++Q ++DCDDA+ W+ + +R+   + +G KMS TE LI+ NQ+ ME +E YR+ I  +   A  +  Y   D   +  +LD +++ Y   L++A + Q++LLDAL++Y+L + SD+VR+WITEK++ L    PSD I+ELEV +HRFE FE E+TK AEKV  VN LSENL+   +P+ Q IV  QD LN +WN +AD+V+ ++  + + + Y+ + ++CQ+T  WI++K  LIES DELG DLE +MQ QRR++ +QRD+ AI+AKIDHL  Q D ++      A+ I  +   +H  W+ L++++++RD  L + +++ RF+Q LD F  WL + Q  +AS+++P +  EAEKL+  +   + E+   E   +  M++G+  ++++ D  Q++ L  R++ I ++W  L+ + E+++K L++ +++  FF DA  ++K++N QE  + K++ S   + + +  NL            F   M ++++ ++ V+  G+ L        +++  KC  L++R +     A +R+ KL +   L   +QD+DD+++ + EK  +             +   + K  E E++A +  IE++   G+   A+ P  + EI   ++ L   W +L+   +E+   LA  NRE LF+E+ +SM+ W+  +  QIV   E      G+  +  Q+K  +    EL  K+K+LE++  H+E LK+Q PD+  ++EQ+  +V++ +  L  P+ ++     ++    QF +D +DE DW+ EK+ +I +  + M T  +LL  QQ+Q RHK + NE+ N   ++D++ Q+ + MI + H       + +++++    +L   ++  Q  L      Q++L D SE  +W+ E+EL LMG    ++D+Q     ++K + L+  I+NY  +I      C ++     P+      K   V+  +  L  +C E++  +  +  +Y    E+  ++EAWI ERT IA S + G D + C LLR+RF  FS ETN++G  +V  AN+  D LI   H  A  I+ WKDR+NE WADLLELI+TRIQLLK+AWDLH++ CD Q +L+ I EK  S  +  D+G+D K+V++LQRK   +E +L +L   +   +  +N LLP Y  DKE+ +  +R E++ A+R L+   E RK++ L+ +D H F +MVREL  W+E +  +M ++ KPRDVSG+ELL+ NH+SLK E+D+++ENFSICL+LGRTLL  +H R  EI+ KC ++  +R I+ ++W +  ++L LM+EVY +ARDAA AEAW+I+QES++ + +LG +LDETLALLKK + F+KA   QEE+F  L++LTT+E+++K                E+T E E      I Q I +  + F+  P   +P                          +G       R+    P  +S     + +   S RP P N+   +H                                 RK++WE   ++A  R+W  LY +L  +  T   +KD R   +KP   Y    P+ L   VAAPA DY KRP VFR++  NG E LFQ  S  +M  WV+ INS S  +    P    P+T +        S    S++LP  A H
Sbjct:    1 MEIQALHQNLHWEPSSVAQPNNYISDDDDFESGNSTAKLYERSRIKALADEREIVQKKTFTKWVNSHLAVVNHRVEDLYLDLRDGKHLLRLLEILSGERLPKPTRGKMRIHCLENVDKSLNFLCDQHVHLENVGAHDIVDGNQRLTLGLIWTIILRFQIQDIIVEEYQTSETKCAKDALLLWCQMKTAGYNNVNVRNFSTSWRDGLAFNALIHKHRPDLIEYQKLTKATPLQNLQNAFTVADEKLGIPPLLDANDVCVEQPDEKSIITYVAAYYHYFNKMKADTVHSKRIGKVVNQAIESSQLIDQYEQLTSELLTWIQKTIELLNDRVFANSLPDVQHQLAGFNTYRTVDKPPKFVEKGALEVLLFTLQSKMRANNHKVYSPPDGKLISDINRAWENLEKAEHARELALRDELIRQEKLSQLATRFDRKAGMREAWLSENQRLVAQYNFGSDLAAVEAATKKHEAIETDISAYAERVNAVVSVAEELQLENYYDNDRIQMRRENVLRLWSNLLDLLRKRRACLNLSLQLQRVFQEMSYLQDWIDEIGNRLKSEDYGKHLMGVDDLLQKHNLLEADIRVLDDRLTQVLDQAKVFV---DCNFPENV-EGYRPIEPEFVQKRGEDLRAAYEKLHELADARRQALEDSRKMWQFFWDMDDEKEWIKEKSQLMSSPDLGHDLTSVERLLRKHRALEEECKIRQNVFNNSVVTGNNLINEGNRGKEAIQQRIDEMHELWDQLADVTAERKQRLQESQEFFQLMADCDDADAWLIDQQRIASNEDVGLKMSTTESLIKINQELMENLEQYRETINLLHVTAAKVSEYPDSDSTIIGSRLDNVDENYNRALELAKQRQQRLLDALSMYKLFDVSDTVRTWITEKERLLATLCPSDVIQELEVTRHRFECFEKEMTKNAEKVSSVNKLSENLIKTDHPDSQQIVIRQDKLNATWNGLADLVEKQKCRIETAHQYNQYLLECQETACWIKDKKNLIESTDELGNDLEGIMQLQRRLSGLQRDLQAIQAKIDHLDEQADVLVVTKPEEAEAIRAERMKIHDLWDELKEMLKERDDRLNDSSELQRFLQDLDHFQVWLRKAQVTVASEDVPNTLPEAEKLLQNHEQFKPEIDGYEDDFKRLMEMGRRVVENQSDP-QYLFLAERLDGIEENWVALHKMYEDRDKVLKQDVEAQSFFRDATLMDKLINKQEALISKEVVSTPESVDEALRNL----------NTFQAAMPANDEKISQVIAVGRDLAARGVFPVEKILAKCDQLEQRRQAVKEKAIDREAKLAQHSRLQGFVQDVDDVEEWISEKTILAQHAPPPRGAGIAAIYGKFKTFESELDANKDKIEKVIATGEHLIAEQPQLQAEIEPRIEVLRRQWVDLNNQAQEQSAKLADSNREALFDETAKSMLTWITEVSSQIVTTTEEVTEEVGLVELNEQIKDQERKEQELMAKRKMLEDMAKHAEKLKEQYPDRKDEFEQVHQEVRIRLTELEAPMANRRDRLTKQKRVRQFFRDLEDEKDWIREKLAIIEDHGR-MGT--SLLSNQQMQRRHKMLANEVDNHQPRIDAVCQQGEEMIADGHPHSEKFREGIDEVRALWASLRLALDDRQAALLQNEVAQQYLFDASEAEAWMGEQELYLMGDE-KARDEQGATNAMKKHELLQKTIENYASEIRSLGDRCRAMVESGHPESEVVAAKQSRVDKMYAGLHDLCLERRLRLEEILKLYSLLREIL-DLEAWIAERTVIASSHEMGADYEHCCLLRERFADFSKETNELGKLRVASANELCDALIAQGHGEAAEIASWKDRVNEAWADLLELIETRIQLLKAAWDLHKFLCDCQDVLDRIAEK--SGIIPEDVGRDAKAVAVLQRKHAAYEAELSRLGQQVEEVVDFANNLLPSYAGDKESIICDRRDEVVQAWRQLQYAAEQRKIHLLDASDVHKFFAMVRELQLWMEAMRTEMTIKEKPRDVSGVELLMNNHKSLKAEIDARKENFSICLSLGRTLLNRRHPREEEIREKCIQLVTERVIMLEQWNDRNENLQLMLEVYHFARDAAVAEAWLIAQESFVKSPDLGESLDETLALLKKHLAFEKAVATQEERFIALEKLTTLELKAK----------------EKTPESEAARKKAIEQKIVDASREFQPLPSTSQP-----------------------AVPSGPMHGTPLRRGFETPTGRS-----LRESVDSGRPTPRNLEALLH---------------------------------RKNEWETTVKRAFGRSWVELYFVLDATLGTLSAYKDSRSAHDKPGHLYHKVPPVNLAGAVAAPATDYDKRPYVFRLKLPNGGESLFQCLSEDEMHTWVETINSVSASL--PAPVKVMPTTEEEEAEGGLVSPAGRSATLPSTALH 2317          
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Match: sptbn2 (spectrin beta chain, non-erythrocytic 1-like [Source:NCBI gene;Acc:103032213])

HSP 1 Score: 1308.12 bits (3384), Expect = 0.000e+0
Identity = 811/2401 (33.78%), Postives = 1340/2401 (55.81%), Query Frame = 1
Query:  154 LSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNF-IPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXD-HSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKII----AEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDS---EIKDTGYFQKVNSRQSMM-----RPFPQSSALS-----PVP---QMKQSKRPQPSNMSKPVHNLSVSTDMLSAS---PKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEK-PKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPP 7251
            L+ E E    N ++++FERSRIKALADERE VQKKTFTKW+NS L  VT +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  QKVHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VN+ NFT SWR GL F A++HKHR DLI+F +  R++   NL  AF++AE  LG+  LLDPEDVNV  PDE+S+ITYVA+YYHYF+ +KA +V  KR+ K+L+  +E +Q+I+ Y++L S+LL+WI  TI  LN RQ +NS+  +Q Q+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA +F++KAA+RE+W+++N  L+ + + G +L  V AA +KHEAIETDI AY E +  +  ++  LE E Y+++  I+  K+ VL LW+ L + L  RRE L  +  +  L+ E   +   +  +  + +  + GKHL +VE+LL+ H L+E+DI +  +R+  + + A R+    D+           A+++EK +   K + EL     +R+  L+ S  +WQF+ +   E  WI+E   I+++ D G DLSS   LL KH+ F  E++++   L N +  G+ LV     G   +  +  DI+  W  L ++++ R+  L E +  +Q+ +D +D E WI E  R    + +G     T+ L RK ++  E ++++R  I+ +  QA++L   +      V  +L  IE++Y++L  ++   ++ L  AL +YR+ +++ + + WI EK+++L N  IPS  +E+LEV++ RFE  E E+     ++  VN +SE L+ + N N + I   QD LNN W++   + D ++  L S  +  N+ ++C +   W++EK K+IES   LG DL  VM  QR++  M+RD+ AI+ K+  L ++ +++   +   A +I  +L+ + + WE L+  ++ R+ +L   + +  F++ LDDF  WL + QT +AS++ P S +EAE+L+ ++ + ++E+    +  E+    G +  + + D  Q++ L  R+++++  W  L  + E +   L +      F  DA+Q E  LN+QE  L         +     ++L    E + ++E F+  M + E+ +  V++ G+ L+ + N   D++Q K  ++ ER +KN   A +   KLK+   L   LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  +++++K G+    + P  ++ + + L  L   W EL    + K Q L   NR +LF +S  ++  WL+NI   + +DD        +TS+   LKK   H M     +   + ++   S+ L     D  +   +++ Q +   D  +  L+  L+   Q+++    A QF +D +DEI W+ E++ L    +  K + ++  L++      ++++++ EI+    ++D +    + M  E   +RA +   +++L +       E +K  + L+     Q+F  D +E  +W+ E+EL +M     +KD+Q    +++K Q LE  +++Y   I +   S   +     P+  +  ++   V+  +  LK +  E++  +   +          ++E WI ER  +A S + G+D +  T+LRD+F  F+ +T+ IG  +V+  N + DELI+  HP   S++ WKD +NE WADLLEL+DTR Q+L ++++LHR++ D++  L  ++EKK ++    +LG+D  +V  L R+   +E D+  L   +      +  L   Y  +K   + +  + + +A+  L    + R+L  L+  +   F +MVR+L+ W++ + +Q++    PRDVS   L++ANH+ +K E++++  +F+ C ++G +LL   H  S EI+ K +++  KRD + QKW + +DHL +++EV Q+ RDA+ AE+W+  QE  +    LG  +DE  +L+K+   F+K     E++F  L++LTT+E                        EHE    IQ + E  +     P      E  Q      ++  +SLDQ +    +   G     ++ QS+       P P+   LS     PVP   + +Q  RP+  + S+ V+     + + +AS   P       + P    M+G L RKH+ E+  +KA+NR+W ++Y +L +  + F+KD +      P   Y  E+P+ L E     A DY KR  VF++R  +G E+LFQ     +M+ W+ +I+S+   M    P + +P   Q   + + ++PP
Sbjct:   27 LAAEAEWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLGRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRSDLIEFDTLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIEKYETLASELLQWIEQTIVTLNDRQLANSLSAVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGFDLGAVEAATRKHEAIETDIGAYGERVAAVESVARELEAEAYHEVRRILARKDNVLRLWEYLKELLTARRERLTTHRDLQRLLEEMRYIMDWMGDMKGRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVRGVQAAAKRFT--TDE---MPYKPCEPALVEEKVSLLGKTYDELGHLAGERRVKLEDSRRLWQFLWELGEEAAWIREQEQILSSGDSGRDLSSALHLLSKHEAFRDEMAARYGPLSNSIASGEQLVQEGHFGAPEVTERIKDIRAQWSHLEEASKLREQLLKESVALHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQAETLPA-AYAQSPEVEGRLPAIEQRYEELETLSSARRQALEGALALYRMFSEAGACQLWIGEKEQWLHNMEIPS-KLEDLEVVQQRFETLEPEMNNLGSRITDVNQVSEQLLKSDNRNKEQINQTQDQLNNRWSEFKRVADERKQALESALNIQNYHLECNEIQSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLGGLRSEAEKLASEHPEQAGEIRARLEEIQEVWEELRSTMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTAVASEDTPTSLAEAERLLAQHEAIKNEVDNYREDYEKMRATGAEVTQGQTDA-QYMFLAQRLQALDTGWHELRRMWESRHCLLAQAFDFQTFLRDAKQAEGFLNSQEYVL---------SHTEMPNSLQGAVEAIKKHEDFLTTMEASEEKINGVVESGRRLVSDGNANADKIQEKADSIQERHQKNKQTANDLLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQALVVEKPELEETVSETLQGLQKQWEELENTTQTKAQCLFDANRAELFTQSCSALDSWLQNISSLLQSDD----FGKDLTSVNILLKK---HQMLEHQMEVREKEVQSLQSQALALAQED--AGVMEVDGQQRRVADSFT-QLQEPLNQRRQQLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLIK------KNQTLQKEIQGHQPRIDDIQAHGRSMDGE---RRADLDGRLSELGEEWSRFISETDKRHSRLAEANRAQQFYTDAAEAEAWMGEQELHMMS-EEKAKDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTSAIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELMDTRTQMLAASYELHRFHQDAREALGRVKEKKEAL-AGAELGRDLNTVQHLHRQHTAYEHDVHALSGQVTQVQDDAARLQKAYAGEKAEDIHRHERAVTEAWEGLLAATQSRRLLLLDTVEKFRFFNMVRDLMLWMDGINLQIQSHDSPRDVSSAGLVIANHQDIKAEIETRAGSFTACTDMGNSLLNNNHYASDEIREKLEQLKAKRDEIKQKWQDKMDHLQIVLEVLQFGRDASVAESWLAGQEPLVRAAELGSNVDEVESLIKRHEAFEKLAAGWEDRFVLLEKLTTLE------------------------EHE----IQRLKEEEERARRPPTPPPAEEVVQSEAEHESAARTSLDQTTLNQSVSVNGVHSDQDTSQSLSVSVSELPNPEPKPLSKPVSKPVPKPYKAQQRYRPEKGSESESVNGPGRDSGLDTASRHDPSATLPGRVDPSTEAMEGMLCRKHEMESHAKKAANRSWQNVYCVLRKGSLGFYKDNKSASNGIP---YHGEVPISLNEATCEVAHDYKKRKNVFKLRLGDGKEFLFQAKDEAEMSSWIRSIHSS---MPSSGPGDRSPG-GQRGLSRAMTMPP 2354          
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Match: sptbn2 (spectrin beta chain, non-erythrocytic 1-like [Source:NCBI gene;Acc:103032213])

HSP 1 Score: 1304.27 bits (3374), Expect = 0.000e+0
Identity = 811/2398 (33.82%), Postives = 1337/2398 (55.75%), Query Frame = 1
Query:  154 LSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNF-IPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXD-HSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKII----AEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDS---EIKDTGYFQKVNSRQSMM-----RPFPQSSALS-----PVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSAS---PKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEK-PKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPP 7251
            L+ E E    N ++++FERSRIKALADERE VQKKTFTKW+NS L  VT +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  QKVHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VN+ NFT SWR GL F A++HKHR DLI+F +  R++   NL  AF++AE  LG+  LLDPEDVNV  PDE+S+ITYVA+YYHYF+ +KA +V  KR+ K+L+  +E +Q+I+ Y++L S+LL+WI  TI  LN RQ +NS+  +Q Q+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA +F++KAA+RE+W+++N  L+ + + G +L  V AA +KHEAIETDI AY E +  +  ++  LE E Y+++  I+  K+ VL LW+ L + L  RRE L  +  +  L+ E   +   +  +  + +  + GKHL +VE+LL+ H L+E+DI +  +R+  + + A R+    D+           A+++EK +   K + EL     +R+  L+ S  +WQF+ +   E  WI+E   I+++ D G DLSS   LL KH+ F  E++++   L N +  G+ LV     G   +  +  DI+  W  L ++++ R+  L E +  +Q+ +D +D E WI E  R    + +G     T+ L RK ++  E ++++R  I+ +  QA++L   +      V  +L  IE++Y++L  ++   ++ L  AL +YR+ +++ + + WI EK+++L N  IPS  +E+LEV++ RFE  E E+     ++  VN +SE L+ + N N + I   QD LNN W++   + D ++  L S  +  N+ ++C +   W++EK K+IES   LG DL  VM  QR++  M+RD+ AI+ K+  L ++ +++   +   A +I  +L+ + + WE L+  ++ R+ +L   + +  F++ LDDF  WL + QT +AS++ P S +EAE+L+ ++ + ++E+    +  E+    G +  + + D  Q++ L  R+++++  W  L  + E +   L +      F  DA+Q E  LN+QE  L         +     ++L    E + ++E F+  M + E+ +  V++ G+ L+ + N   D++Q K  ++ ER +KN   A +   KLK+   L   LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  +++++K G+    + P  ++ + + L  L   W EL    + K Q L   NR +LF +S  ++  WL+NI   + +DD        +TS+   LKK   H M     +   + ++   S+ L     D  +   +++ Q +   D  +  L+  L+   Q+++    A QF +D +DEI W+ E++ L    +  K + ++  L++      ++++++ EI+    ++D +    + M  E   +RA +   +++L +       E +K  + L+     Q+F  D +E  +W+ E+EL +M     +KD+Q    +++K Q LE  +++Y   I +   S   +     P+  +  ++   V+  +  LK +  E++  +   +          ++E WI ER  +A S + G+D +  T+LRD+F  F+ +T+ IG  +V+  N + DELI+  HP   S++ WKD +NE WADLLEL+DTR Q+L ++++LHR++ D++  L  ++EKK ++    +LG+D  +V  L R+   +E D+  L   +      +  L   Y  +K   + +  + + +A+  L    + R+L  L+  +   F +MVR+L+ W++ + +Q++    PRDVS   L++ANH+ +K E++++  +F+ C ++G +LL   H  S EI+ K +++  KRD + QKW + +DHL +++EV Q+ RDA+ AE+W+  QE  +    LG  +DE  +L+K+   F+K     E++F  L++LTT+E                        EHE    IQ + E  +     P      E  Q      ++  +SLDQ +    +   G     ++ QS+       P P+   LS     PVP  K  K  Q  + S+ V+     + + +AS   P       + P    M+G L RKH+ E+  +KA+NR+W ++Y +L +  + F+KD +      P   Y  E+P+ L E     A DY KR  VF++R  +G E+LFQ     +M+ W+ +I+S+   M    P + +P   Q   + + ++PP
Sbjct:   27 LAAEAEWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLGRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRSDLIEFDTLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIEKYETLASELLQWIEQTIVTLNDRQLANSLSAVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGFDLGAVEAATRKHEAIETDIGAYGERVAAVESVARELEAEAYHEVRRILARKDNVLRLWEYLKELLTARRERLTTHRDLQRLLEEMRYIMDWMGDMKGRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVRGVQAAAKRFT--TDE---MPYKPCEPALVEEKVSLLGKTYDELGHLAGERRVKLEDSRRLWQFLWELGEEAAWIREQEQILSSGDSGRDLSSALHLLSKHEAFRDEMAARYGPLSNSIASGEQLVQEGHFGAPEVTERIKDIRAQWSHLEEASKLREQLLKESVALHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQAETLPA-AYAQSPEVEGRLPAIEQRYEELETLSSARRQALEGALALYRMFSEAGACQLWIGEKEQWLHNMEIPS-KLEDLEVVQQRFETLEPEMNNLGSRITDVNQVSEQLLKSDNRNKEQINQTQDQLNNRWSEFKRVADERKQALESALNIQNYHLECNEIQSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLGGLRSEAEKLASEHPEQAGEIRARLEEIQEVWEELRSTMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTAVASEDTPTSLAEAERLLAQHEAIKNEVDNYREDYEKMRATGAEVTQGQTDA-QYMFLAQRLQALDTGWHELRRMWESRHCLLAQAFDFQTFLRDAKQAEGFLNSQEYVL---------SHTEMPNSLQGAVEAIKKHEDFLTTMEASEEKINGVVESGRRLVSDGNANADKIQEKADSIQERHQKNKQTANDLLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQALVVEKPELEETVSETLQGLQKQWEELENTTQTKAQCLFDANRAELFTQSCSALDSWLQNISSLLQSDD----FGKDLTSVNILLKK---HQMLEHQMEVREKEVQSLQSQALALAQED--AGVMEVDGQQRRVADSFT-QLQEPLNQRRQQLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLIK------KNQTLQKEIQGHQPRIDDIQAHGRSMDGE---RRADLDGRLSELGEEWSRFISETDKRHSRLAEANRAQQFYTDAAEAEAWMGEQELHMMS-EEKAKDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTSAIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELMDTRTQMLAASYELHRFHQDAREALGRVKEKKEAL-AGAELGRDLNTVQHLHRQHTAYEHDVHALSGQVTQVQDDAARLQKAYAGEKAEDIHRHERAVTEAWEGLLAATQSRRLLLLDTVEKFRFFNMVRDLMLWMDGINLQIQSHDSPRDVSSAGLVIANHQDIKAEIETRAGSFTACTDMGNSLLNNNHYASDEIREKLEQLKAKRDEIKQKWQDKMDHLQIVLEVLQFGRDASVAESWLAGQEPLVRAAELGSNVDEVESLIKRHEAFEKLAAGWEDRFVLLEKLTTLE------------------------EHE----IQRLKEEEERARRPPTPPPAEEVVQSEAEHESAARTSLDQTTLNQSVSVNGVHSDQDTSQSLSVSVSELPNPEPKPLSKPVSKPVP--KPYKAQQRGSESESVNGPGRDSGLDTASRHDPSATLPGRVDPSTEAMEGMLCRKHEMESHAKKAANRSWQNVYCVLRKGSLGFYKDNKSASNGIP---YHGEVPISLNEATCEVAHDYKKRKNVFKLRLGDGKEFLFQAKDEAEMSSWIRSIHSS---MPSSGPGDRSPG-GQRGLSRAMTMPP 2349          
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1296.57 bits (3354), Expect = 0.000e+0
Identity = 765/2091 (36.59%), Postives = 1239/2091 (59.25%), Query Frame = 1
Query:  184 NVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDK---ASKYEQLETQVKVTMDGLSVPLESK--LSIANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PD-EYKGIVKD-VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEI 6396
            N ++++FERSRIKALADERE VQKKTFTKW+NS L  V+ +I DLY+DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   +SAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+SVITYV +YYHYF+ +KA  V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +L  V AA KKHEAIETDI AYEE +  +  ++  LE E Y+DI  I   K+ VL LW+ LL+ L  RR+ L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI     R+  + S A ++    D D        +  +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D+G DL+   RLL +H+  E E+S +   L++ + EG  + D    G+  I  +  ++Q  W AL      RK +L E    +Q+ +D DD + W  +  R+     +G     T+ L++ ++     V +YR  I+ +  Q+++ L   + +   V+ +L  IE++Y+++ ++    ++ L DAL +Y++ +++D+   WI EK+++L +    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+ +G+P+ + I   QD LN  W++  D+VD K++ L S     N+ +DC +T  WIREK K+IES  ELG DL  VM  QR++  M+RD+ AIEAK+  L  + + +   +   AK I  +L  +   WE ++  +R+R+++L   + + +F+++LDDF +WL + QT +AS+++P + +EAEKL+ ++   ++E+   E+  ++   +G+   + + D  Q++ L+ R+++++  W  L+ + E ++  L +     +F  D +Q E  LN QE  L               + L      + + E F+  M ++E+ +  V++ G+ L  + N+  DR+Q +  ++DER KKN  AA     +LK+   L + LQD  +L     EK+    ++S    ++  S   + +A   E+ + +  ++++ K G Q  A+ P  +  + + L  L   W EL    + K Q L   N+ +LF +S   + KWL  +EGQI +DD        +TS+   LKK      ++E +K+ +E L+  + +L+Q+  D      + E +E + +  +D    PL  +    +A+++I   QF +D +DEI W+ E++ +    +    ++T+  L++      ++++++ EI+    + D + + +Q ++ E+      +   ++ L+   + + +E EK    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+   L     P+ E  G+ +  V+  +  LK +  E++ ++       + + L+Q      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N+  DELI   H  A +++ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +L  I +K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + ++  E++DA+R+L +  E R+   L+  D   F SMVR+L+ W+E+V   +E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG++LL  KH  S EIK K  ++TDKR  +  KW +  + L L++EV+Q++RDA  AEAW++ QE YL++  +G ++D+   L+K+   F+K+    EE+F  L+RLTTME+
Sbjct:   33 NSSARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYMDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKRSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVSVARELEAENYHDIKRITARKDNVLRLWEYLLELLKARRQRLEMNLGLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRVRNVNSNAQKFA--IDDD---GYKPCDPQVIRDRVAHLEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDVGKDLTGAVRLLSQHRALEDEMSGRGGHLQHTVREGLAMADAGHFGETRIRERVAEVQAQWAALEQLAAVRKARLEEACGLHQFQADADDVDAWTLDALRIVSSGDVGHDEFSTQALVKTHKDAAAEVASYRPVIDALHEQSRA-LPPELAESADVSGRLAGIEERYKEVAELTRLRKQALQDALALYKMFSEADACEVWIVEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLKGEAERLAGEHPEQAKAITGRLAEIDSVWEEMKDTLRNREASLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEIHNYEEDYQKMRDMGEMVTQGQTDA-QYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLA---------HTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINSVVEAGRRLASDGNINTDRIQERAASIDERHKKNREAAVELLMRLKDNRDLQKFLQDCQELSLWTNEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKEGMQLVAEKPETEAIVKEKLSALQKQWQELESTTQTKAQCLFDANKAELFTQSCADLDKWLGGLEGQIQSDDYG----KDLTSVNILLKKQQMLENQVEVRKREVEELQSQAHVLRQEGKDTDEVDGRREVVEKKFQEMLD----PLMKRKNFLMASREI--HQFNRDVEDEILWVEERMPIATSTDHGHNLQTVQLLIK------KNQTLQKEIQGHQPRCDDIFERSQSILKEDSPSVEAIKARLSDLQTLWDLIIQETEKRHERLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEE-KAKDEQSSVTMLKKHQILEQAVEDYAETVHQLSKTSRGLVAANHPESERIGMRQSQVDKLYAGLKDLSEERRGKLD------ERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDSVNRMADELINAGHTDAATVAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEILSRILDKHKMLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAVRLQSAYAGDKADDIQRRETEVLDAWRNLLEACEGRRARLLDTGDKFRFFSMVRDLMLWMEDVIRLIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKDKLLQLTDKRKEMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSREMGQSVDDVEKLIKRHEAFEKSAATWEERFSALERLTTMEL 2082          

HSP 2 Score: 123.635 bits (309), Expect = 2.202e-27
Identity = 130/636 (20.44%), Postives = 275/636 (43.24%), Query Frame = 1
Query: 4612 QFLQDCDDEIDWMNEKIDLIRNR--SKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINS---KDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLPDE------YKGIVKDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTK-HIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQ-WARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNT----DRQFINEALINIEQTAE 6468
            +F  +  +E  W+ EK  ++ +    K +     LL       +H+++++E+  R   +   ++E   M D  H     + + V +++     L +     +  L     + +F  D  +V +W     LD + +V +     D+   + +++  ++   E+ +Y P I+   +   +LP E        G +  +E+ +  +  +   +K  +   +     +      E WIVE+ +   S +  + L+   +++ RF     E N   +S+V   N+   +L+   HP    I   +D++N  W+   +L+D + + L SA  +  ++ D       I+EK   +E   +LG D   V  LQRKL   E+DL  +++ + +    +  L   + +  +A +  +  E+   +  ++  L +R+ +  E +    FL  + +   W+      +     P  ++  E LLA H  +K E+ + EE++    ++G  + + +   +   ++ + + +    + L + W N  + LS     YQ + RD   AEA++ +QE  L +  +  TL+   A +KK           +E F     +TTM+   +K+N+     R+  ++  IN ++  E
Sbjct:  641 KFFWEMAEEEGWIREKEQILSSDDVGKDLTGAVRLLS------QHRALEDEMSGRGGHLQHTVREGLAMADAGHFGETRIRERVAEVQAQWAALEQLAAVRKARLEEACGLHQFQADADDVDAWT----LDALRIVSSGDVGHDEFSTQALVKTHKDAAAEVASYRPVIDALHEQSRALPPELAESADVSGRLAGIEERYKEVAELTRLRKQALQDALALYKMFSEADACEVWIVEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNN-QASRVAVVNQIARQLMHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLKGEAERLAGEHPEQAKA-ITGRLAEIDSVWEEMKDTLRNREASLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEIHNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLS-QSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKK-----------QEDF-----MTTMDANEEKINSVVEAGRRLASDGNINTDRIQE 1247          
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Match: sptbn2 (spectrin beta chain, non-erythrocytic 1-like [Source:NCBI gene;Acc:103032213])

HSP 1 Score: 1292.33 bits (3343), Expect = 0.000e+0
Identity = 801/2382 (33.63%), Postives = 1326/2382 (55.67%), Query Frame = 1
Query:  154 LSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNF-IPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXD-HSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKII----AEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEK-PKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPP 7251
            L+ E E    N ++++FERSRIKALADERE VQKKTFTKW+NS L  VT +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  QKVHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VN+ NFT SWR GL F A++HKHR DLI+F +  R++   NL  AF++AE  LG+  LLDPEDVNV  PDE+S+ITYVA+YYHYF+ +KA +V  KR+ K+L+  +E +Q+I+ Y++L S+LL+WI  TI  LN RQ +NS+  +Q Q+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA +F++KAA+RE+W+++N  L+ + + G +L  V AA +KHEAIETDI AY E +  +  ++  LE E Y+++  I+  K+ VL LW+ L + L  RRE L  +  +  L+ E   +   +  +  + +  + GKHL +VE+LL+ H L+E+DI +  +R+  + + A R+    D+           A+++EK +   K + EL     +R+  L+ S  +WQF+ +   E  WI+E   I+++ D G DLSS   LL KH+ F  E++++   L N +  G+ LV     G   +  +  DI+  W  L ++++ R+  L E +  +Q+ +D +D E WI E  R    + +G     T+ L RK ++  E ++++R  I+ +  QA++L   +      V  +L  IE++Y++L  ++   ++ L  AL +YR+ +++ + + WI EK+++L N  IPS  +E+LEV++ RFE  E E+     ++  VN +SE L+ + N N + I   QD LNN W++   + D ++  L S  +  N+ ++C +   W++EK K+IES   LG DL  VM  QR++  M+RD+ AI+ K+  L ++ +++   +   A +I  +L+ + + WE L+  ++ R+ +L   + +  F++ LDDF  WL + QT +AS++ P S +EAE+L+ ++ + ++E+    +  E+    G +  + + D  Q++ L  R+++++  W  L  + E +   L +      F  DA+Q E  LN+QE  L         +     ++L    E + ++E F+  M + E+ +  V++ G+ L+ + N   D++Q K  ++ ER +KN   A +   KLK+   L   LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  +++++K G+    + P  ++ + + L  L   W EL    + K Q L   NR +LF +S  ++  WL+NI   + +DD        +TS+   LKK   H M     +   + ++   S+ L     D  +   +++ Q +   D  +  L+  L+   Q+++    A QF +D +DEI W+ E++ L    +  K + ++  L++      ++++++ EI+    ++D +    + M  E   +RA +   +++L +       E +K  + L+     Q+F  D +E  +W+ E+EL +M     +KD+Q    +++K Q LE  +++Y   I +   S   +     P+  +  ++   V+  +  LK +  E++  +   +          ++E WI ER  +A S + G+D +  T+LRD+F  F+ +T+ IG  +V+  N + DELI+  HP   S++ WKD +NE WADLLEL+DTR Q+L ++++LHR++ D++  L  ++EKK ++    +LG+D  +V  L R+   +E D+  L   +      +  L   Y  +K   + +  + + +A+  L    + R+L  L+  +   F +MVR+L+ W++ + +Q++    PRDVS   L++ANH+ +K E++++  +F+ C ++G +LL   H  S EI+ K +++  KRD + QKW + +DHL +++EV Q+ RDA+ AE+W+  QE  +    LG  +DE  +L+K+   F+K     E++F  L++LTT+E                        EHE    IQ + E  +     P      E  Q      ++  +SLDQ + +  +     V+S Q                Q +  K  +  +++ P  +  + T      P       + P    M+G L RKH+ E+  +KA+NR+W ++Y +L +  + F+KD +      P   Y  E+P+ L E     A DY KR  VF++R  +G E+LFQ     +M+ W+ +I+S+   M    P + +P   Q   + + ++PP
Sbjct:   27 LAAEAEWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLGRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRSDLIEFDTLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIEKYETLASELLQWIEQTIVTLNDRQLANSLSAVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGFDLGAVEAATRKHEAIETDIGAYGERVAAVESVARELEAEAYHEVRRILARKDNVLRLWEYLKELLTARRERLTTHRDLQRLLEEMRYIMDWMGDMKGRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVRGVQAAAKRFT--TDE---MPYKPCEPALVEEKVSLLGKTYDELGHLAGERRVKLEDSRRLWQFLWELGEEAAWIREQEQILSSGDSGRDLSSALHLLSKHEAFRDEMAARYGPLSNSIASGEQLVQEGHFGAPEVTERIKDIRAQWSHLEEASKLREQLLKESVALHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQAETLPA-AYAQSPEVEGRLPAIEQRYEELETLSSARRQALEGALALYRMFSEAGACQLWIGEKEQWLHNMEIPS-KLEDLEVVQQRFETLEPEMNNLGSRITDVNQVSEQLLKSDNRNKEQINQTQDQLNNRWSEFKRVADERKQALESALNIQNYHLECNEIQSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLGGLRSEAEKLASEHPEQAGEIRARLEEIQEVWEELRSTMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTAVASEDTPTSLAEAERLLAQHEAIKNEVDNYREDYEKMRATGAEVTQGQTDA-QYMFLAQRLQALDTGWHELRRMWESRHCLLAQAFDFQTFLRDAKQAEGFLNSQEYVL---------SHTEMPNSLQGAVEAIKKHEDFLTTMEASEEKINGVVESGRRLVSDGNANADKIQEKADSIQERHQKNKQTANDLLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQALVVEKPELEETVSETLQGLQKQWEELENTTQTKAQCLFDANRAELFTQSCSALDSWLQNISSLLQSDD----FGKDLTSVNILLKK---HQMLEHQMEVREKEVQSLQSQALALAQED--AGVMEVDGQQRRVADSFT-QLQEPLNQRRQQLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLIK------KNQTLQKEIQGHQPRIDDIQAHGRSMDGE---RRADLDGRLSELGEEWSRFISETDKRHSRLAEANRAQQFYTDAAEAEAWMGEQELHMMS-EEKAKDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTSAIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELMDTRTQMLAASYELHRFHQDAREALGRVKEKKEAL-AGAELGRDLNTVQHLHRQHTAYEHDVHALSGQVTQVQDDAARLQKAYAGEKAEDIHRHERAVTEAWEGLLAATQSRRLLLLDTVEKFRFFNMVRDLMLWMDGINLQIQSHDSPRDVSSAGLVIANHQDIKAEIETRAGSFTACTDMGNSLLNNNHYASDEIREKLEQLKAKRDEIKQKWQDKMDHLQIVLEVLQFGRDASVAESWLAGQEPLVRAAELGSNVDEVESLIKRHEAFEKLAAGWEDRFVLLEKLTTLE------------------------EHE----IQRLKEEEERARRPPTPPPAEEVVQSEAEHESAARTSLDQTT-LNQSVSVNGVHSDQD-------------TSQYRPEKGSESESVNGPGRDSGLDT-ASRHDPSATLPGRVDPSTEAMEGMLCRKHEMESHAKKAANRSWQNVYCVLRKGSLGFYKDNKSASNGIP---YHGEVPISLNEATCEVAHDYKKRKNVFKLRLGDGKEFLFQAKDEAEMSSWIRSIHSS---MPSSGPGDRSPG-GQRGLSRAMTMPP 2320          
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Match: ENSAMXT00000030945.1 (spectrin beta chain, non-erythrocytic 1-like [Source:NCBI gene;Acc:103033421])

HSP 1 Score: 1290.79 bits (3339), Expect = 0.000e+0
Identity = 768/2101 (36.55%), Postives = 1243/2101 (59.16%), Query Frame = 1
Query:  130 LSSDYQNALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNE-IVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLS--IANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEI 6396
             +SD  N   D DE    N ++++FERSRIKALADERE VQKKTFTKW+NS L  V+ +I DLY+DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA  V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +L  V AA KKHEAIETDI AYEE +  +  ++  LE E Y+DI  I   K+ VL LW  LL+ L  RR+ L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI     R++ + S A ++      D        +  +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL++V RLL KHK  E E S +   L+  + +G+ LV     G + I  + +D+Q  W +L     +R+ +L +    +Q+ +D DD + W+ +  R+     +G      + L++K++   E + +YR  ++ +  QA++L        + V+ +L  IE++Y+++ ++    ++ L DAL +Y++L+++D+   WI EK+++L +    + +E+LEV++HRF+  E E+  +A +V  VN ++  L+ +G+P+ + I   QD LN  W++  D+VD K++ L S     N++++C +T  WIREK K+IES  +LG DL  VM  QR++  M+RD+ AIE K+  L  + D +   +   A  I+ +L  +   WE ++  +R R+ +L   + + +F+++LDDF  WL + QT +AS++ P + +EAEKL+ ++   ++E+   E+  ++   +G+   + + D  Q + L+ R+++++  W  L  + E ++K L +     +F  D +Q E  LN QE  L           +T  ++ L   E  + + E F+  M ++E+ +  V++ G+ L+ + N+  +R+Q K  ++DER KKN  AA     KLK+   L   LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  ++++ K G     + P  +  +   ++ L  TW EL    + K Q L   N+ +LF +S   + KWL  +EGQI +DD        +TS+   LKK      ++E ++K +E L+  ++ L Q+    + + +     V+V    +  PL+ + S  +A+++I   QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    + D + + + R + E     A +   +  L++  + + EE+EK    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +  K+  +L     P+  +  ++   V+  +  LK +  E++ ++              ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  NK  D+LI   H  A +I+ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +L  I +K   +   ++LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + ++  E+++A+RSL +  + R++  L+ +D   F SMVR+L+ W+E+V   ++ + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG+ LL  KH  S EIK K  ++TDKR  +  KW +  + L L++EV+Q++RDA  AEAW++ QE YL++  +G  +DE   L+K+   F+K+    EE+F  L+RLTTME+
Sbjct:   17 FTSDVNNRW-DADEWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYMDLRDGRMLIKLLEVLSGEKLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVEHPDEKSIITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQVVVAVAGELEAENYHDIKRITARKDNVLRLWDYLLELLRARRQRLELNLGLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVKSVNSNAQKFA-----DDSEGYKPCDPQVIRDRVAHMEFCYQELTQLAAERRGRLEESRRLWKFFWEMAEEEGWIREKEQILSSEDCGKDLTAVVRLLSKHKALEDERSGRAGRLQQTVQQGEELVAAGHFGADKIRQRISDVQEQWASLERLFSARRTRLQDACALHQFQADADDMDAWMLDVLRIVSSADVGHDEFSAQSLVKKHKDVAEEISSYRPVLDALHEQARTLPEEQARAGE-VSGRLAGIEERYKEVAELTRLRKQALQDALALYKMLSEADACELWIVEKEQWLNSMEIPEKLEDLEVIQHRFDSLEPEMNSQASRVAVVNQIARQLIHSGHPSEKEIKGQQDKLNTRWSQFRDLVDRKKEALNSTLGVQNYYLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEDKLGDLGKEADRLSEEHGDKASGIKGRLGEIKDVWEEMKGTLRTREESLGEASKLQQFLRELDDFQAWLSRTQTAVASEDKPNTLAEAEKLLAQHEGIKNEIRNYEEDYQKMRDMGEMVTQGQTDA-QHMFLRQRLQALDTGWNELQKMWENRQKLLSQSHAYQLFLRDTKQAEAFLNNQEYVLA----------HTEMADTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNISAERIQEKVDSIDERRKKNRGAASELLTKLKDNRDLQRFLQDCQELSLWISEKMLTAKDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIQKAGSALVEEKPETEAVVQGKMEMLKKTWEELESTTQTKAQCLFDANKAELFTQSCADLDKWLSGLEGQIHSDD----FGKDLTSVNILLKKQQMLESQVEVRQKEVEELRSQAQALSQEGKG-SDEVDGRRRGVEVKFQQVQEPLKKRRSNLMASREI--HQFNRDVEDEILWVEERMALATSTDHGNNLQTVQLLIK------KNQTLQKEIQGHQPRYDDIFERSVRTLQEESPVSAGIRLRLEDLQRIWKLIQEEVEKRHGRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEE-KAKDEQSSVAMLKKHQILEQAVEDYAETVHQLSKTSRALVAAGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERSRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDAVNKMADDLINSGHADAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEVLGRILDKHKKLP--DELGRDQNTVETLQRMHTTFEHDIQALGTQVKQLQEDAVRLQSAYAGDKADDIQRREGEVLEAWRSLLEACDGRRVRLLDTSDKFRFFSMVRDLMLWMEDVIRLIDAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKALLARKHYASEEIKEKLLQLTDKRKEMIDKWEDRWEWLRLVLEVHQFSRDAGVAEAWLLGQEPYLSSREMGQNVDEVEKLIKRHEAFEKSAATWEERFSALERLTTMEL 2083          
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008111.1 (pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 gene:ENSPMAG00000007298.1 transcript:ENSPMAT00000008111.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1320.45 bits (3416), Expect = 0.000e+0
Identity = 824/2418 (34.08%), Postives = 1377/2418 (56.95%), Query Frame = 1
Query:  184 NVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDI-------RSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLS--IANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PD-EYKGIVKDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTT---MEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRF-NSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASN--RTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASR--------------PMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRFFSSIRLKK 7308
            N ++++FERSRIKALADERE VQKKTFTKW+NS L  V+ +I DLY DLRDG+ L+ LLE+LS E +PKPTRG+MRIHCLENVDK L FL  QKVHLEN+G+HDIVDGN RL LGLIWTIILRFQ+QDI  + + +   +SAKDALLLWCQMKTAGY +VNI NFT SWR GL F A++HKHRPDLI+F    +++  +NL  AF+IAE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA +V  KR+ K+L   +E +QMI  Y++L S+LLEWI  TI +LN R+F+NS+ G+QQQ+  F+ YRT EKP+KF EK +LEVLLFTI+S    +  KVY P E   ++ IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAALRE+W+++N  L+ + + G +LP V AA KKHEAIE DI AYEE +  +  ++  LE E Y+++  + + ++ VL LW+ L + L  RR  L+  L +  +  E   +   +  +  +    +YGKHL+ VE+LL+ H L+E+DI       +++N   ++  SE + Y + CD    S++ S     ++E+       + EL     +R+  L+ S  +W+F  + +  E W++E   ++++ D+G DL+ V RLL +H+  E EL+ +   L+  + EG+ + D    G + I A+  ++  LW +L D    RK +L      YQ+ +D DD E W+++  R+     +G     T+ L +K++   E + +YR  ++ +  QAQ L     V    V  +L+ +E++Y++L++++   +++L DAL +Y++ +++++   WI EK ++L      + +E+LEV++HRFE FE E+  +A ++  VN L+  L+  G+P+ Q I   QD+LN+ W+   ++VD K++ L S     NF ++C +T  WIREK K+IES  ELG DL  VM  QR+++ M+RD+ AI+ K+  L  + + +   +      I  +L  ++Q W+ L++ +++R+ +L   + + +F++ LDDF  WL + QT +AS+++P +  EAEKL+ ++ + ++E+   +   +    +G + +  +Q   Q++ L  R+++++  W  LN + E +   L +      F +DARQ +  L+ QE Y++  ++          + L S  E +  +E  +  M ++++ +   L+ G+ L+ E+N Y D++Q K  ++DER KKN + A++   +LK+   L   LQD  +L   + EK+    ++S    ++  +   + +A   E+ + +  +E++++ G+Q   + P  +  + + L  L+  W EL    + K Q L   NR +LF +S   + KW+  IE QI +DD  +     +TS+   +KK      ++E +KK +E L+  + +L Q+   +     Q  T V+   + +  PL+ +    +A++++   Q+++D +DEI W+ E++ L   R+    ++T+  L++      ++++++ EI+    +++ + +  + +I    +    + + +  L+     +  E +     L   L  Q++  DV+E  +W+SE+EL ++     +KD+Q    +++K Q LE  ++NY   I +  ++  +L     P+ E  G+ +   D     K+    K           + ++L+Q      ++E WI ER  +A S + G+D +  T+L +RF  F+ +T  IG  +V+  N+  D LI+  H  + S++ WKD +NE WADLLELIDTR Q+L ++++LHR+  D++ +L  I EK+  M++  +LG+D  +V  LQRK   FE D+  L   +      +  L   Y  +K   + ++ +E++ A++ L    E RKL   +  +   F S+VR+L+ W+E    Q+  + KPRDVS +ELL+ NH+ +K E+D++ +NF+  + LG++LL  +H  + EIK K  ++TDKR  +  KW      L L++EV+Q+ARDA  AEAW+++QE ++  + +G ++DE   LLK+   F+K+    +E+F  L++ TT   +E+R ++   D +   + L       + E H I +      Q  + + +        Q++ R+  N +D S++ + E +  G      +R+    P P S            ++PQ       +H+ SVST  L    + A+           +G L RKH+WE+ N+KAS+  R+WH+LY +L      F+KD ++        Y +E+P+ L   V   A DY K+  V R++  +G +YL Q     +M  W+ +I +A+               PMR    S T PS     P   ++ P + +  K  ++ FS +++KK
Sbjct:   37 NSSARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGEKLPKPTRGKMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDISVETEDNKERRSAKDALLLWCQMKTAGYQNVNIHNFTTSWRDGLAFNAIVHKHRPDLIEFDKLKKSNAHHNLQNAFNIAEQKLGLTKLLDPEDISVDQPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLESAIETDQMIDKYETLASELLEWIEQTIIILNNRKFANSLTGVQQQLQAFSTYRTVEKPNKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVNEINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAALRETWLSENQRLVTQDNFGVDLPAVEAATKKHEAIEADIAAYEERVQAVVDVARELEAEDYHEVRRVCSRRDNVLRLWEYLQELLAARRHRLEANLALQRVFQEMLHIVDWMDEMKVRLLSQDYGKHLLGVEDLLQKHALVEADITVQADRVKAVNAAAQRFSSEDDAY-KPCD----SHVVSERATHLEER-------YAELCSLAAERRSKLEESRKLWRFFWEMAELEGWVREKEPLLSSGDVGKDLTGVLRLLGQHRAVEDELNGRSADLKQTVREGEEMADAGHFGADDIRARVAEMHVLWASLEDLAAQRKRRLQVAESLYQFQADADDIEVWMEDTLRIVSSDEMGHDEFSTQSLNKKHKDVTEEISSYRPVLDALHEQAQGLPDEVTVS-AGVPDRLEALEQRYRELVELSRVRKQRLQDALALYKMYSEAEACELWIDEKSQWLNAMDVPEKLEDLEVIQHRFEGFEPEMNSQASRIAVVNQLARQLMHAGHPSEQDIKAKQDHLNSVWSDFRELVDQKKEALSSALSIQNFHLECNETKAWIREKTKVIESTQELGNDLAGVMALQRKLSGMERDLAAIQTKLADLQGEAERLASMHPEQEDAILGRLAEINQVWDNLKETLQNREESLGEASKLQQFLRDLDDFQTWLSKAQTAIASEDMPNTLPEAEKLLAQHEAIKNEIDNYQDDYQRMRDMG-EVVTRDQSDPQYMFLHQRLQALDTGWNELNKMWENRHSLLSQSHGFQAFLKDARQADGFLSNQE-YVLGHVE--------MPATLESAEEAIKNHEDVMTTMDTNDEKIVGALETGRRLLTEDNTYADKIQEKVDSIDERHKKNRMTAEDVLARLKDNRDLQRFLQDCQELTLWINEKMLTAQDMSYDEARNLHTKWQKHQAFMAELASNKEWLEKIDEEGQQLMVEKPETEPMVKEKLSELHELWDELENTTQLKAQRLFDANRAELFTQSCADLDKWVNQIESQISSDDHGN----DLTSVNILIKKQQMLENQMEVRKKEVEELQSQATVLCQEGKGRDEVDSQRLT-VENRFEQVLAPLQQRRDKLLASKEV--HQYIRDLEDEILWVEERMPLAASRDHGNNLQTVQLLIK------KNQNLQKEIQGHEPRIEDIRERGEDLIARGSVDPEAIHERLEDLRALWATMIVEAKDRHIRLEESLKAQQYYFDVAEAEAWMSEQELYMIA-DEKAKDEQSAVAMLKKHQILEQSVENYSDVIHQLSETSRNLVTSRHPESERIGLRQSQAD-----KLYAGLKDLAEERRGRLEERHKLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLSERFAEFARDTATIGQERVDSVNRIADALIEAGHSDSASVADWKDGLNEAWADLLELIDTRTQMLAASYELHRFNHDAREVLSRINEKQ--MQLPEELGRDQNTVESLQRKHTTFENDIQALGVQVKVLQEDAERLRGSYAGEKVEDIERREEEVVTAWKGLLDACEARKLRLADTGEKFRFFSLVRDLMLWMENTIRQINAQEKPRDVSSVELLMNNHQGIKAEIDTRNDNFTTVIELGKSLLARQHYATDEIKEKLGQLTDKRKEMVSKWEERAHWLKLILEVHQFARDAGVAEAWLLAQEPHITTQEVGESVDEVEQLLKRHEAFEKSVSTWDERFNVLEKHTTLELLELRKQQEKEDEERKQQKLQAELDEKKREEHHIAEQ-----QRIQSQEVTQNGISSDQESPRQGSNMLDPSVNGNGENEADG------ARKLTPEPSPSSD----------RRKPQ------TLHSQSVST--LPGKAEEASA-------FRKEGFLLRKHEWESHNKKASSSVRSWHTLYCVLHNQEFGFYKDSKNM--NTGNTYHNEIPVNLANAVCDVASDYKKKKHVLRLKLPDGNDYLLQAKDDEEMANWIHSIKAAASSRDSSSPSSQGSQAPMR----SKTMPSG----PPSEATSPEKKE--KDREKRFSFLKMKK 2362          
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001834.1 (pep scaffold:Pmarinus_7.0:GL482425:158920:175005:1 gene:ENSPMAG00000001663.1 transcript:ENSPMAT00000001834.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 808.905 bits (2088), Expect = 0.000e+0
Identity = 440/1174 (37.48%), Postives = 698/1174 (59.45%), Query Frame = 1
Query:  385 PKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPE-DVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKF-LGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDER 3900
            PKPTRG+MRIHCLENVDK L FL  QKVHLEN+G+HDIVDGN RL LGLIWTIILRFQ+QDI    + S   +SAKDALLLWCQMKTAGYP+VN+ NFT SWR GL F A+IHKHRPDL+DF    +++  +NL  AF+ AE  LG+  LLDPE DV+V  PDE+S+ITYV S+YHYF+ +KA +V  KR+ K+L+  +E ++M++ Y+SL S+LLEWI  TI  LN R F NS+ G+QQQ++ F+ YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   ++ IN AW+ L  AE+GRE ALR EL+RQEKL  LA++F++KAA+RE+W+ +N  L+ + + G +L  V AA KKHEAIETD+ AYE  +  +  ++  LE E Y+++  ++  ++ VL LW++L + L  RR  L+  L +    +E     A +  +  +      GKHL+ VE+LL+ H L+E+D+ +   R++ + + A R+ +  D          +  +  E+       + EL      R+  L+ +  +  F+ +A   E W++++  ++ + D G+DL++V RLL +H+ FE ELS +R  L+  L  G+     +    +   A++ ++  LW +L  +   R  +L      +Q +SD  D E W  +   L      +G+    T+ L RK++  +E +E YR  I+ ++ QA +L   S+ +   V ++L R+E+ Y +L  +A +   +L DAL +Y + +++ +   W+ EK ++L      + +E+LEV++HRFE  E E+   A +V  VN L+  L+ + + +   I   QD LN  W++  ++ +SK++ L ++    +F ++C +T  WIREK +LIES   LG DL  VM  QR+++ M+RD+ AIE K+  L  + + + +H+   A  +  QL      W  L+  +R R+ +L   + + +F+Q +DDF  WL + Q  +AS+++P +  EAEKL+ ++ + ++E++   +      ++G++  + + D  Q V L+ R+++++  W  L+ + + +   L      L F  DARQ + +L+ QE Y +  ++          + L S    + ++E     M ++++ +  VL  G+ L+ E N   D++Q K  ++ ER
Sbjct:    1 PKPTRGKMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDISVQTEDSKETRSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAVIHKHRPDLVDFEKLKKSNAQHNLQHAFNAAEQHLGVTKLLDPEADVSVDQPDEKSIITYVVSFYHYFSKMKALAVEGKRIGKVLDSAIEADRMVERYESLASELLEWIGRTITALNSRDFPNSLVGVQQQLHAFSSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVAEINRAWERLEKAEHGRELALRDELIRQEKLEQLARRFDRKAAMRETWLAENQRLVMQDNFGADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEAERYHEVARVVRRRDGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTGAWMDEMKLRLLSQECGKHLLGVEDLLQKHALVEADVAAQADRVKAVNAAALRFAEEVD-----GYRPCDPEVASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGEEEKREAERDAQAARARSAELDKLWASLELAASRRAERLRASEALHQLLSDSADVEAWARDASLLVAAGGDVGNDEFSTQALARKHRDVVEEIEGYR--IDSLQEQAAALPA-SLAEPAGVRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALDIPEKLEDLEVVQHRFESLEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEAERLAQHHPERAGAVRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASEDVPSTLPEAEKLLAQHEAIKNEISNYSEDHRRMREMGEEVTRDQSDP-QHVFLRQRLQALHTGWAELHSMWDNRRALLAACHAYLAFARDARQADGVLSNQE-YALSRVE--------MPATLQSAEAAIKKHEELTTSMEANDEKVGSVLDTGRKLVGEGNFNADKIQEKMDSISER 1156          

HSP 2 Score: 99.7525 bits (247), Expect = 6.334e-21
Identity = 127/605 (20.99%), Postives = 255/605 (42.15%), Query Frame = 1
Query: 4723 QLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLPD---EYKGI---VKDVEDNFNSLKIICAEK----KTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLEC------IQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPE---IKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKK----LNTDRQFINEALINIEQTAE 6468
            +L  RH++ ++E+  R  ++   ++  +    E             +L K   +L     +    L    A+ + L D ++V +W  +  L +        D+   + + RK +++  EI+ Y  +I+  ++   +LP    E  G+   ++ +E+ +  L  + AE+    +  ++L+ I+ +T         W+ E+++   + D  + L+   +++ RF     E N + +S+V   N+   +L+  +H     I   +D +N  W++  EL +++ + L++   L        F LEC      I+EK   +E    LG D   V  LQRKL   E+DL  ++  + + +      L  +  ++   +  +  +  D + +LR  L  R+ +  E +    FL  V +   W+ +    +     P  +   E LLA H ++K E+ +  E+      +G  + R +    P+   ++ + + +      L   W N    L+       +ARDA  A+  + +QE  L+   +  TL    A +K              K E+L   T+ME   +K    L+T R+ + E   N ++  E
Sbjct:  576 RLLARHRAFEDELSGRRAQLQQTLRLGEEEKREAERDAQAARARSAELDKLWASLELAASRRAERLRASEALHQLLSDSADVEAWARDASLLVAAGGDVGNDEFSTQALARKHRDVVEEIEGY--RIDSLQEQAAALPASLAEPAGVRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACL----LWLDEKSQWLDALDIPEKLEDLEVVQHRFESLEPEMNGL-ASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQ------SFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGD-LQGEAERLAQHHPERAGAVRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASEDVPSTLPEAEKLLAQHEAIKNEISNYSEDHRRMREMGEEVTRDQS--DPQHVFLRQRLQALHTGWAELHSMWDNRRALLAACHAYLAFARDARQADGVLSNQEYALSRVEMPATLQSAEAAIK--------------KHEELT--TSMEANDEKVGSVLDTGRKLVGEGNFNADKIQE 1148          

HSP 3 Score: 63.5438 bits (153), Expect = 6.643e-10
Identity = 136/710 (19.15%), Postives = 293/710 (41.27%), Query Frame = 1
Query: 2689 SWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIRE-KIKLIESMDELGEDL---ESVMQRQRRINH---MQRD-ICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLN-EIVNENEIF-IDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCK--ALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMD---GLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRS 4773
            +W+ E Q+ +       D+  +E    + E  E+++     +V  V  ++  L          +V  +D +   W ++ +++ ++R  L         F +   T  W+ E K++L+    E G+ L   E ++Q+   +      Q D + A+ A       + D     +   A +   QL+  + E   L  L   R + L     +H F+ + ++   W+ Q++  +AS++     +   +L+ ++ +  DE++    QL++ +++G++  +  +   Q  R   R   +++ W  L   +  + +RL           D+  +E    A++  L+      + N   S   L   + ++V E E + ID +      L   L +              ++ + + L+E + +    A  R  +L++ + L+ +  +       L EK Q L+ +  +  K  D  + Q +  +LE E+N     +  +N+  +Q        + +I    D LN+ W+E  +  E K + L      + F+        W++     I +        +G+ ++    +KL     +L   +  + +L+  +E L Q +P++A     +  Q+  T D    L   L ++     +    ++FLQD DD   W+++    + +     +   TL + ++L  +H+++KNEI N S
Sbjct:  337 TWLAENQRLVMQDNFGADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEAERYHEVARVVRRRDGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTGAWMDEMKLRLLSQ--ECGKHLLGVEDLLQKHALVEADVAAQADRVKAVNAAALRFAEEVDGYRPCDPEVASERAGQLEASYAE---LCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGEEEKREAERDAQAAR--ARSAELDKLWASLELAASRRAERLRASEALHQLLSDSADVEAW--ARDASLLVAAGGDVGNDEFSTQALARKHRDVVEEIEGYRIDSLQEQAAALPASLAEPAG-----------VRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALD-IPEKLEDLEVVQHRFESLEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQ---RKLSGMERDLAAIEVKVGDLQGEAERLAQHHPERAGA---VRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASE----DVPSTLPEAEKLLAQHEAIKNEISNYS 1015          
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004049.1 (pep scaffold:Pmarinus_7.0:GL476488:489896:554954:1 gene:ENSPMAG00000003699.1 transcript:ENSPMAT00000004049.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 778.859 bits (2010), Expect = 0.000e+0
Identity = 417/968 (43.08%), Postives = 620/968 (64.05%), Query Frame = 1
Query:  229 ADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCD--QDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAI 3126
            ADERE VQKKTFTKW+NS L  V+ +I DLY DLRDG+ L+ LLE+LS E +PKPT+G+MRIHCLENV+K L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + S   KSAKDALLLWCQMKTAGYP+V + NFT SWR GL F ALIHKHRPDLIDF + +  D   N+  AF++AE  LG+  LLD ED+ V  PDE+SVITYV +YYHYF+ +KA +V  KR+ K+L   +E +QMI+ Y SL S LL+WI  TI +LN R F+NS+ G+QQQ+  F+ YRT EKP+KF EK +LEVLLFTI+S    +  KV+ P E   +S IN AW+ L  AE+ RE ALR+EL+RQEKL  LA++F++KAA+RESW+T+N  L+ + + G++L  V AA KKHEAIETD+ AYEE +  +  ++  L+ E Y+D+  +   ++ VL LW+ L + L  RR  L+  + +   ++E   +   +  +  +    ++GKHL+ V++LL+ H L+E+D   +  R+  + + A ++ +  D  Q     + S   AM++           ELL    +R+  L  S  +W+ + + S EE WI+E   I+++ D G DL+S+ RLL K +  E EL  +   +   + +G+ +V+      + IA +  ++ +LW  L  +   RK++ LE     Q+++D DDA+ W  +  RL     +G     T+ L +K++  +E + NY   I  ++ QA +L    +     V+ ++   +++Y DLL +A + +++L DAL +++L +++D+   WI EKQK+L      + +E+LEV++HRFE  E E++ +  ++  VN ++E+L+ +G+P+   I   +DNLN+ W+     V  K++ LLS     N+ ++C++T  WI++KIKL+ S  +LG DL  VM  QR++  ++RD+ AI
Sbjct:    1 ADEREEVQKKTFTKWVNSHLSRVSCRIGDLYADLRDGRMLIKLLEVLSGERLPKPTKGKMRIHCLENVEKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDSREVKSAKDALLLWCQMKTAGYPNVRVHNFTTSWRDGLAFNALIHKHRPDLIDFDALDPADPYGNMQTAFNVAEQKLGLTQLLDAEDIAVEHPDEKSVITYVVTYYHYFSKMKALAVEGKRIGKVLESAMETDQMIEKYDSLASDLLDWIEQTIAILNNRTFANSLTGVQQQLQAFSSYRTVEKPAKFTEKGNLEVLLFTIQSRMRANNQKVFLPGEGKLISEINKAWERLEKAEHERELALREELIRQEKLEQLARRFDRKAAMRESWLTENQCLVLQDNFGSDLAAVEAATKKHEAIETDMAAYEERVHAVLHVAQELQAENYHDVARVAARRDNVLRLWRYLQELLCGRRARLEANVALQRTLHEMLHLLHSMEELKGRLLSQDFGKHLLGVDDLLQKHALLEADAAVLATRVHNVTAAARKFAENSDGYQACDPQVVSARVAMLE-------GCLDELLRMAAERRAGLLESRRLWKLVGEISEEEAWIREKERILSSDDFGRDLTSIVRLLSKQRALEDELQHREQRVRQAVADGRGMVEERHFAADKIAERAGNLLSLWSELGRAAALRKLR-LEQAASLQFLADADDADAWTMDHFRLVSSGDIGHDEFSTQALAKKHRDIVEEIGNYASAIRGLQEQADALPD-EVARCGGVSDRMSNTKQQYGDLLQLAAQRKQQLDDALALFKLFSEADACELWIDEKQKWLDQLEIPEKLEDLEVVQHRFEGLEPEMSAQDSRIGVVNGVAEHLIRDGHPSETAIHAKRDNLNSRWDVFRKHVAQKKEALLSALSIQNYHLECRETNSWIQDKIKLVASTQDLGNDLAGVMALQRKLFGIERDLAAI 959          

HSP 2 Score: 69.707 bits (169), Expect = 8.224e-12
Identity = 83/379 (21.90%), Postives = 164/379 (43.27%), Query Frame = 1
Query: 4612 QFLQDCDDEIDWMNEKIDLIRNR--SKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINS---KDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLPDEYK--GIVKDVEDN----FNSLKIICAEKKTEI----SLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDL 5703
            + + +  +E  W+ EK  ++ +    + + +I  LL  Q      +++++E+++R  +V   + + + M++E H     + +    L      L       + +   Q A  +FL D  +  +W     +D   LV +     D+   + + +K +++  EI NY   I   ++   +LPDE    G V D   N    +  L  + A++K ++    +LF ++ +        E WI E+ K     +  + L+   +++ RF     E +    S++   N   + LI+  HP   +I   +D +N  W    + +  + + L SA  +  ++ + +     IQ+K   +    DLG D   V  LQRKL   E+DL
Sbjct:  594 KLVGEISEEEAWIREKERILSSDDFGRDLTSIVRLLSKQ------RALEDELQHREQRVRQAVADGRGMVEERHFAADKIAERAGNLLSLWSELGRAA-ALRKLRLEQAASLQFLADADDADAWT----MDHFRLVSSGDIGHDEFSTQALAKKHRDIVEEIGNYASAIRGLQEQADALPDEVARCGGVSDRMSNTKQQYGDLLQLAAQRKQQLDDALALFKLFSEA----DACELWIDEKQKWLDQLEIPEKLEDLEVVQHRFEGLEPEMSA-QDSRIGVVNGVAEHLIRDGHPSETAIHAKRDNLNSRWDVFRKHVAQKKEALLSALSIQNYHLECRETNSWIQDKIKLVASTQDLGNDLAGVMALQRKLFGIERDL 956          

HSP 3 Score: 65.855 bits (159), Expect = 1.085e-10
Identity = 97/498 (19.48%), Postives = 209/498 (41.97%), Query Frame = 1
Query: 1987 RKEILKHS---HLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFK-RLFDLKFLGDKMSFTEILIRKN---QQNMEIVENYRDNI-EQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQL 3456
            R+E+++      L  +F   A++ E W+ E   ++   + G DL++V+   +KH+  E ++++    +   L   + L   +      +AA+ +++  LW  L +    R+ +L   +   + + +       ++E K RL    F G  +   + L++K+   + +  ++     N+    R  A++  GY   D Q V+ ++  +E    +LL +A + +  LL++  +++L+ +     +WI EK++ L +     D+  +  L  +    E EL  R ++V         +V   +     I     NL + W+++     + R   L +     F  D      W  +  +L+ S D +G D  S     ++   +  +I    + I  L  Q D +     R    +  ++    Q++  L QL   R   L +   + +   + D    W+ + Q  +    IPE   + E + +++     EM+A + ++
Sbjct:  363 REELIRQEKLEQLARRFDRKAAMRESWLTENQCLVLQDNFGSDLAAVEAATKKHEAIETDMAAYEERVHAVLHVAQELQAENYHDVARVAARRDNVLRLWRYLQELLCGRRARLEANVALQRTLHEMLHLLHSMEELKGRLLSQDF-GKHLLGVDDLLQKHALLEADAAVLATRVHNVTAAARKFAENSDGYQACDPQVVSARVAMLEGCLDELLRMAAERRAGLLESRRLWKLVGEISEEEAWIREKERILSSDDFGRDLTSIVRLLSKQRALEDELQHREQRVRQAVADGRGMVEERHFAADKIAERAGNLLSLWSELGRAA-ALRKLRLEQAASLQFLADADDADAWTMDHFRLVSSGD-IGHDEFSTQALAKKHRDIVEEIGNYASAIRGLQEQADALPDEVARCG-GVSDRMSNTKQQYGDLLQLAAQRKQQLDDALALFKLFSEADACELWIDEKQKWLDQLEIPEKLEDLEVVQHRFEGLEPEMSAQDSRI 856          

HSP 4 Score: 59.3066 bits (142), Expect = 1.087e-8
Identity = 133/694 (19.16%), Postives = 298/694 (42.94%), Query Frame = 1
Query: 1351 LAQKFNKKAALRESWITDNMELLQKQSLGNNLPTV---LAALKKHEAIETDI-YAYEENLIGL-----TKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHER----REHLDNYLQVYTLINEFCEVQAII-TGITAKQRI---DNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQ----EFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDI------AHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNF-IPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNN-QDNLNNSWNKMADIVD---SKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWL 3336
            + +K++  A+    WI   + +L  ++  N+L  V   L A   +  +E    +  + NL  L     +++  N ++        +I+  NK    W++L +  HER    RE L    ++  L   F    A+  + +T  Q +   DN+G  L  VE   + HE IE+D+ +  +R+  ++  A        Q+ ++  N  + A +  +R++ ++ +  L + L  R+  L+ +  + + + +       ++EL   + + D G  L  VD LL+KH + E + +     + N     +   + S   Q    + ++A+   ++   + L+     R+  LLE    ++ V +  + E WI E +R+      G  ++    L+ K Q+ +E    +R+  +++R       G  +V+ +  A   D+I ++  +LL +      A  +++  L+     + L D+D   +W  +  + + +  I  D+     + K   ++ E E+   A  +  +   ++ L     P+         D ++N+  +  D++     ++ +L         F +      WI EK K ++ + E+ E LE +   Q R   ++ ++ A +++I  +    + ++R    S   I  + D ++  W++ ++ +  +   L +   I  +  +  + ++W+
Sbjct:  255 MIEKYDSLASDLLDWIEQTIAILNNRTFANSLTGVQQQLQAFSSYRTVEKPAKFTEKGNLEVLLFTIQSRMRANNQKVFLPGEGKLISEINKA---WERLEKAEHERELALREELIRQEKLEQLARRFDRKAAMRESWLTENQCLVLQDNFGSDLAAVEAATKKHEAIETDMAAYEERVHAVLHVA--------QELQAE-NYHDVARVAARRDNVLRLWRYLQELLCGRRARLEANVALQRTLHEMLHLLHSMEELKGRLLSQDFGKHLLGVDDLLQKHALLEADAAVLATRVHNVTAAARKFAENSDGYQACDPQVVSARVAMLEGCLDELLRMAAERRAGLLESRRLWKLVGEISEEEAWIREKERILSSDDFGRDLTSIVRLLSK-QRALEDELQHRE--QRVRQAVAD--GRGMVEERHFAA--DKIAERAGNLLSLWSELGRAAALRKLRLEQAASLQFLADADDADAWTMDHFRLVSSGDIGHDEFSTQALAKKHRDIVE-EIGNYASAIRGLQEQADAL-----PDEVARCGGVSDRMSNTKQQYGDLLQLAAQRKQQLDDALALFKLFSEADACELWIDEKQKWLDQL-EIPEKLEDLEVVQHRFEGLEPEMSAQDSRIGVVNGVAEHLIRDGHPSETAIHAKRDNLNSRWDVFRKHVAQKKEALLSALSIQNYHLECRETNSWI 922          
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000684.1 (pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 gene:ENSPMAG00000000623.1 transcript:ENSPMAT00000000684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 337.421 bits (864), Expect = 4.207e-102
Identity = 193/486 (39.71%), Postives = 294/486 (60.49%), Query Frame = 1
Query:  256 KTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPED-VNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVS---KLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGN-NLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNK-VLDLWKKLLQTLHERREHLDNYLQVYTLINEF 1695
            +TFT W NS L     +I+ +  D RDG  L++LLE++S+E +PKP +G+MR+H + NV+K L F+ ++ V L ++GA +IVDGN ++TLG+IWTIILRF +QDI  +        SAK+ LLLWCQ KTA Y +VN++NF  SW+ GL F ALIH+HRPDLID+    ++D I NL+ AF++AE  L IP +LD ED VN   PDE++++TYV+ YYH F+  + +     R+ K+L     + + + L  + V    +LLEWI  TI +L  R   N++P +Q ++  F  YR   KP K  +K  LE+   T+++   +     + P E   +S I +AW  L  AE G E  L  E+ R E+L +LA+KF +KA + +SW     ++LQ++   + +L  + A LKKHEA E+D+ A+++ +  +  I+  L +  Y+D+ S +NTK K + D W  L +    R++ L    +V   I+  
Sbjct:    4 QTFTAWCNSHLRKAGTQIDSIDEDFRDGLKLMLLLEVISSERLPKPEKGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNTKMTLGMIWTIILRFAIQDISIEN------TSAKEGLLLWCQRKTAPYKNVNVQNFHTSWKDGLAFNALIHRHRPDLIDYDKLRKDDPIGNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSCYYHAFSGAQKAETAANRICKVL---AVNHERVDLSCACVRARLQLLEWINRTIPVLEDRNTQNNMPAMQGKLEDFRDYRRVHKPPKAGDKCQLEINFNTLQTKLRLMNRPAFMPSEGKLVSDIGNAWSHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKAKIHKSWTEGKQQMLQQKDYESVSLAELKALLKKHEAFESDLAAHQDRVEQIAAIAQELNDLNYHDVAS-VNTKCKEICDEWDDLGEWTQTRKDSLSRTEKVLETIDHL 479          
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009295.1 (pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 gene:ENSPMAG00000008383.1 transcript:ENSPMAT00000009295.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 337.421 bits (864), Expect = 3.889e-98
Identity = 190/481 (39.50%), Postives = 289/481 (60.08%), Query Frame = 1
Query:  259 TFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPED-VNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGN-NLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEF 1695
            TFT W NS L      IE++  D R+G  L++LLE++S E + KP RG+MR+H + NV+K L F+ ++ V L ++GA +IVDGN ++TLG+IWTIILRF +QDI  +E       SAK+ LLLWCQ KTA Y +VN++NF  SW+ GL F ALIH+HRPDLID+    ++D I NL+ AF++AE  L IP +LD ED V    PDE++++TYV+ YYH F+  + +     R+ K+L    E+E++++ Y+ + S LL+WIR T  L N R   N++  +Q ++  F  YR   KP K  EK  LE+   T+++   +     + P E   +S I + W  L  AE G E  L  E+ R E+L +LA+KF +KA + E+W      +L+K+   + +L  + A L+KHEA E+D+ A+++ +  +  I+  L E  Y+D+ S+      +   W KL      R++ L+   +V   I++ 
Sbjct:    1 TFTAWCNSHLRKAGTGIENIDEDFRNGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEE------TSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPDLIDYEKLRKDDPITNLNNAFEVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSCYYHAFSGAQKAETAANRICKVLAVNQENEKLMEDYEHMASDLLDWIRRTPWLEN-RVPENTMQAMQGKLEGFRDYRRVHKPPKAQEKCQLEISFNTLQTKLRLMNRPAFMPSEGKMVSDIANGWSMLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKAKIHEAWTAGKEAMLEKRDYDSVSLTELKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDVASVNARCQDICAEWDKLGDLTQRRKDTLERTEKVLETIDQL 474          
BLAST of Spectrin beta chain vs. Ensembl Yeast
Match: SAC6 (Fimbrin, actin-bundling protein; cooperates with Scp1p in organization and maintenance of the actin cytoskeleton; phosphorylated by Cdc28p/Clb2p in metaphase on T103, to regulate conformation, and modulate actin filament binding affinity and actin cable dynamics; relocalizes from the plasma membrane to the cytoplasm upon DNA replication stress; human homologs PLS3 and LCP1 implicated in spinocerebellar ataxia type 2 (SCA2) can each complement yeast null mutant [Source:SGD;Acc:S000002536])

HSP 1 Score: 55.0694 bits (131), Expect = 1.218e-7
Identity = 68/240 (28.33%), Postives = 103/240 (42.92%), Query Frame = 1
Query:  235 ERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIV------PKPTRGR--MRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDA----LLLWCQMK-TAGYPSVNIRNFTNSWRTGLGFVA-LIHKHRPDLIDFS----SCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVAS 900
            ERE    + FT W+NS  + V   +  L+ DL+DG  LL   E +    V       +P  G    R   LEN +  +     +   L  +   DIVDGN  LTLGL+W ++ R              ++ S +D     +L W Q + T G  +  IR+F +   +   F+  +++   P  +D+          +   N  LA  IA   LG    L PED+N      R +IT++AS
Sbjct:  411 ERE---ARVFTLWLNS--LDVDPPVISLFDDLKDGLILLQAYEKVMPGAVDFKHVNKRPASGAEISRFKALENTNYAVDLGRAKGFSLVGIEGSDIVDGNKLLTLGLVWQLMRR------NISITMKTLSSSGRDMSDSQILKWAQDQVTKGGKNSTIRSFKDQALSNAHFLLDVLNGIAPGYVDYDLVTPGNTEEERYANARLAISIARK-LGALIWLVPEDINE--VRARLIITFIAS 636          
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Match: EDO42431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C0])

HSP 1 Score: 1107.05 bits (2862), Expect = 0.000e+0
Identity = 716/2112 (33.90%), Postives = 1175/2112 (55.63%), Query Frame = 1
Query:  190 TSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSD---DIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELG--EDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKD--IEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKM-LSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDG---------------------LSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIR 6399
             +++FERSRIK LADERE VQKKTFTKWINS L  V  ++ +LY DL+DG+ L++LLE+LS E +PKP++GRMRIH LENV+K L FL  Q+VHLENVGAHDIVDGN ++TLGLIWTIILRFQ+QDI   E  +   +SAKDALLLWCQ KT GY  V I NFT SWR GL F A+IH+HRPDLI+F    + D   NL  AF++AE  LGI  LLD EDVNV  PDE+S++TYVA+YYHYF  +K   V   R+ K++ ++ E+E++I  Y+ L S LLEWI   I  L  R+F+N++ G+QQQM  FN YRT EKP +FVEK +LEV LF + S    +  K Y PPE   +  IN AW+ L  +E+ RE ALR+ELMRQE+L  LA KF++K A+RE+W+ +N  L+   + GN+L  V AA KKHEAIETDI AYEE +  +  +++ L  E Y+D   I   K +++ LW+ LL  + +RR  L+  +Q+  +  E   +   +  I      ++YGKHL+ VE+LL+ H L+E+DI +   R++ + ++A  ++   D++ ++  +  ++A I++ +      ++ELL     R+  L+ S  +  F  +A  EE W+ E    + + D G+DL++   LL KH+  E E++++    +     G+ L++  P   + I  + + I++ W+ L D+   RK K+ E L   Q++++ +D   W D  +R+     LG      E+L++K+    E ++ Y   ++    Q    LG        V  + + ++++Y  LL  A   ++KL DAL++++L  ++  V +WI E++  L   +  D   D+EE +V++ RFE F+ EL     +V  VN L  NL+  G+ N   I    D LN  W  + D  + KR +L        F+    +T  WI EK  L+ + +++   +DL +VM  QRR+N++QRD+ A+E K   L     ++        ++  ++ ++ +V   W  ++  ++ RD  LA   ++ RF+  LDDF  WL     E+AS++IP S SEAE+ + ++   +DE+   E   ++ ++ G  + + E D  Q   L+ +++ +   WK L  L E +++ L + L   +F  DA+Q E +L  Q+ +L K+            + + ++ E++ ++E F  +M + DEK+  ++ +  + L  + +  +D++  K QNL ER   N    +    +L++ + L + +QD +D+ D L EK QV +E S  +  +    + + +A E E+ A +  ++++++ G+  + + P  K EI + L  L+  W EL++  + K   L    R++ F    Q+M +W+K +E  I+  ++     + +T+ T   +K                    H +L KQ N  K  + ++L+ Q    +D                      L  PL  K +  +Q +   QF +D DDE  W+NEK  L+++ +        L + Q+LQ +H+++  EI       + +  +   ++   H +   +     +L++  ++L ++ + ++  L   L  +++  D +E  SW+SE+EL++MG     KD+     ++++ + LE  I +Y   + E  ++   L     P+  +  ++   ++  +  LK +  E++ ++       +T +LYQ      ++E WI ++ ++A S D G+DL  C LL ++F  F+ +T  IG+ +V   N   D+LI   H  A +I+ WKD INE WADLLELI+TR ++L++A +LH++Y D++ +L  IQEK + M    +LG+D  SV  LQR  ++FE DL  L   ++     +  LL  Y  +K + +  K  E++ A+++L   +  R     +  D + FL  V++ + W+ ++   +    K +DVSG+E+L+  H+S  +E++ +EE+F   + +G  LL   H  S EI+ K   +   +D +  +W    +HL L++EV Q+ARDA +AEAW+++QESYL NENLG+ L E   LL+K   F+K    QEE+F  L+RLT  E+R
Sbjct:    6 AARLFERSRIKVLADERERVQKKTFTKWINSHLQRVGARVNELYHDLQDGRKLILLLEVLSGEKLPKPSKGRMRIHNLENVEKSLVFLKKQRVHLENVGAHDIVDGNQKITLGLIWTIILRFQIQDITI-EGETTEKRSAKDALLLWCQSKTVGYVHVTITNFTTSWRDGLAFNAIIHRHRPDLIEFEKLTKADAEQNLEQAFEVAETQLGITPLLDAEDVNVDFPDEKSILTYVAAYYHYFAKMKTVEVSGSRIGKVIERIKENEELIIDYEKLASDLLEWIEIKIIQLGEREFANTLLGVQQQMLEFNQYRTQEKPPRFVEKGNLEVQLFILTSKIRANHQKPYIPPEGRGMIDINRAWERLEKSEHERELALREELMRQERLEMLAAKFDRKYAMRETWLNENQRLVAVDNFGNDLAAVEAATKKHEAIETDIMAYEERVNAIVAVAEELHRENYHDSERIQVCKGRIIQLWELLLVLIKQRRVRLEKCMQLQRVFQEMINIIDWMDEIKIGLLSEDYGKHLLGVEDLLQKHSLVEADIAAQADRVKTVNAQAEAFLHVEDEEGKTQ-HKPDEAQIRDHQAELEGAYNELLQLAAARRARLEESLKLQSFYRNADEEEMWVTEKDYFVQSTDYGHDLNTAMILLTKHEAVEREMTARNAQTKAVARNGEELLEAVPYATDTIQNRLDTIRSKWDKLHDNAAYRKKKIQENLKLQQFIAEYNDIMSWCDMMERIVANDDLGYDEHSAEVLVKKHHAVEEGIQGYASEVKAFHCQVDG-LGDEDKSSPEVVDRCNTLDERYSALLQQAAARRQKLQDALSLHKLNREAYIVETWIDERENRLDTALTVDKGMDLEECQVIEQRFEGFQQELDANERRVQLVNELGGNLIEKGHINSDEIKETIDRLNTRWCNLRDTANQKRAKLDKALRLQQFYAQTLETKTWISEKSSLLITEEDVTNMKDLATVMVLQRRLNNIQRDLPALEDKCTSLENDAQQLCSEYEGEPEEEIVKEKITVVSSSWVEMKDNVKQRDEALAESGELQRFVIDLDDFQIWLRHTHNEVASEDIPNSLSEAERSLKEHEDIKDEIDTHEPDFQKLIEDGPKWAQDESDLQQ-QSLKEQLDQLQSGWKDLLVLWENRKRLLIQALNHQLFIRDAKQCEALLGQQDLFLSKE---------EVGATVEAVQELIKKHEEFSKRMDVQDEKINQMI-QFAQRLANDGHYAQDKITEKAQNLHERRNANRQKLEAALQRLRDALQLQQFIQDAEDMYDWLNEKHQVASEESYRDLSNIQGKVMKHEAFEAELQANKERLDQISESGRDLADEKPENKPEIDELLQKLDQKWLELAEVSKHKGSKLKDAQRQEEFNAGVQTMQEWVKELETVIITQEKA----TDLTTATRLYQK--------------------HKQLEKQINA-KKERLKELDAQAADMVDAGHFDPNAVQETKIILEEKYECLEAPLAEKGAELDQAMQFFQFDRDVDDEETWINEKEPLLQSTNYG----NNLFEVQKLQKKHQTLCAEIDIHQKHKERICNQGDELVLGYHPQAEDIERRRKELEEKWDDLKKQSDAYKAQLDLSLQAKQYYFDAAEAESWMSEQELNMMGDE-RGKDEASATEMLKRHETLEAAIADYAETVNELGETANGLVESNHPESEQIKIRQNQIDKLYAGLKDLAEERRGKLD------ETLKLYQLNREVDDLELWIADKEQVAGSQDIGQDLAHCELLIEKFRDFARDTTHIGTERVASTNGVCDQLIGTGHSDAATIAEWKDGINESWADLLELIETRTKMLEAALELHKYYHDAKEVLAMIQEKDNLM--TEELGRDLNSVQQLQRTHQSFEADLAPLGHQVSGIQEEAGRLLGSYAGEKASEIQAKEDEVVQAWKNLNLRVRQRTDKLHDADDLYRFLIAVQDQMLWMNDMLKHILTYEKAKDVSGVEVLMDQHQSRHVEIEGREESFFGVIKMGEQLLAKSHYASAEIREKINMLHRHKDEMLLEWKKRWEHLGLILEVMQFARDAYTAEAWIMAQESYLRNENLGIDLAEVEKLLEKHGNFEKVVAAQEERFLALERLTQFELR 2065          

HSP 2 Score: 78.5666 bits (192), Expect = 3.706e-14
Identity = 44/124 (35.48%), Postives = 60/124 (48.39%), Query Frame = 1
Query: 6841 MKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPST 7212
            M+G L+RK   +  N+KA+ R W   YV+L    + FFKD++      +  +    PL   + V   A DY KR  VFR R  NG E+LFQ     DM  W+  +   +    QV  S   PST
Sbjct: 2159 MEGYLHRKPTMDGPNRKAAIRQWKQYYVILRDMELHFFKDQK----SARNDHAAAHPLATLDSVCEVASDYTKRKHVFRFRVSNGQEFLFQAKDEEDMNIWIKHVQECA----QVPESPAKPST 2274          
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Match: EDO49576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP7])

HSP 1 Score: 531.176 bits (1367), Expect = 2.192e-165
Identity = 302/789 (38.28%), Postives = 472/789 (59.82%), Query Frame = 1
Query:  187 VTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDL---KFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSI 2544
            V +  FE+ RIK L +ER   QKKTFTKW+NS L    + + DL+ DL DGK L+ LLE++S E +    RG+ R+H ++NV+K L FL  + V LE++GA D+VDGN RL LGLIW IILRFQ+ DI + +D S   KSAK+ALLLWCQ  T GYP V+I+NF+ SWR GL F AL+HKHRPDLID+++   + +  NL+ AF +A   LGI  LLD EDV+ P PD+RSV+TYVA+YY YF  LK+     +R+ K++  ++E E+M + Y+S+VS LL WI + I  L  R F  +I  +Q+++  F  +RT EKP K+ E+V++E  LF +++ +  +  + + PPE   +  IN AW  + +AE+ R  ALR EL+RQ+ L  +A+KF +KA LRESW+ D ++++  + LG +  TV AALK+HEAI TD+ A EE    +  ++  L +E Y     I   ++ ++  W KL++ L  RR  L  + Q+  +  +     A +  I A  R ++YG+HL++V+ +L  H L+ES I+S ++R   + ++A  +V                 +IK+++    + F  L+    +R+  L+ S  ++ F  D   E+ +IKE   +  + ++G DL+S+ RL ++H+  E E++ +    E  + +G+ L+D    G + I AK   +Q  W  L +   +R+ +L +     QY SD +DAE W+ E  ++F +    +  D+ S   +L R +    EI + + D+I Q++ Q++ L+G +I
Sbjct:    4 VEAPTFEKDRIKTLKNERIFSQKKTFTKWVNSFLDKSGLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKFRVHNIQNVNKALEFL-QKSVKLESIGAEDVVDGNERLILGLIWMIILRFQIADISYQDDMSKERKSAKEALLLWCQRMTRGYPGVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAAEKLGITRLLDAEDVDCPRPDDRSVMTYVAAYYQYFAKLKSEETGGRRIAKIIGVIMEIEKMEKSYESMVSDLLHWISSKITEL-ARPFEKNIFAVQRELGAFKHFRTVEKPPKYTERVNIEAHLFNLQTKRKANNQRPFAPPEGKLVKDINRAWQVMESAEHERAQALRNELIRQQMLEKMAEKFQRKADLRESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFVA---------AKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKE--KMFVVCSEDYGRDEQSAVSLLQRHSHIEDEI-KAFADDIAQLKEQSK-LMGEAI 777          

HSP 2 Score: 85.5001 bits (210), Expect = 1.746e-16
Identity = 80/388 (20.62%), Postives = 163/388 (42.01%), Query Frame = 1
Query: 2023 QFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWI----------DEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQ 3156
            +F   A L E W+ ++V ++++  LG D ++V+  L++H+    ++ ++    +      + L+D      + I  + + I   W+ LV   E+R+  L           D D A   +          D  + L D++ + DK S  E  I+   +              I  QAQS +     + + + ++   + + +Q L+ +  + + +L D+L +Y    D +    +I E  K   +     D+  L  L+ R E  E+E+  R      +    + L+  G+   + I      L  +W K+ ++  ++R+ L        ++ D      W++EK+ ++ S D  G D +S +   +R +H++ +I A    I  L  Q
Sbjct:  393 KFQRKADLRESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLA----------INTQAQSFVAAKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSED-YGRDEQSAVSLLQRHSHIEDEIKAFADDIAQLKEQ 769          

HSP 3 Score: 81.2629 bits (199), Expect = 3.547e-15
Identity = 91/448 (20.31%), Postives = 199/448 (44.42%), Query Frame = 1
Query: 2197 EGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAME---QQLEEWMKI-GKDFLKSEQDKDQFVRLQ 3528
            EGK + DI+   Q   +A++   Q L   L+     R+  L +M + +Q  +D    E W+D+  ++ D + LG   +  E  +++++     V+   +  + + N AQ L+         + K+ D I  K+  L+      +  L     +  +  D DS  + + + +  L +      + +++ +  +  + ES++  + E+   +N  +++ V   +P  ++I   Q  L  ++  +  +   +R  L        FF D ++   +I+E  KL  S  E+G DL S+ + Q+R   ++ +I    +  + ++A+G  ++      AK+I+ ++  +   W  L++L   R   L +     ++    +D  +W+ +    + S++    +  A  L+ +++   DE+ A      QL+E  K+ G+    + Q    FV L+
Sbjct:  352 EGKLVKDINRAWQVMESAEHERAQALRNELI-----RQQMLEKMAEKFQRKADL--RESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFVAAKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAAS-KEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEIKAFADDIAQLKEQSKLMGEAIKNTSQQVPHFVSLK 791          
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Match: ALPHA-ACTININ (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4X0])

HSP 1 Score: 361.688 bits (927), Expect = 1.017e-105
Identity = 227/590 (38.47%), Postives = 328/590 (55.59%), Query Frame = 1
Query:  163 EDEVQYANVTSKVFERSRIKALADER-ENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPED-VNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGN-NLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLIN----EFCEVQAIITGITAKQR---IDNYGKHLM-EVEELLRSHELIESD----------IRSINQRLEKLISEANRYV 1869
            EDE +Y       F     K L D   E  QKKTFT W NS L     +I ++  DLRDG  LL LLE++S E +P P RG++R H + NV+K L F+  + V L +VGA +IVDGN ++TLG+IWTIILRF +QDI  ++ +      AKD LLLWCQ KTA Y +V+++NFT S++ GL F ALIH+HRPDLID+ S  + D + NL+ AFD+AE  L IP +LDPED V    PDER+V+TYV+SYYH F S + +    KR+ K+LN   ++E+M++ Y+ L S LL+WI  T+  L  R    ++  +Q++++    YR GEKP K  EK  LE    T+++   +S    Y P E   ++ IN AW  L  AE   E  L  E+ R E+L +LA+KF  K  + ESW      +L K    +  L  + A +KKHEA E+D+ A+++ +  +  I+  L    Y+ I  +      + D WK L +    R + L++  Q    ++    EF +  A         R   +D +  H + E++ELL +HE  + +          I  I  ++E L  + N Y 
Sbjct:    3 EDEQEYYGY----FYGEEDKGLLDPAWERQQKKTFTAWCNSHLRKTGKQIGEIEEDLRDGVLLLQLLEIISGERLPHPERGKLRFHRIANVNKALDFVAGKGVKLVSVGAEEIVDGNLKMTLGMIWTIILRFAIQDIAIEDSF------AKDGLLLWCQRKTAPYKNVSVKNFTTSFKDGLAFCALIHRHRPDLIDYDSLRKEDPLYNLNKAFDVAEQYLDIPRMLDPEDMVETERPDERAVMTYVSSYYHAFTSSQQADTAAKRIGKVLNINRDNERMMEDYERLASDLLDWINKTMPWLTSRDTDGTLKDMQRKLDELRNYRKGEKPPKVEEKGQLETNFNTLQTKLRLSNRPAYLPSEGKMINDINDAWGGLEMAEKDFEDWLLMEMRRMERLDHLAEKFRHKCNIHESWTNGKDAVLSKDDYSDATLADINALMKKHEAFESDLAAHQDRVDQIVAIAQELNALEYSKIDEVNARCQNICDDWKDLGELTMHRLQKLEDAQQRLQSLDQLRLEFAKKAAPFNNWLESAREDLMDMFSVHTVEEIQELLDAHEAFKENMPAAQAEYNSIMDIAVQIESLSGQENPYT 582          
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Match: EDO29101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4L2])

HSP 1 Score: 342.813 bits (878), Expect = 1.148e-105
Identity = 175/364 (48.08%), Postives = 245/364 (67.31%), Query Frame = 1
Query:  187 VTSKVFERSRIKALADERENVQKKTFTKWINSTL--IHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAW 1272
            V +  FE+ RIK L +ER   QKKTFTKW+NS L  +   + + DL+ DL DGK L+ LLE++S E +    RG+ R+H ++NV+K L FL  + V LE++GA D+VDGN RL LGLIW IILRFQ+ DI + +D S   KSAK+ALLLWCQ  T GYP V+I+NF+ SWR GL F AL+HKHRPDLID+++   + +  NL+ AF +AE  LGI  LLD EDV+ P PD+RSV+TYVA+YY YF  LK+     +R+ K++  ++E E+M + Y+S+VS LL WI + I  L  R F  +I  +Q+++  F  +RT EKP K+ E+V++E  LF +++ +  +  + + PPE   +  IN AW
Sbjct:    4 VEAPTFEKDRIKTLKNERIFSQKKTFTKWVNSFLDKVRSGLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKFRVHNIQNVNKALEFL-QKSVKLESIGAEDVVDGNERLILGLIWMIILRFQIADISYQDDMSKERKSAKEALLLWCQRMTRGYPDVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAEEKLGITRLLDAEDVDCPRPDDRSVMTYVAAYYQYFAKLKSEETGGRRIAKIIGVIMEIEKMEKSYESMVSDLLHWISSKITEL-ARPFEKNIFAVQRELGAFKHFRTVEKPPKYTERVNIEAHLFNLQTKRKANNQRPFAPPEGKLVKDINRAW 365          
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Match: EDO49575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP6])

HSP 1 Score: 313.153 bits (801), Expect = 2.598e-85
Identity = 433/2021 (21.43%), Postives = 864/2021 (42.75%), Query Frame = 1
Query: 1426 QSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNK-VLDLWKKLLQTLHERREHLDNYLQVYTLIN------EFC-EVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIE-HQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEM----------AAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEK-ILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQN-----------------PDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLPD----EYKGIVK---DVEDNFNSLKIICAEKKTEI----SLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQ-----NIRRFNSIDS----SLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSA-SPKPATTRTI--------PPEE-----VLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCV---FRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMR--QVNPSNTNPSTTQSHPNLSSSLPPQAQ 7260
            + LG +L +     +KHE  E ++   E+ +  LT  S  L+          +    K VL LW++L +    +R  L +  + Y L N       +C E   +I        + +  + + E++E     +  E     + +  EK+I + +    F +++            I +K    + +   L  S D RKE L  ++ +  F+ DA   + +      ++   +LG  +  V+ LL+KH+  E  + S+   L    + GK L+D      + I  + + + +  E L    + R+ KL       Q+  D  ++E WI E  +    +   D ++    L +      E+  + R  I+ +R++ + L+         V  +++ +  ++++LL+ +     KL +A    +   + D   S IT+K+  + +     D E    L+ + + F+ +L   A +V  +N L+E L+  G+     I   Q+ L   WN++ D    +R +L        F  +C+     I EK   +++  E+G DL +V    R+ + ++R++  IE K++ L  +   ++R     A+ ++  Q D++ Q WE L  L   R   L     +  F+    D  +W+  + T M+S  + ++  +AE ++  +  ++ +M           A    L E   +  D +K  Q+ D  V     ++ + Q  K++          L++     MF  DA + E  I N Q          ++     S+ +L ++  ++  +  F   + + E+ +  +    K  +   + + + +++K   + ++W+     A +R  KL E  LL + L+D  +L+  + EK+Q+  E S     +    L + +  E E++A++  ++ + + G+    + P  ++ +   L +L   W+ L    + K Q L    +++ FE +   +  W++ +E  + ++D     RS    + N +K+  S  M++   +  +      SELLKQ                    D A ++EQL          +    E +L + +  +   QFL D   E+DW+ +K  +    +K  +    LL  Q L  + + +++EI +  + V +L++  ++++   H     +      L +  E L    +     L   LA  ++   V E+ +W+SEK L L+      +D+     ++RK   L++E+     KI + +     L D    E+  + K   ++E+ +  L+ +  ++   +     LF    +  EL     AW+ E+  I  SDD G+DL+   +L  +F +F+ +    G  ++ +  +    L+  +H  +  I    + I E W  L E   TR++ L  A DLH +      +   IQEK  ++ V  +   D + V  LQRK + F++DL  L   ++  +  ++ L       K   LI ++QE+  A++ L+++   ++ + L+      FL   R+L+ WIE  + Q+         + +E L+A ++ L+ E+DS+  +     +    LL + +  + +I++K   + D  D L          L    E+ ++ R+A   EAW+ ++E  L +E++G +L+    LLKK   F+K  + Q EKF  L   T+  +  K     +       +N E+         ++ +T++V     KP I    E  +Q      ++   S+ +    S    S  + +  F  V+ ++ +      SS  +  P  K     +P N +  V NL  ++++ S+ S  PA    +         P+E     V+++G L R+ + +   + A +  W +LY +L    + F+ D++ F     Q        V  ++    ++ +++       FR+   +G+++LF+   V+D  RW + I +++      Q N  +    T Q  P     +PP +Q
Sbjct: 1512 EDLGRDLASTQVLQRKHEVFECELVTLEKQIEELTVESARLQATYQGQTARSVEQHEKYVLSLWEELKRKTSRKRRKLHDAYEFYKLGNTVRDLISWCIETSRLIASDDPVHTVSDAERMMRELDEHHAEMDAREESFARVLETGEKMIEDGH----FAEEE------------ITDKLELLLSERERLYASWDTRKEELSEAYYLHVFLKDAKQVDSFTSSQEAVLLCAELGNSVDEVEFLLKKHENTEKLVLSQEEKLSALQVLGKELIDNQHNQSDMIRNRLSGVCDRREKLKAELDKRREKLQNSHKIMQFYQDVVESESWIMEKLQTATDESFKDPINLESKLQKHQAFESELTAHER-AIDSVRDKGEQLISCGHFAASEVEVRIEALYIQWEELLEASATKGRKLQEARDHQQFNQEVDIADSCITDKETIVLSSDYGRDFEHCVRLQRKMKEFDQDLAVDAARVEAINVLAEKLIGQGHAGSVRIQQRQNALTERWNRLQDKASERRQKLAEACEIHAFNRNCRDVSSMINEKAA-VQTSGEVGRDLPAVEALIRKHDDVERELTVIEGKMEELEGEAYRLVRSQPHMARAVQAKQADIIEQ-WERLNDLFDQRKVILEANRLLQIFLVDYRDLMSWMNDLGTRMSSGELADNVRDAEAMLGLHEERKGQMNARMDSYNATVAFGMSLVEQGHVSADVIK--QNVDDLVLENTELQQLWQSRKLM----------LQQSTDLQMFLADAEKAENWIKNKQ----------MVAQSIESRESLDNVESLLKSHINFEKSLSTYEENIRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMNEKLQIAAEASYREATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRS----VNNLIKRHQSLQMDIARYEDRV------SELLKQAGEFVAAEHFLKDEIADRAADVAERFEQL----------VEPATERELRLQD-SLALHQFLADTQVEVDWIKDKEPI----AKSEDYGRNLLGVQSLMKKMEGLESEINSHELLVQALLETGEQLVLRGHYAERDIGAKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEK-LSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDAGDTEFSKLEKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELG----AWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGE-RIAKLTEHAQMLLDDEHTDSEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGVAENGAPDLRHVQALQRKHQGFQRDLQALGEKVDLVLRDADDLSAKVPAHKH-ELIMEKQEVQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFADVETLIAQNQELQTEIDSRANSVEEFQSRADQLLGSGNPSAEDIRNKSSHVRDTWDRLGASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSEDVGDSLEAVEELLKKQDEFEKMLLTQGEKFNSLTN-TSFSVHKKSCAPKQ-------VNSEEA------RTVKAVTDSVVA---KPGIDVAKEIPEQMNGLSEVKESKSVSAESMDSFGNASAARTSSPFNAVSPQRQLDSSDKASSTQTSSP-FKAVLPQRPINTADEVTNLINASNLKSSLSESPAEKEQVRSPLEFDPGPKEIQKTLVVLEGMLRRRQELQTAGRNAGSNIWQNLYSVLIDKSLLFYGDKKSFSGGGNQ--------VSPQIELRGSRLHVEEESTNHEFRLLLPDGSQFLFRCKDVLDFHRWTNEIEASTNDGEDVQSNGGHEKIETDQISPMSLDKVPPYSQ 3433          

HSP 2 Score: 241.121 bits (614), Expect = 1.965e-63
Identity = 274/1296 (21.14%), Postives = 568/1296 (43.83%), Query Frame = 1
Query: 2548 DHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMD-CQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSE----QDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQ--NPDK-ASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVIN---SKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-------PDEYKGIVKDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRL 6381
            D   VA +   I   Y  L++ +   +  L  A+  Y   ++ + +  W++ K++   +    + ++ ++ ++ + E F +E+  +  +V  +N L++ L+ +G+ +   +   +  +N  W K+  +   K +E L++ H    F+D C++   WI+EK   +   +ELG+D+E+V  + RR   ++RD+ A+E K+  L  Q   ++  + R A+ I+ +   V   W IL+     R   L        F+    D  +W  +++    S   P+  + A +LI ++  + DE+    ++ ++  + G++ L +     Q K     L+    +++  W   ND   +                                  D+QS ++           +  ++ ++E F+  + + E+ +  +    KT+I   +  +D + ++ +++  R       A +R+  L    +L   ++D D+    + EK Q+  + S  + K+    L + KA E EI A +  I+ +NK GK          +++ D L  LN  W  L     EK   L    R++    + + +  W+   E  ++  ++     +G+  +T + + L+S      +   +++      EL+ Q   N D   S  E L+++ +     L    + + S+        QF+ D + E+ W+ E +     ++   +   +L+  Q+LQ RH + +NE+ N   ++D+++   Q +ID  +     V +   +L+   + L +   + +  L +    Q++L + +E  SW+++K     GL  +    KD      ++ + + L++++  +   I+E  +    L        ++     +D+E+ F  L  +   + T ++      +     + I A++ E+ + A S+D G D +   +++ RF  F         +  N  N     L+   H    +I   +D    +W  L + I  R + L SA ++HR+  D   L+  IQEK +++ +  DLG+D  S  +LQRK + FE +L+ L+  I      S  L   Y      ++ +  + ++  +  L++    ++    +  +F+   + VR+L+ W  E +  +        VS  E ++        EMD++EE+F+  L  G  ++   H    EI  K + +  +R+ L+  W    + LS    ++ + +DA   +++  SQE+ L    LG ++DE   LLKK    +K  ++QEEK   L+ L
Sbjct:  527 DRDNVAVRQITITNTYNRLIETSEMRRLSLQKAIKYYHFCHECEDMDLWMSNKERQFKSIESQNTLDAIQTVRQKLERFATEIATKCSRVSDINQLADELIQDGHAHSAAVKAKRKEINERWEKLQRL-KVKEEENLAEKHGVELFLDVCEEMRSWIQEKDAAL-CKEELGKDIETVRAQLRRHQGIERDLAAVEDKVAKLQDQAKSLVVRHPRQARQIKAKEGEVISLWAILKSKANKRKGLLDEAYGQQGFLADARDLMSWSAELKESFISAEDPQDIASASELIQQHEEKFDEIQTRFERFDQLDEYGRNLLATSPQAVQVKQSMAALKAEKAALSSSWAKRNDRLHQGL--------------------------------DLQSSVDE----------VEWLLKKHEDFVKTLTAQEEKVRSLADMAKTIIHARHQARDWVASRAESVINRRDNVKNQASDRQKALLTSQVLQNFIRDADEFGGWIKEKSQIAEDESFKDPKNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKVKDKLKGLNEAWLNLVADTTEKGNKLQQAERQRQLNRAMEDVRIWMNETEA-VLGLEDTGRDLAGVKFLTKKHQLLESD--IEMHATVIVDVADKAQELVSQGHFNSDTIKSDSENLQSRYR----SLLCLTDKRRSVLEDAFALHQFIYDIEVEMTWVREHL----QQASSGDLGTSLISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSATDKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDK----AGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQSSHFDSEKISSTQRDLEEQFCGLNTLVKTRHTRLTESKKLHEYRREVEEISAYVSEQLQTAASEDYGTDFEHLQVIQGRFGDFQRSVASYAENFRNVDN-LAKMLVSEGHTDTVAIKEQQDITRSMWLHLEDQIRLRQKRLTSAEEIHRFNRDLNELISRIQEKDAAINL-EDLGRDLASTQVLQRKHEVFECELVTLEKQIEELTVESARLQATYQGQTARSVEQHEKYVLSLWEELKRKTSRKRRKLHDAYEFYKLGNTVRDLISWCIETSRLIASDDPVHTVSDAERMMRELDEHHAEMDAREESFARVLETGEKMIEDGHFAEEEITDKLELLLSERERLYASWDTRKEELSEAYYLHVFLKDAKQVDSFTSSQEAVLLCAELGNSVDEVEFLLKKHENTEKLVLSQEEKLSALQVL 1761          

HSP 3 Score: 195.282 bits (495), Expect = 1.669e-49
Identity = 177/783 (22.61%), Postives = 351/783 (44.83%), Query Frame = 1
Query: 1360 KFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDL------VHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKD 3690
            +F + A   ESW+ + +++  + S       +   L+KH+  E ++ A++  L  +T+   +L     +   ++ +    + DLW  L      + + L   +Q  T      E+QA I  +      ++YGK +  V  L++ H+ ++ DI     R+ +L+ +A  +V    + F  +  +   A + E+       F +L++   +R+  L+ S  + QF+ D  +E  WIK+   I  + D G +L  V  L++K +  E E++S  + ++  L  G+ LV      +  I AK+  +  LWE L  + ++R  KL   L  +QY     + + W+ E   L      G   +  E L+RK+      ++     I  +R+    L      +   + K  D +E++Y  L D+A     +LLD+  ++  L ++D + +W+ EK+  + +     D+E +E+L  +FEVF  +L    E++  +   ++ L+ + + + ++I    + +   W+ + +   ++ +EL        F     +   WI+EKI  +   +    DL  V   QR+    QRD+ A+  K+D ++   D++      SAK   H+ +L      V + W+ LQQL   + S L     +  F+    D  +W+     ++A + +  + ++ E LI +    + E+ +    +EE+       L S     + +R  N+   +   W  L      + ++L+   +   F  +A Q+E  LNA+E  L+ +
Sbjct: 2338 QFLRDAKELESWMNEKLQIAAEASY-REATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFV--AAEHFLKDEIADRAADVAER-------FEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGLESEINSHELLVQALLETGEQLVLRGHYAERDIGAKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDAGDTEFSKLEKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGERIAKLTEHAQMLLDDEHTDSEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGVAENGAPDLRHVQALQRKHQGFQRDLQALGEKVDLVLRDADDL------SAKVPAHKHELIMEKQEVQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFADVETLIAQNQELQTEIDSRANSVEEFQSRADQLLGSGNPSAEDIR--NKSSHVRDTWDRLGASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSE 3102          

HSP 4 Score: 187.963 bits (476), Expect = 2.739e-47
Identity = 217/985 (22.03%), Postives = 445/985 (45.18%), Query Frame = 1
Query: 1357 QKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAA-LKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDL---WKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEI-LRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLK-----SEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDK-------MLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNL 4260
            Q F + A     WI +  ++ + +S  +  P  L   LK+H+A E +I A   N  G+ +I+   ++ I          K+K+  L   W  L+    E+   L    +   L     +V+  +    A   +++ G+ L  V+ L + H+L+ESDI         ++  A++  +   Q    + NS     IK    +    +  LL   DKR+ +L+ +  + QFI D  +E  W++E +   ++ DLG  L SV RL ++H  FE EL++ +  ++  L  G+ L+D      + +  +  ++QNLW+ LVD    RK +L +     +Y+S+ ++A+ W+++   L   +  G   +  E L+ +++     V  +   I+++  +A+ L+  S  D + ++     +E+++  L  +      +L ++  ++    + + + ++++E+ +   +     D E L+V++ RF  F+  +   AE   +V+NL++ LV  G+ +   I   QD   + W  + D +  ++  L S      F  D  + I  I+EK   I ++++LG DL S    QR+    + ++  +E +I+ L  +   +   +  ++A+ +E     V   WE L++    +   L +  + ++    + D  +W  +    +AS +   + S+AE+++ + +    EM A E+     ++ G+  ++      E+  D+   L +  E +   W    +        L +     +F +DA+Q++   ++QE  L+                   L   V+E E  + K       +LS E+ L+ +   GK LI   +   D ++N+   + +R +K       R+ KL+    + +  QD+ + +  ++EK+Q   + S  +  + +S L + +A E E+ A+   I+ +  +G+Q  +       E+   ++ L   W EL +A   K + L
Sbjct:  960 QNFIRDADEFGGWIKEKSQIAEDESFKD--PKNLQGNLKRHKAFEAEITA---NKDGIDRINKAGKDLIRTKHFGAQKVKDKLKGLNEAWLNLVADTTEKGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDI---EMHATVIVDVADKAQELVSQ---GHFNSDT---IKSDSENLQSRYRSLLCLTDKRRSVLEDAFALHQFIYDIEVEMTWVREHLQQASSGDLGTSLISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSATDKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQSSHFDSEKISSTQRDLEEQFCGLNTLVKTRHTRLTESKKLHEYRREVEEISAYVSEQLQTAASEDYGTDFEHLQVIQGRFGDFQRSVASYAENFRNVDNLAKMLVSEGHTDTVAIKEQQDITRSMWLHLEDQIRLRQKRLTSAEEIHRFNRDLNELISRIQEKDAAI-NLEDLGRDLASTQVLQRKHEVFECELVTLEKQIEELTVESARLQATYQGQTARSVEQHEKYVLSLWEELKRKTSRKRRKLHDAYEFYKLGNTVRDLISWCIETSRLIASDDPVHTVSDAERMMRELDEHHAEMDAREESFARVLETGEKMIEDGHFAEEEITDKLELLLSERERLYASWDTRKE-------ELSEAYYLHVFLKDAKQVDSFTSSQEAVLL----------------CAELGNSVDEVEFLLKKHENTEKLVLSQEEKLSALQVLGKELIDNQHNQSDMIRNRLSGVCDRREKLKAELDKRREKLQNSHKIMQFYQDVVESESWIMEKLQTATDESFKDPINLESKLQKHQAFESELTAHERAIDSVRDKGEQLISCGHFAASEVEVRIEALYIQWEELLEASATKGRKL 1906          

HSP 5 Score: 131.724 bits (330), Expect = 3.032e-30
Identity = 137/659 (20.79%), Postives = 297/659 (45.07%), Query Frame = 1
Query: 1357 QKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFI-------AAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFL--CNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFI 3306
            Q+FN++  + +S ITD   ++     G +    +   +K +  + D+      +  +  +++ L  + +   + I   +N + + W +L     ERR+ L    +++       +V ++I    A Q     G+ L  VE L+R H+ +E ++  I  ++E+L  EA R V+      R+         ++ K+   I+ +  L D  D+RK IL+ + L+  F+VD      W+ +L   M++ +L  ++   + +L  H+  + +++++  S    +  G +LV+   V  + I         +N ++Q LW       +SRK+ L +  D   +++D + AE WI   + +       + +   E L++ +    + +  Y +NI  + + A+  L       + +  K   I  K++ L  +A     KL ++  +++ L D+  + SW+ EK +     ++  + ++++ ++ KH  + FE+E++    ++  +    ++L+ N     + + +   +L + W+ + D+ D+K   L        F  +  +   WI E    + S D  G+D+ SV    +R   +Q DI   E ++  L+ Q  E +        +I  +   V + +E L +   +R+  L +   +H+F+
Sbjct: 1913 QQFNQEVDIADSCITDKETIVLSSDYGRDFEHCVRLQRKMKEFDQDLAVDAARVEAINVLAEKLIGQGHAGSVRIQQRQNALTERWNRLQDKASERRQKLAEACEIHAFNRNCRDVSSMINEKAAVQTSGEVGRDLPAVEALIRKHDDVERELTVIEGKMEELEGEAYRLVRSQPHMARA---------VQAKQADIIEQWERLNDLFDQRKVILEANRLLQIFLVDYRDLMSWMNDLGTRMSSGELADNVRDAEAMLGLHEERKGQMNARMDSYNATVAFGMSLVEQGHVSADVIKQNVDDLVLENTELQQLW-------QSRKLMLQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTYEENIRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMNEKLQIAAEASYREATNLQQ-KLQKH--QTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASED-YGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFL 2551          

HSP 6 Score: 112.849 bits (281), Expect = 1.538e-24
Identity = 160/767 (20.86%), Postives = 328/767 (42.76%), Query Frame = 1
Query: 1249 LSTINSAWDELNTAEYGRETAL---RKEL-MRQEKLR--------NLAQKFNKKAAL-----RESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAM-IKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKS 3495
            +S IN   DEL    +    A+   RKE+  R EKL+        NLA+K   +  L       SWI +    L K+ LG ++ TV A L++H+ IE D+ A E+ +  L   + +L          I   + +V+ LW  L    ++R+  LD        + +  ++ +    +          + +    EL++ HE    +I++  +R ++L           D+  R+ + +  +A+ +K+   +   +   L  S  KR + L H  L  Q  VD   E +W                      LL+KH+ F   L+++   + +     KT++      ++++A++   + N  + + +    R+  LL       ++ D D+   WI E  ++ + +   D  +    L R      EI  N +D I++I    + L+       Q V  KL  + + + +L+    +   KL  A    +L    + VR W+ E +  L       D+  ++ L  + ++ ES++   A  +  V + ++ LV  G+ N   I ++ +NL + +  +  + D +R  L   +    F  D +  + W+RE ++   S D LG  L SV + Q+R    + ++   + +ID +++ G +++     +   +E + + +   W+ L  +   R   L +     +++ + ++  +W+       ASQ+  +  + AE L+ ++ + + ++AA    ++E  +  +  ++S
Sbjct:  616 VSDINQLADELIQDGHAHSAAVKAKRKEINERWEKLQRLKVKEEENLAEKHGVELFLDVCEEMRSWIQEKDAALCKEELGKDIETVRAQLRRHQGIERDLAAVEDKVAKLQDQAKSLVVRHPRQARQIKAKEGEVISLWAILKSKANKRKGLLDEAYGQQGFLADARDLMSWSAELKESFISAEDPQDIASASELIQQHEEKFDEIQTRFERFDQL-----------DEYGRNLLATSPQAVQVKQSMAALKAEKAALSSSWAKRNDRL-HQGLDLQSSVD---EVEW----------------------LLKKHEDFVKTLTAQEEKVRSLADMAKTIIHARHQARDWVASRAESVINRRDNVKNQASDRQKALLTSQVLQNFIRDADEFGGWIKEKSQIAEDESFKDPKNLQGNLKRHKAFEAEITAN-KDGIDRINKAGKDLIRTKHFGAQKVKDKLKGLNEAWLNLVADTTEKGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDIEMHATVIVDVADKAQELVSQGHFNSDTIKSDSENLQSRYRSLLCLTDKRRSVLEDAFALHQFIYDIEVEMTWVREHLQQASSGD-LGTSLISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSATDKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQS 1343          

HSP 7 Score: 108.997 bits (271), Expect = 2.162e-23
Identity = 207/1121 (18.47%), Postives = 479/1121 (42.73%), Query Frame = 1
Query: 1345 RNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIIS-------IINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKA--MIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKR-------GKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEK 4659
            R+++   N+KAA++ S             +G +LP V A ++KH+ +E ++   E  +       + LE E Y  + S       +   +  +++ W++L     +R+  L+    +   + ++ ++ + +  +  +        ++ + E +L  HE  +     +N R++      N  V F      S +  G+ +  +IK+  +  + +  EL      RK +L+ S  +  F+ DA   E WIK    +  + +    L +V+ LL+ H  FE  LS+   ++ +     K  + +     E I +K  +I + WEAL     SR  KL E    +Q++ D  + E W++E  ++       +  +  + L +K+Q     V  ++  ++ I    QSL+  S    +TV  +L  +   +  L D++    ++L +A+       +   +++WI E +  L +     D+  +  L  R +  + ++ +  ++V  +   +   V   +     I +   ++   + ++ +    +   L        F  D Q  ++WI++K  + +S D  G +L  V    +++  ++ +I + E  +  L+  G++++     + +DI  +  ++ + WE L+   + R+  L      H++  ++ +   W+ +  + ++S +    ++ AE L+ K+++ + E+ A E ++ +   I  +   S+    +F +L+   + + + +  L D++ ++ +RL    +   F  +A ++   +  +E  +  D             +L  +  ++ + E+F   ++S  + +A + +  + L+ + +   + ++ + + + ERW         R  +L     LH   + +D++   + EKI  L    +  N + D  L   +AL+ +   ++  ++ L ++           SA  P  K E+I     +   W +L +    K  +L      + F +  + +M W++    Q VA++    + + + ++  Q ++L +      N  +  ++  D  +LL   NP  A       + V+ T D L   L ++          ++F ++ D    W+N +
Sbjct: 2026 RDVSSMINEKAAVQTSG-----------EVGRDLPAVEALIRKHDDVERELTVIEGKM-------EELEGEAYRLVRSQPHMARAVQAKQADIIEQWERLNDLFDQRKVILEANRLLQIFLVDYRDLMSWMNDLGTRMSSGELADNVRDAEAMLGLHEERKG---QMNARMDSY----NATVAFG----MSLVEQGHVSADVIKQNVDDLVLENTELQQLWQSRKLMLQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTYEENIRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMNEKLQIAAEASYREATNLQQKL-QKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDKEPIAKSED-YGRNLLGVQSLMKKMEGLESEINSHELLVQALLETGEQLVLRGHYAERDIGAKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSEL--SDAGDTEFSKLEKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSD---------DCGRDLEHVEMLMQKFEVFTRDLVSSGERIAKLTEHAQMLLDDEHTDSEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALG---VAENGAPD--LRHVQALQRKHQGFQRDLQALGEKVDLVLRDADDLSAKVPAHKHELIMEKQEVQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQ-VAEETLGSTFADVETLIAQNQELQTEIDSRANSVEEFQSRAD--QLLGSGNP-SAEDIRNKSSHVRDTWDRLGASLRTRTQQLQHNKEIQRFKREADQLEAWLNAR 3095          

HSP 8 Score: 90.8929 bits (224), Expect = 7.616e-18
Identity = 97/485 (20.00%), Postives = 209/485 (43.09%), Query Frame = 1
Query: 1387 ESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGY-DLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLS 2838
            ++W+++ + L+     G +  +    L+KH+A++ ++ A E  +  L  I   L +    +   +   ++++ + +  L     +R   L +  +++  + E  E+ A +    A    D+ G+ L  VE L++  E+   D+ S  +R+ KL   A   +   D+   S +      +I E+ +   +     L+ LD+ +++      V +          WI+E +D +   + G  DL  V  L RKH+ F+ +L +    ++  L +   L    P  +  +  +  ++Q  W+ L     S++  LL+      ++ D  D   WI+        + LG   +  E LI +NQ+    +++  +++E+ +++A  LLG      + +  K   +   +  L        ++L     + R   ++D + +W+  ++  L +    D +E +E L  + + FE  L  + EK   + N S
Sbjct: 2664 DAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDAGDTEFSKLEKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGERIAKLTEHAQMLLD--DEHTDSEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEI-------HAWIQEKIDALGVAENGAPDLRHVQALQRKHQGFQRDLQALGEKVDLVLRDADDLSAKVPAHKHELIMEKQEVQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFADVETLIAQNQELQTEIDSRANSVEEFQSRADQLLGSGNPSAEDIRNKSSHVRDTWDRLGASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSEDVGDSLEAVEELLKKQDEFEKMLLTQGEKFNSLTNTS 3139          

HSP 9 Score: 83.1889 bits (204), Expect = 1.609e-15
Identity = 132/717 (18.41%), Postives = 298/717 (41.56%), Query Frame = 1
Query: 1387 ESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDN--------YLQVYTLINEFCEVQAIITGITAKQRI--DNYGKHLMEVEELLRSHELIESDIRSIN---QRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIA----------AKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLG--YSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEE 3462
             SW   N  L Q   L +++  V   LKKHE     + A EE +  L  ++            +II+ +++  D      +++  RR+++ N         L    L N   +       I  K +I  D   K    ++  L+ H+  E++I +      R+ K   +  R   F  Q  +  +   N+A +    ++T K     L   ++++++ +        + D  +   W+ E   ++   D G DL+ V  L +KH++ E ++           M    +VD++   QE ++          + + ++Q+ + +L+  T+ R+  L +    +Q++ D +    W+ E  +      LG  +   + L +++      + N++  I+ + +  Q L+   YS  D   V ++ + ++  + +L+D+A + +++L D+    + L++++   SW+ +K     +     D    E L  R +  + ++   +  +  +   +  LV + + + + I + Q +L   +  +  +V ++   L        +  + ++   ++ E+++   S D  G D E +   Q R    QR + +      ++      ++         I+ Q D+    W  L+  IR R   L +  +IHRF + L++  + + +    +  +++    +  + L  K+     E+  +E+Q+EE
Sbjct:  864 SSWAKRNDRLHQGLDLQSSVDEVEWLLKKHEDFVKTLTAQEEKVRSLADMAK-----------TIIHARHQARDWVASRAESVINRRDNVKNQASDRQKALLTSQVLQNFIRDADEFGGWIKEKSQIAEDESFKDPKNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKVKDKLKGLNEAWLNLVADTTEKG--NKLQQAERQRQLNR-------AMEDVRI---WMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDIE----------MHATVIVDVADKAQELVSQGHFNSDTIKSDSENLQSRYRSLLCLTDKRRSVLEDAFALHQFIYDIEVEMTWVREHLQQASSGDLGTSLISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSATD--KVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQSSHFDSEKISSTQRDLEEQFCGLNTLVKTRHTRLTESKKLHEYRREVEEISAYVSEQLQTAASED-YGTDFEHLQVIQGRFGDFQRSVASYAENFRNVDNLAKMLVSEGHTDTVAIKEQQDITRSMWLHLEDQIRLRQKRLTSAEEIHRFNRDLNELISRIQEKDAAINLEDLGRDLASTQVLQRKHEVFECELVTLEKQIEE 1544          

HSP 10 Score: 70.4774 bits (171), Expect = 1.007e-11
Identity = 179/906 (19.76%), Postives = 368/906 (40.62%), Query Frame = 1
Query: 1573 ISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISE-ANRYVQFCDQDFRSN--INSGN--KAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNM----EIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQI----------IVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEM----------AAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESI----NQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQV-LNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEII 4188
            I+I NT N+       L++T   RR  L   ++ Y   +E CE   +         + N  +    +E    S   +++ I+++ Q+LE+  +E A +  +  D +  ++  I  G+   A +K KR    + + +L     K +E L   H V  F+        WI+E    +   +LG D+ +V   LR+H+  E +L++    +     + K+LV   P     I AK  ++ +LW  L      RK  L E      +++D  D   W  E K  F              +  ++ Q++    E+++ + +  ++I               QT  ++ D++++  ++LL  A   Q   +           +    SW     +          ++E+E L  + E F   LT + EKV  + ++++ ++   +  HQ           ++N +DN+ N           ++  LL+     NF  D  +   WI+EK ++ E  DE  +D +++    +R    + +I A +  ID +   G +++R     A+ ++ +L  +++ W  L     ++ + L       +  + ++D   W+ + +  +  ++     +  + L  K+     ++          A   Q+L        D +KS+ +      LQ+R  S+    ++   +L D                 F  D   IE  +    ++L    Q+   +  TS   L+S+  +   +  F +++ + +  +  VL  G+ LI       D+++ +C+ L   W +    A  RK +L +  L  + L + ++ D  + +K  +  ++    +  S ++ L + KAL+ ++ A+   I+EL +  ++      HF  E I
Sbjct:  536 ITITNTYNR-------LIETSEMRRLSLQKAIKYYHFCHE-CEDMDLW--------MSNKERQFKSIE----SQNTLDA-IQTVRQKLERFATEIATKCSRVSDINQLADELIQDGHAHSAAVKAKRKEINERWEKLQRLKVKEEENLAEKHGVELFLDVCEEMRSWIQEKDAALCKEELGKDIETVRAQLRRHQGIERDLAAVEDKVAKLQDQAKSLVVRHPRQARQIKAKEGEVISLWAILKSKANKRKGLLDEAYGQQGFLADARDLMSWSAELKESF--------------ISAEDPQDIASASELIQQHEEKFDEI---------------QTRFERFDQLDEYGRNLL--ATSPQAVQVKQSMAALKAEKAALSSSWAKRNDRLHQGLDLQSSVDEVEWLLKKHEDFVKTLTAQEEKVRSLADMAKTII---HARHQARDWVASRAESVINRRDNVKNQ-------ASDRQKALLTSQVLQNFIRDADEFGGWIKEKSQIAE--DESFKDPKNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKVKDKLKGLNEAWLNLVADTTEKGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDIEMHATVIVDVADKAQELVSQGHFNSDTIKSDSEN-----LQSRYRSLLCLTDKRRSVLED-----------AFALHQFIYD---IEVEMTWVREHLQ---QASSGDLGTS---LISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSATDKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRL-VQSSHFDSEKI 1351          

HSP 11 Score: 67.781 bits (164), Expect = 6.538e-11
Identity = 153/805 (19.01%), Postives = 311/805 (38.63%), Query Frame = 1
Query: 4069 LAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTM---DGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKI-DLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----------PDEYKG-------IVKDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNT 6417
            L + + +E ++ A    + +L  + K      P   ++I      + S WA L     ++   L     ++ F    + +M W   ++   ++ ++P    S    I    +K D     ++ + +  + L ++   L   +P           QVK +M         L S  +  N ++     LQ   DE++W+ +K  D ++  + Q E                           KV SL   A+ +I   H  R  V      +   R+N+  +    Q  L     +Q F+ D  E   WI EK    +    + KD + ++  +++ +  E EI      I+   K+   L            D+ KG       +V D  +  N L+   AE++ +++  +         +++  W+ E   +   +D+G+DL     L  +  +  S+     +  V+ A+K   EL+   H  + +I    + +   +  LL L D R  +L+ A+ LH++  D +  +  ++E         DLG    SV  LQ++   FE +L    + I+  ++    L+   C      + ++ +EL + +  L  +   RK    +      +LS   E   W+ +       +   +D +  E LL  H++L++++ +            R L+++ H  S +I S  +++ ++   L          L+   +++++ R+     A+V  Q     +E+ G   +    +  +F  FQ++  +  E F  +  L  M +     +T
Sbjct:  705 LRRHQGIERDLAAVEDKVAKLQDQAKSLVVRHPRQARQIKAKEGEVISLWAILKSKANKRKGLLDEAYGQQGFLADARDLMSWSAELKESFISAEDPQDIASASELIQQHEEKFDE----IQTRFERFDQLDEYGRNLLATSPQA--------VQVKQSMAALKAEKAALSSSWAKRNDRLHQGLDLQSSVDEVEWLLKKHEDFVKTLTAQEE---------------------------KVRSLADMAKTIIHARHQARDWVASRAESVINRRDNVKNQASDRQKALLTSQVLQNFIRDADEFGGWIKEK--SQIAEDESFKDPKNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKVKDKLKGLNEAWLNLVADTTEKGNKLQ--QAERQRQLNRAM---------EDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDIEMHATVIVDVADK-AQELVSQGHFNSDTIKSDSENLQSRYRSLLCLTDKRRSVLEDAFALHQFIYDIEVEMTWVREHLQQAS-SGDLGTSLISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLID-SCYSATDKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQSSHFDSEKISSTQRDLEEQFCGLNTLVKTRHTRLTESKKLHEYRREVEEISAYVSEQLQTAASEDYGTDFEHLQVIQGRFGDFQRSVASYAENFRNVDNLAKMLVSEGHTDT 1454          

HSP 12 Score: 67.0106 bits (162), Expect = 1.226e-10
Identity = 58/292 (19.86%), Postives = 123/292 (42.12%), Query Frame = 1
Query: 2242 IAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEW---IREKIKLIESMDELGEDLESVMQRQRRINHMQ 3108
            +A +   I N +  L++++E R++ L + + YY +  +C+D + W+   +R F      + +   + + +K ++    +      +  I   A  L+         V  K   I ++++ L  +  K +E L +   V   L+  + +RSWI EK   LC      DIE +     R +  E +L    +KV  + + +++LVV      + I   +  + + W  +    + ++  L   Y    F  D +  + W   ++E     E   ++    E + Q + + + +Q
Sbjct:  531 VAVRQITITNTYNRLIETSEMRRLSLQKAIKYYHFCHECEDMDLWMSNKERQFKSIESQNTLDAIQTVRQKLERFATEIATKCSRVSDINQLADELIQDGHAHSAAVKAKRKEINERWEKLQRLKVKEEENLAEKHGVELFLDVCEEMRSWIQEKDAALCKEELGKDIETVRAQLRRHQGIERDLAAVEDKVAKLQDQAKSLVVRHPRQARQIKAKEGEVISLWAILKSKANKRKGLLDEAYGQQGFLADARDLMSWSAELKESFISAEDPQDIASASELIQQHEEKFDEIQ 822          
BLAST of Spectrin beta chain vs. Ensembl Medaka
Match: sptbn2 (spectrin beta chain, non-erythrocytic 1 [Source:NCBI gene;Acc:101155789])

HSP 1 Score: 1289.25 bits (3335), Expect = 0.000e+0
Identity = 802/2369 (33.85%), Postives = 1325/2369 (55.93%), Query Frame = 1
Query:  184 NVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKII----AEQFLQDCDDEIDWMNEKIDLIRN--RSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSID-SSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPS-NMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNP-STTQSHPNLSSS 7242
            N ++++FERSRIKALADERE VQKKTFTKW+NS L  VT +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  QKVHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR GL F A++HKHRPD+I+F +  R++   NL  AF++AE  LG+  LLDPEDVNV  PDE+S+ITYVA+YYHYF+ +KA +V  KR+ K+L+  +E +Q+I  Y++L S+LL+WI  TI  LN RQ +NS+  +Q Q+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA +F++KAA+RE+W+++N  L+ + + G +L  V AA +KHEAIETDI AY E ++ +  ++  LE E Y+D+  I+  ++ VL LW+ L + L  RRE L  +  +  L  E   +   +     + +  + GKHL +V +LL+ H L+E+DI +  +R++ + + A  +  + +Q ++         ++ EK     + + EL      R+E L+ S  +WQF+ D   E  WI+E   I+ + D G DL+S   LL KH+ F  E++++ + L N +  G+ L++    G   +  +  DI+  W  L ++T+ R+  L E +  +Q+ +D +D E WI E  R    + LG     T+ L RK ++  E ++++R  I  +  QAQ+ L  + V H  V  +L  IE+ Y++L  ++   ++ L  AL++Y++ +++D+   W+ EK+++L        +E+LEV++ RFE  E E+     +V HVN+++E L+ + N     I   +D LNN W +   +   K+  L S  +  N+ ++C +   W++EK K+IES   LG DL  VM  QR++  M+RD+ AI+ K+D L ++  ++   +   A++I+ +L  + + WE L   ++ R+ +L   + +  F++ L+DF +WL + QT +AS++IP S  EAE L+ ++ S ++E+   ++  E+   +G++  + + D  Q + L  R+++++  W  L  + E +   L +      F  DA+Q E  LN+QE  L         +     +NL +  E + ++E F+    + E+ +  V+  G+ LI ++N   D++Q K  ++ ER  KN   A+    KLK+   L   LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  +++++K G+   A+ P  K  +   L++L   W E+      K Q L   NR +LF +S  ++  WL NIE Q+ +DD        +TS+   LKK      ++E ++K +++L+  +  L Q++    +   +++ Q +   D  S  L+  L +  QK++    A QF +D +DEI W+ E++ L  +    K + T+  L++      ++++++ EI+    ++D +++  +     +  ++AL+ + + +L+   + L  E +     L      Q+F  D +E  +W+ E+EL +M     +KD+Q    +++K Q LE  +++Y   I +   S   +     P+  +  ++   V+  +  LK +  E++  +   +          ++E WI ER  +A S + G+D +  ++LRD+F  F+ +T+ IG  +V+  N   D+LI+  HP   S++ WKD +NE WADLLELIDTR Q+L ++++LHR++ D+  +L  ++EK+ ++    DLG+D  +V  L R+ +  E D+  L   +N     +  L   Y  +K   + +    +  A+ +L++  + R+L   +  +   FL+ VR+L+ W++ V +Q++    PRDVS  EL++ NH+ +K E+D++ ++F+  +++G  L+   H  + EI+ K  ++ ++RD + +KW + +++L +++EV Q+ RDA+ AE+W+  QE  +    LG  +DE  +LLK+   F+K     EE+F QL+RLTT+E +  +   + +          Q     V E+ Q   E               + H    R   S+D ++L+QD  +         +   S+     + S    V + KQ +R   S +++ P  +  +++  L AS           +   ++G L RK + E+ N+KA+ R+WH++Y  L +  + FFKD +         Y  EMP  L E V   A DY KR  VF++R  NG EYLFQ     +M  W+ +I        Q +P      S   + P +S S
Sbjct:   37 NSSARLFERSRIKALADEREAVQKKTFTKWVNSHLSRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGLAFNAIVHKHRPDVIEFDNLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIDKYETLASELLQWIEQTIGTLNDRQLANSLNAVQNQLQAFNSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYVPKEGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGTDLGAVEAATRKHEAIETDINAYLERVVAVEDVAKELEAEGYHDVRRILARRDNVLRLWEYLKELLAARRERLTAHRDLQRLFQEMRYITDWMKDEQGRLQSQDTGKHLHDVLDLLQKHNLVEADISAQAERIKGVQAAAKPFSSY-EQAYK----PCEPGLVGEKVERLGQAYEELGQLASARRERLEDSRRLWQFLWDLGEEAAWIREQEQILASGDCGRDLTSALHLLSKHEAFRDEMAARFMPLNNSIAAGEALINEGHFGASEVTERIQDIRAQWAHLEETTKLREQSLKEAVALHQFQTDANDMEAWIMETLRQLSSQELGHDEFSTQTLARKQREIDEEIQSHRPLINTLHEQAQA-LPQAYVSHPQVDGRLPAIEQSYKELESLSATRRQALDGALSLYQMFSEADACLLWVEEKEQWLDGMEIPTKLEDLEVVQQRFESLEPEMNNLGARVTHVNDVAEFLLDSDNCRKDQIHQTRDQLNNRWAEFEQLAGQKKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLKSEAGKLASEHPDQAEEIQGRLAEIQEVWEELNATMKRREESLGEASKLQGFLRDLNDFQSWLSRTQTAVASEDIPTSLPEAENLLTQHESIKNELDNYKEDYEKMRAVGEEVTQGQTDA-QHMFLAQRLQALDTGWHELRRMWENRHSLLAQGFDFQGFMRDAKQAEAFLNSQEYVL---------HHTEMPTNLQAAEEAIRKHEDFLTTTEASEEKINSVVDSGRRLINDSNANSDKIQEKVDSIQERHNKNKEMAKELLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQALVAEKPELKPVVQQILEDLQHQWEEVEGTTRTKAQCLFDANRAELFTQSCSALGSWLNNIESQLHSDDYG----KDLTSVNILLKKQQMLEHQMEVREKEVQSLQAQALALSQED----AGLTEIDGQQRQVTDNFS-NLQQPLRLRKQKLLASKEAHQFNRDLEDEILWVTERMPLATSTEHGKDLSTVQLLIK------KNQTLQKEIQGHQPRIDDILKRGETQSQVDGERQALLEERLAELRDLWDQLISETDNRNTRLLEARRAQQFYADAAEAEAWMGEQELHMMS-EEKAKDEQSALVMVKKHQILEQTLEDYAQTIHQLANSSRLMVTNEHPESERITLRQAQVDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREMVAGSHELGQDYEHVSMLRDKFREFARDTSTIGQERVDGVNALADDLIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLGASYELHRFHQDAMEVLGRVKEKREALPA--DLGRDLNTVKHLHRQHQTLENDIQALSWQVNQVQDDAARLQKAYAGEKADDIHRSEHAVSSAWEALQEACQSRRLLLQDTVEKFRFLNAVRDLMLWMDGVNLQIDAHDSPRDVSSAELVIGNHQDIKSEIDTRADSFTASIDMGNALINKSHYAADEIQEKLAQLQERRDEINKKWQDKMNYLQIVLEVLQFGRDASVAESWLAGQEPLVRAAELGTNVDEVESLLKRHEAFEKLATAWEERFVQLERLTTLEEQELQRRREEEERARRPPTPPQ-----VEEVTQSKAET--------------QAHDSEAR--TSLDQTTLNQDVSVNGVHSDNDTSQSLSLSLSVGKKSEPKRVFKPKQPERGSESESVNGPGRDSGLASSRLEASATLPGRGGADSDAECVEGMLCRKQEMESHNKKAATRSWHNVYCTLKKGGLHFFKDNKSVSSGIT--YHGEMPFSLEEAVCEVALDYKKRKHVFKLRNENGKEYLFQAKDEAEMNSWIQSIRRFITTRSQDSPGAPRALSRAMTMPPISPS 2348          
BLAST of Spectrin beta chain vs. Ensembl Medaka
Match: sptbn1 (spectrin beta chain, non-erythrocytic 1-like [Source:NCBI gene;Acc:101164035])

HSP 1 Score: 1284.24 bits (3322), Expect = 0.000e+0
Identity = 799/2373 (33.67%), Postives = 1319/2373 (55.58%), Query Frame = 1
Query:  211 SRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIR--NRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PD-EYKGIVKD-VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSI--DSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAI-NSASRPMRQVN---PSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRF 7284
             R K L DERE VQKKTFTKW+NS L  V+ +I DLY+DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   +SAKDALLLWCQMKTAGYP+VNI+NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+SVITYV +YYHYF+ +KA  V  KR+ K+L+  +E E +I+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +L  V AA KKHEAIETDI AYEE +  +  +S  LE E Y+DI  I   K+ VL LW+ LL+ L  RR+ L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI     R+  +   AN+Y    D  ++      +  +I+++       + EL     +R+  L+ S  +W+F  + + EE WI+E   I+++ + G DL+   RLL + +  E E+S +   L++ + EG+ +V +   G + I  +  D+Q  W  L       + +L E L  +Q+ +D DD + W  +  R+      G     T+ L+RK++     V +YR  I+ +  QA +L      + ++V  +L  IE++Y+++ ++    +E L DAL  +++ +++++ + WI EK+++L      + +E+LEV++HRF+  E E+  +A +V  VN +   L+  G+P+  I    QD LNN W    D++D K++ L S     N+ +DC +T  WI+EK K+IES  ELG DL  V+  QR++  M+RD+ AIE K+  L  +   +   +   AK I  +L  +   WE ++  ++ R+ +L     + +F++ LDDF +WL + QT +AS+++P + +EAEKL+ +++  ++E+   E+  ++   +G D +   Q   Q++ LQ R+++++  W  L+ + E ++  L +     +F  D +Q E  LN QE Y++   +            L      + + E F+  M ++E  +  V++ G+ L  + N+  ++++ K  ++D+R KKN  AA     +LK+   L + LQ+  +L   + EK+    +++    ++  S   + +A   E+ + +  + ++ K G    ++ P  +  + + L  L+S W EL    + K Q L   N+ +LF +S   + KWL  +EGQI ++D        +TS+   LKK      ++E +++ +  L+   + L Q+  D   + +     V+     L  PL  + ++        QF +D +DEI W  E++ +    +    ++T+  L++      ++++++ E++    ++D +++ +Q ++ +       +   + +L++  + L EE  +    L      Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q +E  +++Y   + +  K+   L     P+ E  G+ +  V+  +  LK +  E++ ++   +          ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N   DELI   H  A +++ WKD +NE WADLLELIDTR Q+L ++++LH++Y D + +L  I +K+  +    ++G+D  +V  LQR   +FE+D+  L + +      +  L   Y  DK   + +K  E+++A+R L +  + R+   L+  +   F SMVR+LL W+++V   +E +  PRDVS +ELL+ NH+ +K E+D++ ++FS C+ LG+ LL  KH  + EIK K  ++TDKR  +  KW +  + L L++EV+Q++RDA  AEAW++ QE YL++  +G ++DE   L+K+   F+K+    EE+F                            +  +         ++   E ++     P    P + HQ+ +++  S+   + L  D +   TG          ++    + S++ P P       P P+   K  H+ S        S  P  ++  P   V M+G L+RKH+WE  N+KASNR+WH++Y ++    M+FFKD +   +     Y ++ P+ L +     A DY K+  VF++R  +G EYLFQ     +M+ W+  I N+A+  +       P        Q+ P  + +L  ++   K  KRF
Sbjct:   14 GRFKQLQDEREAVQKKTFTKWVNSHLSRVSCRITDLYLDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKERRSAKDALLLWCQMKTAGYPNVNIQNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTRLLDPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETENLIEKYESLASALLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRMELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGLDLQAVEAATKKHEAIETDIAAYEERVQAVVAVSKELELECYHDIKRIAARKDNVLRLWEYLLELLKARRQRLEMNLGLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVSCNANKY-SVTDGGYKP----CDPRVIQDRVAHLEFCYQELTQLAAERRARLEDSRRLWKFFWEMAEEEGWIREKEQILSSLEQGRDLTGAVRLLSQQRALEDEMSGRAGHLQHTITEGRAMVQVGHNGSDKILERIGDLQAQWAELEQHAAVTRRRLEEALALHQFQADADDVDAWTLDALRIVSSGETGHNEFSTQALVRKHKDAAAEVASYRPVIDSLHEQAATL---PKEEAESVRGRLAGIEERYKEVAELTKLRKEALQDALARHKMFSEANACQVWIEEKEQWLNATEIPEKLEDLEVVQHRFDSLEPEMNNQASRVAVVNQIGRQLMHAGSPSDDIKAQ-QDKLNNRWGLFRDLLDLKKESLNSALGVQNYHLDCNETKSWIKEKTKVIESTQELGNDLMGVLALQRKLTGMERDLVAIEDKLGDLRGEAQRLAEEHPDQAKAITGRLAEITAVWEEMKNTLKRREESLGEARKLQQFLRDLDDFQSWLSRTQTAVASEDMPNTLAEAEKLMAQHDGIKNEILNYEEDYQKMRDMG-DMVTRGQTDAQYMFLQQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQE-YVLAHAEM--------PPTLEGAEAAIKKQEDFMTTMDANEDKINGVMEAGRRLASDGNINAEKIKEKVASIDDRHKKNREAAVELLMRLKDNRDLQKFLQECQELSLWISEKMLTAQDMTYDEARNLHSKWLKHQAFMAELQSNKEWLNKIEKDGTLLVSEKPETEVVVKEKLTALHSMWEELESTTQTKAQCLFDANKTELFTQSCTDLDKWLGGLEGQIQSEDYG----KDLTSVNILLKKQQMLENQVEVRQREVVELQSQVKALGQEAKD-TDEVDGRRQGVEKKFQELLEPLRHRRNLLVASREGHQFNRDVEDEILWAQERMPVATSTDHGHNLQTVQLLMK------KNQTLEKELQGHQPRIDDILERSQSLLRDQTSGTEGIHRRLAELQELWDRLREEGRRRHARLQEAHKAQQYYFDAAEAEAWMSEQELYMMSEE-KAKDEQSAITMLKKHQIMEQAVEDYAEVVHQLSKTSRGLVANEHPESERIGMRQSQVDKLYAGLKDLSEERRGKLEERLRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDGVNHLADELINAGHGDAATVAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDGKEILARIADKQKKLP--EEMGRDQNTVETLQRMHTSFERDVQALGAQVRQLQEDAVRLQSSYAGDKADDIQRKDGEVLEAWRILLEACDSRRSRLLDTGERFRFFSMVRDLLLWMDDVIRLIEAQENPRDVSSVELLMNNHQGIKAEIDARNDSFSTCVELGKALLARKHYAAAEIKEKLLQLTDKRKEMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSREVGQSVDEVEKLIKRHEAFEKSAATWEERF----------------------------SALERLTTLELLEVRRQQEEMERRRRPP---SPEQLHQEEVQQEKSVVMQNGLPSDEDSPWTGL-----EGGGLVNGLVERSSMEPSPA------PSPTMTKKNKHSQS--------STLPLKSQDSP---VQMEGLLHRKHEWEGHNKKASNRSWHNVYCVVCHQEMSFFKDSKAAAQGAA--YHNQPPVSLKDATCDVASDYKKKKYVFKLRVADGNEYLFQAKDEEEMSSWIQVILNAAASELTDTQSSFPGTPVSGRAQTLP-ATITLTTESSPGKKEKRF 2297          
BLAST of Spectrin beta chain vs. Ensembl Medaka
Match: SPTBN1 (spectrin beta chain, non-erythrocytic 1 [Source:NCBI gene;Acc:101159770])

HSP 1 Score: 1281.93 bits (3316), Expect = 0.000e+0
Identity = 761/2095 (36.32%), Postives = 1248/2095 (59.57%), Query Frame = 1
Query:  160 DEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIK-LIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLS--IANQKIIAEQFLQDCDDEIDWMNEKIDLI--RNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PD-EYKGIVKD-VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQ------NIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTM 6390
            D D+    N ++++FERSRIKALADERE VQKKTFTKW+NS L  V+ +I DLY+DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  Q+VHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR G+ F ALIHKHRPDLIDF    +++   NL  AF++AE  LG+  LLDPED++V  PDE+S+ITYV +YYHYF+ +KA  V  KR+ K+L+  +E E+MI+ Y+SL S LLEWI  TI +LN R+F+NS+ G+QQQ+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA++F++KAA+RE+W+++N  L+ + + G +L  V AA KKHEAIETDI AYEE +  +  ++  LE E Y+DI  I   K+ V  LW+ LL+ L  RR  L+  L +  +  E   +   +  +       +YGKHL+ VE+LL+ H L+E+DI     R+  + S A R+    +          +  +I+++       + EL+    +R+  L+ S  +W+F  + + EE WI+E   I+++ D G DL+   RLL +HK FE E+S +   L+  + +G+ LV  +  G + I  +  DIQ  W  L   T  RK +L E  +++Q+ +D DD + W+ +  R+     +G     T+ L++K++   E +++YR  IE + +Q+++L      + + V  +L  IE++Y+++ ++    ++ L DAL +Y++L+++ +   WI EK+++L +    + +E+LEV++HRFE  E E+  +A +V  VN ++  L+  G+P+ + I   QD LN  W++  D+VD K++ L+S     N+ ++C +T  WI+EK K LIES  ELG DL  VM  QR++  M+RD+ AIE K+  L  + + +   +   ++ I+ +L  +   W+ ++  +++R+ +L   + + +F++ LDDF +WL + QT +AS+++P + +EAEKL+ ++ + ++E+   E+  ++   +G+   + + D  Q + L+ R+++++  W  L+ + E ++  L +     +F  D +Q E  LN QE  L               + L +    + + E F+  M ++E+ ++ V+  G+ L+ + N+  +R+Q K  ++D+R KKN  AA +   +LK+   L + LQD  +L+  + EK+    +++    ++  S   + +A   E+ + +  +++++K G+    + P  +  + + L +L + W EL    + K + L   N+ +LF +S   + KWL  +EGQ+ +DD        +TS+   LKK      ++E ++K ++ LK  S+ L+Q+  D + + +     V+     L  PL+ +    +A+++I   QF +D +DEI W+ E++ L    +    ++T+  L++      ++++++ EI+    + D + + +Q ++ E      L+   + +L+   E + +E EK    LS     Q++  D +E  +W+SE+EL +M     +KD+Q    +++K Q LE  +++Y   + +   +   L     PD E  G+ +  V+  +  LK +  E++ ++       + + L+Q      ++E WI ER  +A S + G+D +  T+L++RF  F+ +T  IG  +V+  N+  DELI   H  A +I+ WKD +NE WADLLELIDTR Q+L ++++LH++Y D++ +L  I +K   +    +LG+D  +V  LQR    FE D+  L + +      +  L   Y  DK   + K+  E+++A+++L   +E R+   ++  D   F SMVR+L+ W+E+V   +E + KPRDVS +ELL+ NH+ +K E+D++ ++F+ C+ LG+ LL  KH  S EIK K  ++TDKR  +  KW +  + L L++EV+Q++RDA  AEAW++ QE YL++  +G ++DE   L+K+   F+K+    EE+F  L+RLTT+
Sbjct:   26 DADDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHLSRVSCRITDLYMDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALKVEGKRIGKVLDHAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVSVAKELEAESYHDIKRITARKDNVNRLWEYLLELLKARRHRLEQNLGLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRNVNSNAQRFASDTE-----GYKPCDPQIIRDRVAHLEFCYQELIQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSEDYGKDLTGALRLLSQHKAFEDEMSGRAAHLQQTIKQGEDLVADNHFGADKIRERIRDIQEQWATLERLTAVRKSRLQEACNHHQFQADADDIDTWMLDVLRIVSSVDVGHDEFSTQALVKKHKDVAEEIDSYRPVIEALHDQSRTLPPEK-ANSEEVKSRLAGIEERYKEVAELTRLRKQALQDALALYKMLSEASACELWIDEKEQWLNSMDIPEKLEDLEVVQHRFESLEPEMNSQASRVAVVNQVARQLIHCGHPSEKEIKAQQDKLNTRWSQFRDLVDQKKESLVSALGVQNYHLECNETKSWIKEKNKVLIESTQELGNDLAGVMALQRKLTGMERDLVAIEDKMGDLGKEAERLASEHPEQSEAIKGRLAEITGVWQEMKDGLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHENIKNEIRNYEEDYQKMRDMGEMVTQGQTDA-QHMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLA---------HTEMPTTLEAAEAAIKKQEDFMTTMDANEEKISNVVDTGRRLVADGNVSSERIQEKVDSIDQRHKKNRQAASDLLMRLKDNRDLQKFLQDCQELNLWINEKMLTAQDMTYDEARNLHSKWLKHQAFMAELQSNKEWLDKISKDGQTLMTEKPETEGVVKEKLASLKTMWEELESTTQTKAKCLFDANKAELFTQSCADLDKWLNGLEGQLQSDD----FGKDLTSVNILLKKQQMLESQVEVRQKEVDELKGQSQALRQEGKD-SDEVDGQRIIVEKKFQTLQEPLKKRRDKLMASREI--HQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLIK------KNQTLQKEIQGHQPRYDDIFERSQHVLREGSPTAELIRQRLAELQSLWEQIKKETEKRHTRLSEAHEAQQYYFDAAEAEAWMSEQELYMMSEE-KAKDEQSAVAMLKKHQILEQAVEDYADTVHQLSSTSRGLVAAGHPDSERIGMRQSQVDKLYAGLKDLSEERRGKLD------ERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDGVNRLADELINSGHGDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEVLNRILDKHKKLP--EELGRDQNTVEALQRMHTAFEHDIQALGTQVRQLQDDAVRLQSAYAGDKADDIQKREGEVLEAWKNLLAAVEGRRAKLVDTGDKFRFFSMVRDLMLWMEDVIRLIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKALLARKHYASEEIKEKLLQLTDKRKEMIDKWEDRWEWLRLVLEVHQFSRDAGVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWEERFSALERLTTV 2082          
BLAST of Spectrin beta chain vs. Ensembl Medaka
Match: sptbn2 (spectrin beta chain, non-erythrocytic 1 [Source:NCBI gene;Acc:101155789])

HSP 1 Score: 1280.77 bits (3313), Expect = 0.000e+0
Identity = 794/2330 (34.08%), Postives = 1311/2330 (56.27%), Query Frame = 1
Query:  184 NVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKII----AEQFLQDCDDEIDWMNEKIDLIRN--RSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSID-SSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPS-NMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVV 7128
            N ++++FERSRIKALADERE VQKKTFTKW+NS L  VT +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  QKVHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR GL F A++HKHRPD+I+F +  R++   NL  AF++AE  LG+  LLDPEDVNV  PDE+S+ITYVA+YYHYF+ +KA +V  KR+ K+L+  +E +Q+I  Y++L S+LL+WI  TI  LN RQ +NS+  +Q Q+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA +F++KAA+RE+W+++N  L+ + + G +L  V AA +KHEAIETDI AY E ++ +  ++  LE E Y+D+  I+  ++ VL LW+ L + L  RRE L  +  +  L  E   +   +     + +  + GKHL +V +LL+ H L+E+DI +  +R++ + + A  +  + +Q ++         ++ EK     + + EL      R+E L+ S  +WQF+ D   E  WI+E   I+ + D G DL+S   LL KH+ F  E++++ + L N +  G+ L++    G   +  +  DI+  W  L ++T+ R+  L E +  +Q+ +D +D E WI E  R    + LG     T+ L RK ++  E ++++R  I  +  QAQ+ L  + V H  V  +L  IE+ Y++L  ++   ++ L  AL++Y++ +++D+   W+ EK+++L        +E+LEV++ RFE  E E+     +V HVN+++E L+ + N     I   +D LNN W +   +   K+  L S  +  N+ ++C +   W++EK K+IES   LG DL  VM  QR++  M+RD+ AI+ K+D L ++  ++   +   A++I+ +L  + + WE L   ++ R+ +L   + +  F++ L+DF +WL + QT +AS++IP S  EAE L+ ++ S ++E+   ++  E+   +G++  + + D  Q + L  R+++++  W  L  + E +   L +      F  DA+Q E  LN+QE  L         +     +NL +  E + ++E F+    + E+ +  V+  G+ LI ++N   D++Q K  ++ ER  KN   A+    KLK+   L   LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  +++++K G+   A+ P  K  +   L++L   W E+      K Q L   NR +LF +S  ++  WL NIE Q+ +DD        +TS+   LKK      ++E ++K +++L+  +  L Q++    +   +++ Q +   D  S  L+  L +  QK++    A QF +D +DEI W+ E++ L  +    K + T+  L++      ++++++ EI+    ++D +++  +     +  ++AL+ + + +L+   + L  E +     L      Q+F  D +E  +W+ E+EL +M     +KD+Q    +++K Q LE  +++Y   I +   S   +     P+  +  ++   V+  +  LK +  E++  +   +          ++E WI ER  +A S + G+D +  ++LRD+F  F+ +T+ IG  +V+  N   D+LI+  HP   S++ WKD +NE WADLLELIDTR Q+L ++++LHR++ D+  +L  ++EK+ ++    DLG+D  +V  L R+ +  E D+  L   +N     +  L   Y  +K   + +    +  A+ +L++  + R+L   +  +   FL+ VR+L+ W++ V +Q++    PRDVS  EL++ NH+ +K E+D++ ++F+  +++G  L+   H  + EI+ K  ++ ++RD + +KW + +++L +++EV Q+ RDA+ AE+W+  QE  +    LG  +DE  +LLK+   F+K     EE+F QL+RLTT+E +  +   + +          Q     V E+ Q   E               + H    R   S+D ++L+QD  +         +   S+     + S    V + KQ +R   S +++ P  +  +++  L AS           +   ++G L RK + E+ N+KA+ R+WH++Y  L +  + FFKD +         Y  EMP  L E V   A DY KR  VF++R  NG EYLFQ    V
Sbjct:   37 NSSARLFERSRIKALADEREAVQKKTFTKWVNSHLSRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGLAFNAIVHKHRPDVIEFDNLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIDKYETLASELLQWIEQTIGTLNDRQLANSLNAVQNQLQAFNSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYVPKEGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGTDLGAVEAATRKHEAIETDINAYLERVVAVEDVAKELEAEGYHDVRRILARRDNVLRLWEYLKELLAARRERLTAHRDLQRLFQEMRYITDWMKDEQGRLQSQDTGKHLHDVLDLLQKHNLVEADISAQAERIKGVQAAAKPFSSY-EQAYK----PCEPGLVGEKVERLGQAYEELGQLASARRERLEDSRRLWQFLWDLGEEAAWIREQEQILASGDCGRDLTSALHLLSKHEAFRDEMAARFMPLNNSIAAGEALINEGHFGASEVTERIQDIRAQWAHLEETTKLREQSLKEAVALHQFQTDANDMEAWIMETLRQLSSQELGHDEFSTQTLARKQREIDEEIQSHRPLINTLHEQAQA-LPQAYVSHPQVDGRLPAIEQSYKELESLSATRRQALDGALSLYQMFSEADACLLWVEEKEQWLDGMEIPTKLEDLEVVQQRFESLEPEMNNLGARVTHVNDVAEFLLDSDNCRKDQIHQTRDQLNNRWAEFEQLAGQKKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLKSEAGKLASEHPDQAEEIQGRLAEIQEVWEELNATMKRREESLGEASKLQGFLRDLNDFQSWLSRTQTAVASEDIPTSLPEAENLLTQHESIKNELDNYKEDYEKMRAVGEEVTQGQTDA-QHMFLAQRLQALDTGWHELRRMWENRHSLLAQGFDFQGFMRDAKQAEAFLNSQEYVL---------HHTEMPTNLQAAEEAIRKHEDFLTTTEASEEKINSVVDSGRRLINDSNANSDKIQEKVDSIQERHNKNKEMAKELLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQALVAEKPELKPVVQQILEDLQHQWEEVEGTTRTKAQCLFDANRAELFTQSCSALGSWLNNIESQLHSDDYG----KDLTSVNILLKKQQMLEHQMEVREKEVQSLQAQALALSQED----AGLTEIDGQQRQVTDNFS-NLQQPLRLRKQKLLASKEAHQFNRDLEDEILWVTERMPLATSTEHGKDLSTVQLLIK------KNQTLQKEIQGHQPRIDDILKRGETQSQVDGERQALLEERLAELRDLWDQLISETDNRNTRLLEARRAQQFYADAAEAEAWMGEQELHMMS-EEKAKDEQSALVMVKKHQILEQTLEDYAQTIHQLANSSRLMVTNEHPESERITLRQAQVDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREMVAGSHELGQDYEHVSMLRDKFREFARDTSTIGQERVDGVNALADDLIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLGASYELHRFHQDAMEVLGRVKEKREALPA--DLGRDLNTVKHLHRQHQTLENDIQALSWQVNQVQDDAARLQKAYAGEKADDIHRSEHAVSSAWEALQEACQSRRLLLQDTVEKFRFLNAVRDLMLWMDGVNLQIDAHDSPRDVSSAELVIGNHQDIKSEIDTRADSFTASIDMGNALINKSHYAADEIQEKLAQLQERRDEINKKWQDKMNYLQIVLEVLQFGRDASVAESWLAGQEPLVRAAELGTNVDEVESLLKRHEAFEKLATAWEERFVQLERLTTLEEQELQRRREEEERARRPPTPPQ-----VEEVTQSKAET--------------QAHDSEAR--TSLDQTTLNQDVSVNGVHSDNDTSQSLSLSLSVGKKSEPKRVFKPKQPERGSESESVNGPGRDSGLASSRLEASATLPGRGGADSDAECVEGMLCRKQEMESHNKKAATRSWHNVYCTLKKGGLHFFKDNKSVSSGIT--YHGEMPFSLEEAVCEVALDYKKRKHVFKLRNENGKEYLFQAKDEV 2309          
BLAST of Spectrin beta chain vs. Ensembl Medaka
Match: sptbn2 (spectrin beta chain, non-erythrocytic 1 [Source:NCBI gene;Acc:101155789])

HSP 1 Score: 1273.07 bits (3293), Expect = 0.000e+0
Identity = 798/2375 (33.60%), Postives = 1321/2375 (55.62%), Query Frame = 1
Query:  166 DEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKII----AEQFLQDCDDEIDWMNEKIDLIRN--RSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PDEYKGIVK--DVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSID-SSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPS-NMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNP-STTQSHPNLSSS 7242
            ++VQY+N+        R K L DERE VQKKTFTKW+NS L  VT +I DLY DLRDG+ L+ LLE+LS E +PKPT+GRMRIHCLENVDK L FL  QKVHLEN+G+HDIVDGN RLTLGLIWTIILRFQ+QDI  + + +   KSAKDALLLWCQMKTAGYP+VNI NFT SWR GL F A++HKHRPD+I+F +  R++   NL  AF++AE  LG+  LLDPEDVNV  PDE+S+ITYVA+YYHYF+ +KA +V  KR+ K+L+  +E +Q+I  Y++L S+LL+WI  TI  LN RQ +NS+  +Q Q+  FN YRT EKP KF EK +LEVLLFTI+S    +  KVY P E   +S IN AW+ L  AE+ RE ALR EL+RQEKL  LA +F++KAA+RE+W+++N  L+ + + G +L  V AA +KHEAIETDI AY E ++ +  ++  LE E Y+D+  I+  ++ VL LW+ L + L  RRE L  +  +  L  E   +   +     + +  + GKHL +V +LL+ H L+E+DI +  +R++ + + A  +  + +Q ++         ++ EK     + + EL      R+E L+ S  +WQF+ D   E  WI+E   I+ + D G DL+S   LL KH+ F  E++++ + L N +  G+ L++    G   +  +  DI+  W  L ++T+ R+  L E +  +Q+ +D +D E WI E  R    + LG     T+ L RK ++  E ++++R  I  +  QAQ+ L  + V H  V  +L  IE+ Y++L  ++   ++ L  AL++Y++ +++D+   W+ EK+++L        +E+LEV++ RFE  E E+     +V HVN+++E L+ + N     I   +D LNN W +   +   K+  L S  +  N+ ++C +   W++EK K+IES   LG DL  VM  QR++  M+RD+ AI+ K+D L ++  ++   +   A++I+ +L  + + WE L   ++ R+ +L   + +  F++ L+DF +WL + QT +AS++IP S  EAE L+ ++ S ++E+   ++  E+   +G++  + + D  Q + L  R+++++  W  L  + E +   L +      F  DA+Q E  LN+QE  L         +     +NL +  E + ++E F+    + E+ +  V+  G+ LI ++N   D++Q K  ++ ER  KN   A+    KLK+   L   LQD  +L   + EK+    ++S    ++  S   + +A   E+ + +  +++++K G+   A+ P  K  +   L++L   W E+      K Q L   NR +LF +S  ++  WL NIE Q+ +DD        +TS+   LKK      ++E ++K +++L+  +  L Q++    +   +++ Q +   D  S  L+  L +  QK++    A QF +D +DEI W+ E++ L  +    K + T+  L++      ++++++ EI+    ++D +++  +     +  ++AL+ + + +L+   + L  E +     L      Q+F  D +E  +W+ E+EL +M     +KD+Q    +++K Q LE  +++Y   I +   S   +     P+  +  ++   V+  +  LK +  E++  +   +          ++E WI ER  +A S + G+D +  ++LRD+F  F+ +T+ IG  +V+  N   D+LI+  HP   S++ WKD +NE WADLLELIDTR Q+L ++++LHR++ D+  +L  ++EK+ ++    DLG+D  +V  L R+ +  E D+  L   +N     +  L   Y  +K   + +    +  A+ +L++  + R+L   +  +   FL+ VR+L+ W++ V +Q++    PRDVS  EL++ NH+ +K E+D++ ++F+  +++G  L+   H  + EI+ K  ++ ++RD + +KW + +++L +++EV Q+ RDA+ AE+W+  QE  +    LG  +DE  +LLK+   F+K     EE+F QL+RLTT+E +  +   + +          Q     V E+ Q   E               + H    R   S+D ++L+QD  +         +   S+     + S    V + KQ +R   S +++ P  +  +++  L AS           +   ++G L RK + E+ N+KA+ R+WH++Y  L +  + FFKD +         Y  EMP  L E V   A DY KR  VF++R  NG EYLFQ     +M  W+ +I        Q +P      S   + P +S S
Sbjct:   17 NQVQYSNILE-----GRFKQLQDEREAVQKKTFTKWVNSHLSRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGLAFNAIVHKHRPDVIEFDNLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIDKYETLASELLQWIEQTIGTLNDRQLANSLNAVQNQLQAFNSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYVPKEGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGTDLGAVEAATRKHEAIETDINAYLERVVAVEDVAKELEAEGYHDVRRILARRDNVLRLWEYLKELLAARRERLTAHRDLQRLFQEMRYITDWMKDEQGRLQSQDTGKHLHDVLDLLQKHNLVEADISAQAERIKGVQAAAKPFSSY-EQAYK----PCEPGLVGEKVERLGQAYEELGQLASARRERLEDSRRLWQFLWDLGEEAAWIREQEQILASGDCGRDLTSALHLLSKHEAFRDEMAARFMPLNNSIAAGEALINEGHFGASEVTERIQDIRAQWAHLEETTKLREQSLKEAVALHQFQTDANDMEAWIMETLRQLSSQELGHDEFSTQTLARKQREIDEEIQSHRPLINTLHEQAQA-LPQAYVSHPQVDGRLPAIEQSYKELESLSATRRQALDGALSLYQMFSEADACLLWVEEKEQWLDGMEIPTKLEDLEVVQQRFESLEPEMNNLGARVTHVNDVAEFLLDSDNCRKDQIHQTRDQLNNRWAEFEQLAGQKKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLKSEAGKLASEHPDQAEEIQGRLAEIQEVWEELNATMKRREESLGEASKLQGFLRDLNDFQSWLSRTQTAVASEDIPTSLPEAENLLTQHESIKNELDNYKEDYEKMRAVGEEVTQGQTDA-QHMFLAQRLQALDTGWHELRRMWENRHSLLAQGFDFQGFMRDAKQAEAFLNSQEYVL---------HHTEMPTNLQAAEEAIRKHEDFLTTTEASEEKINSVVDSGRRLINDSNANSDKIQEKVDSIQERHNKNKEMAKELLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQALVAEKPELKPVVQQILEDLQHQWEEVEGTTRTKAQCLFDANRAELFTQSCSALGSWLNNIESQLHSDDYG----KDLTSVNILLKKQQMLEHQMEVREKEVQSLQAQALALSQED----AGLTEIDGQQRQVTDNFS-NLQQPLRLRKQKLLASKEAHQFNRDLEDEILWVTERMPLATSTEHGKDLSTVQLLIK------KNQTLQKEIQGHQPRIDDILKRGETQSQVDGERQALLEERLAELRDLWDQLISETDNRNTRLLEARRAQQFYADAAEAEAWMGEQELHMMS-EEKAKDEQSALVMVKKHQILEQTLEDYAQTIHQLANSSRLMVTNEHPESERITLRQAQVDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREMVAGSHELGQDYEHVSMLRDKFREFARDTSTIGQERVDGVNALADDLIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLGASYELHRFHQDAMEVLGRVKEKREALPA--DLGRDLNTVKHLHRQHQTLENDIQALSWQVNQVQDDAARLQKAYAGEKADDIHRSEHAVSSAWEALQEACQSRRLLLQDTVEKFRFLNAVRDLMLWMDGVNLQIDAHDSPRDVSSAELVIGNHQDIKSEIDTRADSFTASIDMGNALINKSHYAADEIQEKLAQLQERRDEINKKWQDKMNYLQIVLEVLQFGRDASVAESWLAGQEPLVRAAELGTNVDEVESLLKRHEAFEKLATAWEERFVQLERLTTLEEQELQRRREEEERARRPPTPPQ-----VEEVTQSKAET--------------QAHDSEAR--TSLDQTTLNQDVSVNGVHSDNDTSQSLSLSLSVGKKSEPKRVFKPKQPERGSESESVNGPGRDSGLASSRLEASATLPGRGGADSDAECVEGMLCRKQEMESHNKKAATRSWHNVYCTLKKGGLHFFKDNKSVSSGIT--YHGEMPFSLEEAVCEVALDYKKRKHVFKLRNENGKEYLFQAKDEAEMNSWIQSIRRFITTRSQDSPGAPRALSRAMTMPPISPS 2329          
BLAST of Spectrin beta chain vs. Planmine SMEST
Match: SMESG000039799.1 (SMESG000039799.1)

HSP 1 Score: 4797.26 bits (12442), Expect = 0.000e+0
Identity = 2401/2408 (99.71%), Postives = 2404/2408 (99.83%), Query Frame = 1
Query:   85 MEICVPYLNGNYCDSLSSDYQNALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLPDEYKGIVKDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRFFSSIRLKK 7308
            MEICVPYLNGNYCDSLSSDYQNALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFLL LLELLSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFN YRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDLSEEKEKRLEKYLKSLMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVLLHELLQDIDDLDDSLLEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMELENKKKLLENLKDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDT+NQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGL+INSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLP+EYKGIVKDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRF IFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSV LLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRFFSSIRLKK
Sbjct:    1 MEICVPYLNGNYCDSLSSDYQNALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFLLALLELLSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNLYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDLSEEKEKRLEKYLKSLMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVLLHELLQDIDDLDDSLLEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMELENKKKLLENLKDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTINQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLIINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLPEEYKGIVKDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFAIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVCLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRFFSSIRLKK 2408          
BLAST of Spectrin beta chain vs. Planmine SMEST
Match: SMESG000035098.1 (SMESG000035098.1)

HSP 1 Score: 1631.69 bits (4224), Expect = 0.000e+0
Identity = 949/2395 (39.62%), Postives = 1457/2395 (60.84%), Query Frame = 1
Query:  154 LSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNST--IKD-FHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEM-EKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKI-------EEFKKSCVSLPDEYKGIVKDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRFFSSIRLK 7305
             SDEDE +  +  SK++ERSRIKALA+ERE VQKKTFTKW+NS L  V   ++DLY+DLRDGK L+ LLE+L+ E +PKPTRG+MRIHCL NVDK + FL +Q VHLENVGAHDIVDG+PRLTLGL+WTIILRFQ+QDI  DE  +  A+SAKDALLLWCQMKTAGY +VNIRNFT SWR GL F A+IHKH P+LI++    +   + NL  AF+IAE+ L IP LLD ED+NV  PDE+S++TYV + YHYFN +K  +V  KR+ K+LNQ +E E  I  Y +L S LLEWI +TI+LL+ R F+NS+ G+QQQ+  FN YR  EKP KF +K +LE+LLFTI S    +  K Y P E   +S IN AW++L  AE+ RE  LR+EL+RQEKL  L  +F++K  +RE+W+++N  L+ + + GN+L  V AA KKHEAIETDI+AYEE +  +  +++ L EE Y+DI  I   K+ V+ +W+ LL+ L  RR  L+   Q+  +  E   +   I  I  + + ++ GKHL+ V++LL+ H L+E+DIR +  R  +++ +A  ++   D DF  N+     A   E  N    +KD +  LL+    R   L+ S  +WQF  +   +++WIKE   +M++PDLG+DLSSV+RLLRKHK  E E+  ++ +LE  L +G+ L++    G++ I  K   ++ +W  LVD T  R+ +L E L++YQ ++DCDDA+ W+ +  R+   + +G K++ TE LI+ NQ  M+ +  +R +++Q+R Q  ++  Y   D   +  +LD ++ +Y  L++++   Q+KLLDA+++Y+L + +DSV++WI EK+K L   +PSD++EELEV++HRF+ FESE+   AEKV  VN LS++LV + +PN + I+  QD+LN +WN +AD+V+ K+ ++ + Y Y+ F ++ Q+T  WI EK KLI+S DELG DLE +MQ QRR+  +QRD+ AIEAK+DHL  + D+I          +E +   +++ W  L+ ++++RD  L + +++ RF+Q LD F  WL + QT +AS++IP +  EAEKL++++N  + E+A    + E  +  G+   +  QD  Q++ L  R+  I + W+ L  + +++E  L + L++  FF+DA+QI+ +L+  E  ++K      ++  TS   + ++ E + +++   +  +++E  +  +L+ G+ L+++NN   D++Q KC  + ER       +  R   L  Q+ L E  Q+IDD+++ + EK+ + ++ S  + ++  +   + KA E+EI A +  IE++ K G++     P F +     +D L   W EL+   ++K + +A  NRE +F E+ +SM +W+ +I  QI+  +E   +  G+  I  Q+K  +  + ELENK+K+L +++ H+  LK+Q PD+  + EQ++ +V+V +  +  PL  +     ++    QFL+D +DE  W+ EKI+L++N  K  ++   LL  QQ   R K++ NE+ N   ++ ++ ++ + MI E H +       + +L +  + L  ++ E+F  +L + L  Q++L D SE  +W+ E+EL LM     +KD+Q    +++K Q++E  I+NY  +I       +E   SC    D        V+  +  L+ +C+E++  +   V      +   ++E WI ER  +A S + G D + C LLRDRF  F+ ETN IG  ++  AN+  D LI   H  +  I+ WKDRINE WADLLELI+TRIQLLK+AWDLH++  D Q LL+ I EKK  + + +++G+D KSV+  QRK + FE+++ +L   I +A+  +N LLPLY   KE  +  +R EL+ A+R L+   E RK++ L+ AD H FLSMVREL++W+ E+  QM+ + KP+DV+G++LL+ NHRSLK E+D++EENFSICL+LGRTLL  +H R  +I+ KC E+   R  L  +W    D+L L++EVYQ+ARDAA AE+W+++Q +YL+ ++LG  LDETLALLKK I F++A M QEE+FE LK+LTT+E+R+K  +                                           P  Q Q++I R   I   + +         FQ          P P+     P+   + +     S        LS   D  SA   P T++   P     +G L RKH+WE+  +KAS R+WH LYV+L+   ++ +KD++H KEKP + Y HE PL L      PA DY KR  VFR++  NG EYLFQ  S  +M  W+  +N+++        + ++    Q H    S      + H G K+FF+  R K
Sbjct:   23 FSDEDEFEGGDSVSKLYERSRIKALAEEREIVQKKTFTKWMNSHLAKVGEFVDDLYLDLRDGKKLIKLLEILACEKLPKPTRGKMRIHCLVNVDKAINFLLDQHVHLENVGAHDIVDGSPRLTLGLVWTIILRFQMQDIVLDEYDATDARSAKDALLLWCQMKTAGYNNVNIRNFTTSWRDGLAFNAIIHKHCPELIEYMKLAKAAPLQNLRNAFNIAEDELMIPKLLDAEDINVEQPDEKSIMTYVVTLYHYFNRMKTENVQCKRIGKVLNQAIESEDRITEYDNLASDLLEWINHTIQLLDERLFANSLSGVQQQLAAFNTYRISEKPPKFNDKGNLEMLLFTIHSEMRANNQKPYIPEEGKMISDINRAWEKLEKAEHERELCLREELIRQEKLDQLGSRFDRKTTMREAWLSENQRLVTQDNFGNDLAAVEAATKKHEAIETDIFAYEERVNAVMTVAEELAEENYHDIERINLRKDNVIKMWQDLLELLKMRRNRLELSKQMQNVFQEIIYLLDWIDEIGNRLKSEDCGKHLLGVDDLLQKHGLLEADIRVLEIRKNQVLEQAEVFI---DCDFDENLQGYRPAEPSEVENRCQQLKDSYQALLELASYRHNALQESKKMWQFFWEMEDDKEWIKEKSQLMSSPDLGHDLSSVERLLRKHKALEEEVRIRQQALETGLQKGEELIENDNWGKDRIKDKIQKMKTIWAQLVDLTAERRQRLEESLEFYQLLTDCDDADAWMIDQLRIVKNEDVGTKLALTEALIKNNQDLMDELATFRQSLDQLRTQGTTISEYPETDASKIFNRLDTLDNRYDQLIELSKLRQQKLLDAMSMYKLFDVADSVKTWIIEKEKLLITLVPSDELEELEVIRHRFDCFESEMRANAEKVSKVNELSKDLVSDEHPNTENIIQKQDDLNINWNDLADMVEKKKQDIETSYKYNQFLIEAQETANWIIEKEKLIQSTDELGNDLEGIMQLQRRLGGLQRDLKAIEAKVDHLDKEADDIEEKKPEVGNIVEPERAKINELWTELKSMLKERDDKLNDSSELQRFLQDLDHFQMWLRRSQTAVASEDIPNNLQEAEKLLDQHNQLKQEIAVYHPEFERLIHFGRKVTEG-QDDAQYMFLNQRLSGIEESWEGLEKMCDDREAVLNQSLQAQTFFKDAQQIDIVLSKLENAVLK------SDLPTS---VEAVEEAIKQHDNINNNAIANEVKIDSLLESGRNLVVDNNFNADKIQRKCDEIAERRSAIRRKSSERSELLAAQLELQEFYQEIDDVEEWIGEKMIIASDDSYRDLQNVSARYGRFKAFEEEIGANKDKIEKVIKAGQELMQQRPQFAEITQIKIDELAQQWNELNNTAQDKSKKIADANRETIFNETAKSMNEWITDISSQIITTEEDSETEIGLVEINEQMKDQEKKDKELENKRKMLADMETHAVKLKEQYPDREEEIEQMQQEVRVKLTQVEAPLAGRRENLLKRKRVRQFLRDIEDEKQWIEEKINLVQNNGKIGDS---LLAVQQFIRRLKTLNNEVDNHHPRIQAVCEDGEIMISEGHPQSEKFKIAMKELWELWDQLQMKLLERFA-VLEDNLVAQQYLFDASEAEAWMGEQELYLMSPE-KAKDEQGANNLMKKHQHIEKMIENYADEIRNLGERSQEMMHSCHPQSDLVAQKQSKVDKMYAGLRDLCSERQFRLEENVKLFHLLKEIVDLETWIAERIVLASSHEMGSDYEHCCLLRDRFAEFAKETNAIGGGRICAANELCDSLINQGHAESAEIAQWKDRINESWADLLELIETRIQLLKAAWDLHKFLSDCQDLLDRITEKK--LVIPDEVGRDAKSVATYQRKHQAFEQEVHRLGQQIESAVETANHLLPLYAGQKERMICDRRDELLHAWRELQMASEFRKVHLLDAADLHRFLSMVRELINWMFEIRQQMDSKDKPKDVAGVDLLVNNHRSLKAEIDAREENFSICLSLGRTLLNRRHPRENDIREKCIEVVTLRVNLIDQWAERYDYLHLILEVYQFARDAAVAESWLMAQCTYLSCQDLGENLDETLALLKKHIAFERAVMTQEERFEALKKLTTLELRAKDSS-------------------------------------------PESQRQKDIERQKKIAEMIKE---------FQPP--------PTPKLQKSEPILDSETAIESVSSQQVASSRKLSTEHDRDSAD-HPTTSKH--PGSESHEGTLSRKHEWESTGKKASGRSWHELYVVLNDGVLSAYKDQKHGKEKPSELYHHESPLQLSGARIGPATDYTKRVNVFRLKLVNGGEYLFQAKSESEMNEWITKLNNSASGADSDTATRSSTLPLQQHGTSES-----GEGHHGKKKFFTLGRKK 2329          
BLAST of Spectrin beta chain vs. Planmine SMEST
Match: SMESG000066485.1 (SMESG000066485.1)

HSP 1 Score: 1346.64 bits (3484), Expect = 0.000e+0
Identity = 820/2129 (38.52%), Postives = 1279/2129 (60.08%), Query Frame = 1
Query:   94 CVPYLNGNYCDSLSSDYQNALSDEDEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSG-------NKAMIKEKRNSTIK-DFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLV-DISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTE----ILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMK-DIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDE-NHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-------PDEYKGIVKDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLN 6414
             +P+ NG      + D    ++ +DE    + TSK++ER RIKALA ERENVQKKTFTKWINS L  +   I+DLY DL+DGK LL+LLE+LS E +P PT+G+MRIHCLENVDK L FL  Q+VHLEN+GAHDIVDGN RLTLGLIWTIILRFQ+QDI  +ED +   + AKDALLLWCQMKTAGYP+ N+RNF+  WR GL F A+IH+HRPDL+++S+ +R++   NL  A  IAE  LGIP LLDPEDV+V  PDE+S++TYV ++YH+F+ +KA SV +KR+ K+L+Q +E E+M+  Y  L S LLEWI  TI LLN R F+NS+ G+QQQ+  FN YR  EKP KF EK +LE+LLF+I+S    +    Y P E   +S IN+AW++L+ AE+ RE ALR EL+RQEKL  LA +F++KA +RE+W+T+N  L+ + + G +L  V AA KKHEAI+TDI AYEE +  +T ++  LE E Y+D+  ++  ++ V+ LW+KLL  L  R+  LD   +V  L  +   +  II  + A+ + ++ G+HLM VE+L+  H L+E DIR +  ++E ++S+A     F + +F   ++SG       N+ ++   R   +K ++  LL+    RK+ L  S ++W+F+   + EEQW+KE + +M NPDLG+DLSSV RL+ KHKV E ++ +    L+N +  G+ L+ D +P G E +A    +++ LW  L++ TE+R+ KL + L Y+  ++DC + E WI E  +L  +    D+ S  E      I K++Q  + +E+Y  NI  +  Q +  L    ++  T+ +K+  I+ +Y  L ++ ++ Q KL D L+++R+L  +D+V++WI EK+K L + IP+D++EELEV +HRF+ FE E+  +A++V  VN L+E L    +P    +VN +  LN  WN +AD+V+++R++L + Y ++ + ++C+QT EWIREK +L+ES DELG+DL  +MQ QRR+  MQRD+ AI AK++HL  + D ++       + I  +  ++   W  L  ++ DRD  L+  +++ RF+Q LD  H WL +MQT +AS+++P+  ++AEK + ++   ++E+ + + +    +  G+   + + D  Q++ L  R+ ++ + W+ L  + E ++  L + L   +F  DA Q E +L  +E +L K DI   I N      NLL       ++E F+  + ++      V++ G+ L+   +   D++  + +++ ER + N   +     KLK+QVL  EL QDIDDL   + EK+ +  + S    K+      + +A ++EI A +  + +      Q   + P     I   +D+LN  W EL +    K + +   NRE +FEE T  +M WL+ I   I+  +E       +T +  +LKK++  + E+E K+K +++LK H+  LK++ P+KA   EQ    ++     L +P+++K     Q+   +QFL++ DD+  W+++K+ L    ++       LL  QQL  RH+ +  E+ N   +++ L +E   +I+E + ++R   V  + +L+     L   ++  Q  L    A Q FL D  E  SW+ E+EL L+      +D +    VI+K    +  I++Y  +I +       L        D        V+  +  L+ +C EKK  +S        Y    ++E WI ERT +A S D G D + C LLR+RF  F  ET+ +G  +V  AN     LI   H  +  I+ W DRIN+ WA+L EL+ TRIQLL++AW+ +++    Q +L+ I EK +S  +  D+ KD +SV++ QRK   F  D   L+  +   +  +N LLP Y   KE  + ++R +++  +  L    E R+    + AD   F SMVRELL W++ V +Q+  + +P+DVSG+ELL+ +HRS+K E+ ++EE+ SIC+NLGRTLL    +   E+++    +  ++  L   W    D+L L++EVYQ+ARDA+ AEAW+++QE YL N+ LG TLDETL+LLKK I F+K  M+QEE+F+ L++LTTMEIR+K++ 
Sbjct:    7 TLPWSNG------TGDTNGNITTDDEWDTEDSTSKLYERFRIKALAGERENVQKKTFTKWINSHLNKLKQSIDDLYNDLKDGKMLLLLLEILSGEQLPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQVPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDIINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQ---PFINSEF--GLDSGDFQPADPNEVIL---RTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQAGQQLILDKNP-GAEKVADNLKELELLWNELIELTENRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKI----DETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKK-LSEGDLELVTIEEKVSNIKSQYAILFELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNDEELIREERMILEDFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDA-QYMFLSQRLNALEEGWQELCQMWENRQGLLSQSLSLQVFLRDAIQSEVLLAQEENFLSKEDIPISIEN----SQNLL------RKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILERRESNKRRSNEAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLETIGESIIVTEE---EVETLTDVNVKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPIKNKKIQLIQRKRIQQFLRNLDDQKAWVDDKLLL----AESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIAS--IPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFQALEKLTTMEIRAKEIT 2095          

HSP 2 Score: 134.42 bits (337), Expect = 7.866e-31
Identity = 76/234 (32.48%), Postives = 128/234 (54.70%), Query Frame = 1
Query: 6616 IKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLS--QSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRN-GAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRFFSSIRLKK 7308
            +KD    +++ +   + +P P    +   P++  S+  +     +  H +SV +   +   + + T+T       ++G L RKH+WE +N+KA NR+WH   V+LS  ++++  +KDE+H+ EKP+  Y  +  L L ++VAAPA DYLKRP VFR++  + GAEYLFQ     DM RWV++IN  S+  + +    T P  + + P  +S     +    G K+ F ++  KK
Sbjct: 2101 LKDKHKQERIENAIKIFQPPPSPELVHESPKVSISEEDEEGKSHQ--HKISVISKEAAEMCQSSETKTD------IRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQ--KDLKSETTAPGKSSTLPACTSDPHVPSTQATGFKKKFFTLTRKK 2324          
BLAST of Spectrin beta chain vs. Planmine SMEST
Match: SMESG000081696.1 (SMESG000081696.1)

HSP 1 Score: 1299.26 bits (3361), Expect = 0.000e+0
Identity = 829/2405 (34.47%), Postives = 1386/2405 (57.63%), Query Frame = 1
Query:  166 DEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHV--TMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKL--MEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQT---VAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVS-LPDEYKGIV--------------KDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTR-TIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFK-EKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRFFSSIRLKK 7308
            D ++  N ++ ++ERSRIKAL+++RE VQKKTFTKW+NS L+       ++DL+VDL+DGK LL LLE+LS E +P  T+G++RIHC+ENV K + FL +Q V  EN+GAHDIVDGNP L LGLIWTIILRFQ+QD   DE      +++K++LLLWCQMKTAGY +VNIRNFT+SW+ GL F AL+HKHRP+++D+ +  + + + NL+ AF+ AE   G+P LLD  D+ V  P+E+S++TYV S     N +K +    KRL  ++N+ +  E++I  Y+ L  +LLEWI+  I  +   + + S+PG+++Q+  F+ YR  EKP KF ++  LE+  F I+S       K+Y PPE   +S IN AWD L  +E+  E  L +EL+RQ+KL  L   FN+KA +R+ W+ +N  L+ ++  G++L T++AA+KKHEA+E DI+A+EE +  L  I+D+L+ E Y  I  + +    ++++WKKLL  L  RR+ LD    +  ++ E   +   +  IT + +  ++GKHL+ VE LL  H+++ SDIR++  R    I + +R +Q  D D R+ I+     M   K    + ++ EL+   ++R++ L    ++W++I D + +++WIKE++ +  +PD G+DL SV+RL+RK +    +++ ++  + +KL  +  KT  D SP  QE I  + ++I  L + L  +  +R+ +L +  D++Q ++D +DA+  I E +RLF+   +GDK+S TE  ++++++ M  VE     I ++  +   L     +D Q      +  +R++  ++DL+D+A+  +  LL+    + L ++ +++ +WI  K+K L   +PS++++EL V+KHRF+ FE ++   + KV   N +S +L+   +P  +II   Q+ LN  WN++AD+ + K+ EL     Y+ F ++ Q+T  WI++K+KL+E  D+L +DLE +MQ QRR+  +QRD+ AIEAK+ +L  + D++          I+ ++  V++ WE L+ +++DRD+ L + N++ +F + LD F  WL ++Q ++A+Q+IP+   EAE+    +   ++E+   E +    ++ G+    S+ D  Q++    R+  +  +W  L  + ++K+  L +   +  F  D+ QI+ IL  QE +L K    L NN+  +K+          E E F + + S++  +  V+  G++L+  N L  D+++NKC+ +  R          R + L++ +LL E   D+  L++ + EK+ + ++ S  + K   +   + K  E E+ A R  ++E+ ++G +   + PHF+ EI   +  L + W+EL     EK + L   NRE +F+E+T+SMM W+  I  QI+   E      G+  +  ++K  +  + +L+ K+K+L +++ H+E LK+Q P++  ++E ++ +VKV +  +  PL  + +I  QK   +QFL+D +DE +W+ EK++ I       ET+   LQ  +   R K+   EI N + ++  L  E + MI  +          +++L K  ++L    E  Q        VQE+L +  E   W+SE+E DLM     +KD+      +RK + L   I NY         S VS L D+Y  I+              + V+  +  L  +C EKK +I   + +   Y   Q +E WI ER+++A S++ G +L+ C LLR+RF  F+ +TN++GSS+V +A++  D+LI   H  +  I+ WKDRINE WADLLELI+TRIQLLK+A+D  ++  DS  LL+ I EK   +  V  +GKD KSV+  QRK   F  ++ +L+  I+NA+ +++ LLP+Y  +KE  +  ++ EL   + SL+K  E+R  + ++ +D + F +MVREL++W+ E+ IQ+    K RDV G+EL+++NHRSLK E+DS++EN SIC+ LGRTL+  KH ++ +++ K KE+  K   + + W    + L +++EVYQ+AR+AA AEAW+I+QE  LN ++ G TL+ETL LL+K +  ++    Q ++FE LK+LT+ E   K L  +++   E L + E+  E  + E   P           P    P       +R+  +I   L +D                 ++ P    S  S V     ++ P    + +              +PK   T+ T  P+     G L RKH+WEN  +KA NR W+ LYV++  S+M+ +K+ ++++ +K +Q YKHE P+ L   +++PA +Y KRP VFR+R +NGAEYLF+     +M +WV+ IN       ++   +T+ +   + PN+ S            K+ F ++  K+
Sbjct:   13 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPTLILGLIWTIILRFQIQDAAIDE--KDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNKVKRNEKQCKRLGNVINEAISAEKLINNYEELSEELLEWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGR----IDDTSRKLQTADFD-RAAIDQDYVDM---KEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLE----LDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDP-QYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSK--SELPNNYEATKAT-------EREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVTEISSQIIT-TEEIIEEYGLVELNEKMKDQEDKDKQLDQKRKMLSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIR---RLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMR-EDKAKDEGGALNAMRKHEELISVINNY--------GSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSSRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEV--VGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAEKK--REKLKDREKRLELTIREFNTP-----------PPTPEP-------VRKVEAI-KQLSED-----------------IIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKS----------KENPKLIETKSTTEPK----TGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVYKERKYYEDDKKQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKIN-------EIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQ 2318          
BLAST of Spectrin beta chain vs. Planmine SMEST
Match: SMESG000081696.1 (SMESG000081696.1)

HSP 1 Score: 1298.88 bits (3360), Expect = 0.000e+0
Identity = 829/2405 (34.47%), Postives = 1386/2405 (57.63%), Query Frame = 1
Query:  166 DEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHV--TMKIEDLYVDLRDGKFXXXXXXXXSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKL--MEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQT---VAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDXXXXXXXXXXXXXXXXMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVXXXXXXXXXXXXXXXXXEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMXXXXXXXXXXXXXDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVS-LPDEYKGIV--------------KDVEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTR-TIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFK-EKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRFFSSIRLKK 7308
            D ++  N ++ ++ERSRIKAL+++RE VQKKTFTKW+NS L+       ++DL+VDL+DGK LL LLE+LS E +P  T+G++RIHC+ENV K + FL +Q V  EN+GAHDIVDGNP L LGLIWTIILRFQ+QD   DE      +++K++LLLWCQMKTAGY +VNIRNFT+SW+ GL F AL+HKHRP+++D+ +  + + + NL+ AF+ AE   G+P LLD  D+ V  P+E+S++TYV S     N +K +    KRL  ++N+ +  E++I  Y+ L  +LLEWI+  I  +   + + S+PG+++Q+  F+ YR  EKP KF ++  LE+  F I+S       K+Y PPE   +S IN AWD L  +E+  E  L +EL+RQ+KL  L   FN+KA +R+ W+ +N  L+ ++  G++L T++AA+KKHEA+E DI+A+EE +  L  I+D+L+ E Y  I  + +    ++++WKKLL  L  RR+ LD    +  ++ E   +   +  IT + +  ++GKHL+ VE LL  H+++ SDIR++  R    I + +R +Q  D D R+ I+     M   K    + ++ EL+   ++R++ L    ++W++I D + +++WIKE++ +  +PD G+DL SV+RL+RK +    +++ ++  + +KL  +  KT  D SP  QE I  + ++I  L + L  +  +R+ +L +  D++Q ++D +DA+  I E +RLF+   +GDK+S TE  ++++++ M  VE     I ++  +   L     +D Q      +  +R++  ++DL+D+A+  +  LL+    + L ++ +++ +WI  K+K L   +PS++++EL V+KHRF+ FE ++   + KV   N +S +L+   +P  +II   Q+ LN  WN++AD+ + K+ EL     Y+ F ++ Q+T  WI++K+KL+E  D+L +DLE +MQ QRR+  +QRD+ AIEAK+ +L  + D++          I+ ++  V++ WE L+ +++DRD+ L + N++ +F + LD F  WL ++Q ++A+Q+IP+   EAE+    +   ++E+   E +    ++ G+    S+ D  Q++    R+  +  +W  L  + ++K+  L +   +  F  D+ QI+ IL  QE +L K    L NN+  +K+          E E F + + S++  +  V+  G++L+  N L  D+++NKC+ +  R          R + L++ +LL E   D+  L++ + EK+ + ++ S  + K   +   + K  E E+ A R  ++E+ ++G +   + PHF+ EI   +  L + W+EL     EK + L   NRE +F+E+T+SMM W+  I  QI+   E      G+  +  ++K  +  + +L+ K+K+L +++ H+E LK+Q P++  ++E ++ +VKV +  +  PL  + +I  QK   +QFL+D +DE +W+ EK++ I       ET+   LQ  +   R K+   EI N + ++  L  E + MI  +          +++L K  ++L    E  Q        VQE+L +  E   W+SE+E DLM     +KD+      +RK + L   I NY         S VS L D+Y  I+              + V+  +  L  +C EKK +I   + +   Y   Q +E WI ER+++A S++ G +L+ C LLR+RF  F+ +TN++GSS+V +A++  D+LI   H  +  I+ WKDRINE WADLLELI+TRIQLLK+A+D  ++  DS  LL+ I EK   +  V  +GKD KSV+  QRK   F  ++ +L+  I+NA+ +++ LLP+Y  +KE  +  ++ EL   + SL+K  E+R  + ++ +D + F +MVREL++W+ E+ IQ+    K RDV G+EL+++NHRSLK E+DS++EN SIC+ LGRTL+  KH ++ +++ K KE+  K   + + W    + L +++EVYQ+AR+AA AEAW+I+QE  LN ++ G TL+ETL LL+K +  ++    Q ++FE LK+LT+ E   K L  +++   E L + E+  E  + E   P           P    P       +R+  +I   L +D                 ++ P    S  S V     ++ P    + +              +PK   T+ T  P+     G L RKH+WEN  +KA NR W+ LYV++  S+M+ +K+ ++++ +K +Q YKHE P+ L   +++PA +Y KRP VFR+R +NGAEYLF+     +M +WV+ IN       ++   +T+ +   + PN+ S            K+ F ++  K+
Sbjct:    5 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPTLILGLIWTIILRFQIQDAAIDE--KDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNKVKRNEKQCKRLGNVINEAISAEKLINNYEELSEELLEWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGR----IDDTSRKLQTADFD-RAAIDQDYVDM---KEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLE----LDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDP-QYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSK--SELPNNYEATKAT-------EREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVTEISSQIIT-TEEIIEEYGLVELNEKMKDQEDKDKQLDQKRKMLSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIR---RLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMR-EDKAKDEGGALNAMRKHEELISVINNY--------GSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSSRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEV--VGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAEKK--REKLKDREKRLELTIREFNTP-----------PPTPEP-------VRKVEAI-KQLSED-----------------IIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKS----------KENPKLIETKSTTEPK----TGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVYKERKYYEDDKKQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKIN-------EIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQ 2310          
The following BLAST results are available for this feature:
BLAST of Spectrin beta chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPTBN10.000e+035.19spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+035.07spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+036.29spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN20.000e+033.35spectrin beta, non-erythrocytic 2 [Source:HGNC Sym... [more]
SPTBN20.000e+033.35spectrin beta, non-erythrocytic 2 [Source:HGNC Sym... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-700.000e+035.15Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
unc-700.000e+034.90Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
unc-704.859e-1736.74Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
unc-706.134e-1736.28Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
sma-11.272e-14437.44SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3][more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
beta-Spec6.665e-3037.09gene:FBgn0250788 transcript:FBtr0074454[more]
beta-Spec6.911e-3037.09gene:FBgn0250788 transcript:FBtr0334404[more]
beta-Spec8.032e-3037.09gene:FBgn0250788 transcript:FBtr0334405[more]
kst5.385e-14831.41gene:FBgn0004167 transcript:FBtr0073071[more]
kst6.317e-14831.37gene:FBgn0004167 transcript:FBtr0300017[more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptbn10.000e+034.30spectrin, beta, non-erythrocytic 1 [Source:ZFIN;Ac... [more]
sptbn21.278e-1634.88spectrin, beta, non-erythrocytic 2 [Source:ZFIN;Ac... [more]
sptbn15.228e-2835.84spectrin, beta, non-erythrocytic 1 [Source:ZFIN;Ac... [more]
sptb1.176e-1734.83spectrin, beta, erythrocytic [Source:ZFIN;Acc:ZDB-... [more]
sptb1.176e-1734.83spectrin, beta, erythrocytic [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPTBN10.000e+035.17spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+034.99spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+035.42spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+035.38spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+034.98spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sptbn10.000e+035.22spectrin beta, non-erythrocytic 1 [Source:MGI Symb... [more]
Sptbn10.000e+035.22spectrin beta, non-erythrocytic 1 [Source:MGI Symb... [more]
Sptbn10.000e+036.58spectrin beta, non-erythrocytic 1 [Source:MGI Symb... [more]
Sptbn10.000e+036.40spectrin beta, non-erythrocytic 1 [Source:MGI Symb... [more]
Sptbn20.000e+032.75spectrin beta, non-erythrocytic 2 [Source:MGI Symb... [more]
back to top
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01082|SPTB2_HUMAN0.000e+035.19Spectrin beta chain, non-erythrocytic 1 OS=Homo sa... [more]
sp|Q62261|SPTB2_MOUSE0.000e+035.22Spectrin beta chain, non-erythrocytic 1 OS=Mus mus... [more]
sp|Q00963|SPTCB_DROME6.681e-2937.09Spectrin beta chain OS=Drosophila melanogaster OX=... [more]
sp|O15020|SPTN2_HUMAN0.000e+033.35Spectrin beta chain, non-erythrocytic 2 OS=Homo sa... [more]
sp|Q9QWN8|SPTN2_RAT0.000e+032.72Spectrin beta chain, non-erythrocytic 2 OS=Rattus ... [more]
back to top
BLAST of Spectrin beta chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NLG00.000e+040.59Spectrin beta chain OS=Paragonimus westermani OX=3... [more]
A0A0X3PMM50.000e+040.08Uncharacterized protein (Fragment) OS=Schistocepha... [more]
G4VDE60.000e+039.40Spectrin beta chain OS=Schistosoma mansoni OX=6183... [more]
A0A094ZSL40.000e+039.32Spectrin beta chain OS=Schistosoma haematobium OX=... [more]
A0A5K3ET410.000e+039.37Spectrin beta chain OS=Mesocestoides corti OX=5346... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptbn20.000e+033.78spectrin beta chain, non-erythrocytic 1-like [Sour... [more]
sptbn20.000e+033.82spectrin beta chain, non-erythrocytic 1-like [Sour... [more]
SPTBN12.202e-2736.59spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
sptbn20.000e+033.63spectrin beta chain, non-erythrocytic 1-like [Sour... [more]
ENSAMXT00000030945.10.000e+036.55spectrin beta chain, non-erythrocytic 1-like [Sour... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008111.10.000e+034.08pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 ge... [more]
ENSPMAT00000001834.16.334e-2137.48pep scaffold:Pmarinus_7.0:GL482425:158920:175005:1... [more]
ENSPMAT00000004049.18.224e-1243.08pep scaffold:Pmarinus_7.0:GL476488:489896:554954:1... [more]
ENSPMAT00000000684.14.207e-10239.71pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 ... [more]
ENSPMAT00000009295.13.889e-9839.50pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 ge... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SAC61.218e-728.33Fimbrin, actin-bundling protein; cooperates with S... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO424313.706e-1433.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495762.192e-16538.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ALPHA-ACTININ1.017e-10538.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291011.148e-10548.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495752.598e-8521.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptbn20.000e+033.85spectrin beta chain, non-erythrocytic 1 [Source:NC... [more]
sptbn10.000e+033.67spectrin beta chain, non-erythrocytic 1-like [Sour... [more]
SPTBN10.000e+036.32spectrin beta chain, non-erythrocytic 1 [Source:NC... [more]
sptbn20.000e+034.08spectrin beta chain, non-erythrocytic 1 [Source:NC... [more]
sptbn20.000e+033.60spectrin beta chain, non-erythrocytic 1 [Source:NC... [more]
back to top
BLAST of Spectrin beta chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039799.10.000e+099.71SMESG000039799.1[more]
SMESG000035098.10.000e+039.62SMESG000035098.1[more]
SMESG000066485.17.866e-3138.52SMESG000066485.1[more]
SMESG000081696.10.000e+034.47SMESG000081696.1[more]
SMESG000081696.10.000e+034.47SMESG000081696.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003374 ID=SMED30003374|Name=Spectrin beta chain|organism=Schmidtea mediterranea sexual|type=transcript|length=7443bp
AAAATTTCATTAGAATTTATTATCGCGGCAGTATGTTTATTTCACCATAA
AAATTGGAAGAAATACAATTATAAAAAATAAATCATGGAAATTTGTGTAC
CCTATTTAAACGGTAATTATTGTGATTCTCTGTCAAGCGACTATCAAAAC
GCATTATCTGATGAAGATGAAGTTCAGTACGCAAATGTGACATCAAAAGT
TTTTGAAAGATCAAGAATTAAAGCTTTAGCAGATGAAAGAGAAAATGTCC
AAAAGAAAACCTTTACCAAATGGATTAATTCAACTTTGATTCATGTCACT
ATGAAAATTGAAGATTTATATGTTGATTTGAGAGATGGAAAATTTTTATT
GGTTTTATTAGAACTTCTATCAAATGAAATTGTGCCGAAACCAACGCGTG
GTAGAATGAGAATTCATTGCTTAGAAAATGTGGATAAATGTCTAGGATTT
TTATTCAACCAAAAGGTCCATCTTGAAAATGTTGGAGCACATGATATTGT
TGATGGAAATCCTCGATTGACTCTGGGTTTAATATGGACAATAATTTTAA
GATTTCAAGTCCAAGACATCCAATTCGATGAAGATTACTCACCTGTTGCA
AAATCTGCTAAGGATGCCTTGTTATTGTGGTGTCAAATGAAAACTGCCGG
TTATCCTAGCGTTAACATCAGAAATTTCACTAATAGCTGGCGAACTGGTC
TTGGATTTGTTGCTTTGATTCATAAACATCGTCCAGATTTGATAGATTTT
TCAAGCTGTAACAGAAATGACAATATTAATAACTTACATTTGGCTTTTGA
CATAGCGGAAAATGCTCTTGGAATTCCTTCTTTGTTAGATCCAGAAGATG
TAAATGTGCCCTTGCCAGATGAGCGATCCGTCATCACATATGTAGCAAGC
TATTACCATTACTTTAATTCATTAAAAGCCAGCAGCGTTCTGAATAAAAG
GCTGAATAAATTGCTCAATCAGGTTTTAGAAGATGAACAAATGATACAAC
TCTATCAGAGTCTTGTTTCTAAATTATTAGAGTGGATTCGTAATACAATT
CGACTGTTAAATATGCGCCAGTTCTCCAATTCAATTCCCGGAATTCAGCA
ACAAATGAACACATTCAACTTTTATAGAACCGGAGAGAAACCGAGCAAAT
TTGTGGAAAAAGTCGACCTAGAAGTCCTGTTGTTCACGATAAAAAGCAAT
CAGTTTGTGTCCAGATTAAAGGTTTACAATCCGCCGGAAGAATTTAGTTT
ATCGACTATCAATTCAGCATGGGATGAGTTGAATACTGCTGAATATGGTC
GTGAAACGGCATTGAGAAAGGAACTGATGCGACAAGAAAAACTGAGAAAT
CTGGCACAGAAATTCAACAAAAAAGCAGCTTTAAGAGAATCGTGGATTAC
CGACAATATGGAGCTGTTGCAAAAGCAATCATTGGGCAATAATTTACCAA
CAGTGCTAGCGGCGTTGAAGAAACACGAAGCGATCGAAACGGACATTTAT
GCGTACGAAGAAAACCTAATTGGTTTAACAAAAATCTCTGATAATCTAGA
AGAAGAAATCTATAACGATATAATTTCAATTATCAACACTAAAAATAAAG
TTCTTGATCTTTGGAAAAAATTGCTTCAAACTCTTCATGAACGCAGAGAA
CATCTGGACAACTATTTACAGGTTTACACCTTGATCAACGAATTCTGTGA
AGTGCAGGCAATTATTACCGGGATAACTGCTAAACAGAGAATCGATAACT
ATGGCAAGCACCTAATGGAAGTGGAAGAACTATTGAGATCACATGAATTG
ATCGAGTCGGATATCCGTTCGATCAATCAAAGATTAGAAAAACTGATTTC
CGAAGCAAATCGATACGTACAGTTTTGCGATCAAGATTTTCGAAGCAATA
TCAATTCGGGCAATAAAGCAATGATTAAGGAAAAACGCAATTCGACCATT
AAAGATTTCCATGAACTTTTAGATAGTCTTGATAAGCGTAAAGAAATTTT
GAAACACTCGCATTTGGTTTGGCAATTTATCGTCGATGCGTCACTCGAGG
AGCAATGGATTAAAGAACTCGTCGATATCATGAATAATCCCGATCTGGGA
TACGATCTTTCATCGGTCGATAGATTGTTGAGAAAGCATAAAGTTTTTGA
ACTTGAACTCAGCTCCAAACGGATTTCATTGGAAAATAAACTGATGGAAG
GAAAAACTCTAGTTGACATTTCTCCTGTTGGACAAGAGTTTATTGCAGCT
AAAAACAATGACATTCAGAACCTATGGGAAGCATTGGTGGATTCGACTGA
ATCGAGAAAGATCAAACTGTTGGAAATGTTAGACTATTACCAATACGTGT
CTGACTGTGATGATGCCGAATGTTGGATTGATGAGTTCAAACGGCTTTTC
GATTTGAAATTCCTCGGAGATAAAATGTCTTTTACGGAAATCCTTATTCG
AAAGAATCAACAAAATATGGAAATCGTTGAAAATTACCGAGACAATATCG
AACAAATTCGCAATCAAGCCCAATCATTACTGGGGTATTCTATAGTTGAC
CATCAAACAGTAGCGAAGAAATTGGATAGAATCGAAAAGAAGTATCAAGA
TTTACTCGATATTGCTCATAAAATGCAGGAGAAGTTGCTGGACGCGTTGA
CAGTTTATCGGTTGCTAAATGACTCGGATTCAGTTCGATCATGGATAACG
GAGAAACAGAAATTCCTCTGCAACTTCATTCCGAGTGATGACATTGAAGA
ATTGGAAGTTCTCAAGCATCGGTTTGAAGTATTCGAGTCGGAATTGACAA
AGCGTGCAGAAAAGGTTTATCATGTGAATAACCTTTCGGAAAATCTCGTT
GTCAATGGCAATCCAAATCACCAGATAATCGTGAATAATCAAGACAACCT
AAACAATTCCTGGAATAAAATGGCCGATATTGTCGACAGTAAACGCGATG
AGTTATTATCGAAATATCATTATAGCAACTTCTTTATGGATTGCCAGCAG
ACTATTGAATGGATCAGAGAGAAAATCAAGCTCATTGAATCCATGGATGA
GCTTGGGGAGGATTTAGAGAGTGTAATGCAACGACAAAGACGTATAAACC
ACATGCAAAGAGACATTTGTGCCATTGAAGCGAAAATCGATCATCTCGTG
GCTCAGGGTGATGAAATATTGCGACACAATTTGCGAAGCGCCAAAGACAT
CGAACACCAATTGGATTTAGTGCATCAGGAATGGGAAATTCTCCAGCAGT
TAATTAGAGATCGCGATTCTACCTTGGCCAATAAGAATGATATTCATAGA
TTTATTCAGAAATTAGACGATTTTCATAATTGGCTCGGGCAAATGCAAAC
AGAAATGGCAAGTCAGAATATCCCAGAATCTCAATCGGAAGCTGAAAAAT
TGATCAACAAATACAATTCCCAAAGAGATGAAATGGCTGCAATGGAACAG
CAGCTAGAAGAATGGATGAAAATCGGCAAAGATTTTCTCAAAAGTGAACA
AGACAAAGACCAATTTGTAAGACTTCAAAATAGAATAGAATCAATAAATC
AGGATTGGAAAATTCTCAATGATCTTAGCGAAGAAAAAGAAAAGCGATTA
GAAAAATATTTGAAAAGCTTGATGTTCTTTGAGGATGCAAGGCAAATTGA
AAAAATTCTAAATGCTCAGGAAAAATATTTAATGAAAGACATCCAATCGC
TAATAAATAATTTCAATACGAGCAAGTCTAATTTATTGTCACTCAATGAA
ATTGTAAACGAAAATGAAATATTCATTGACAAAATGCTATCTGATGAAAA
ACTGCTAGCAATAGTTCTGAAGCAAGGCAAAACGCTGATTTTAGAAAATA
ATTTATATAAGGACCGTATGCAAAATAAGTGTCAAAATCTAGATGAAAGA
TGGAAAAAGAACACATTGGCAGCTCAAAATCGGAAAAATAAATTGAAGGA
ACAAGTTTTGTTGCATGAATTGCTTCAGGATATTGATGATCTCGATGACA
GTTTATTAGAAAAAATTCAAGTACTCAATGAAATTAGCATGCTTAATAAC
AAATCAACCGACAGCTGTCTAGCTCAGTGTAAAGCACTGGAGGACGAAAT
TAATGCCTACAGACCAATTATTGAAGAACTCAATAAGAGAGGAAAGCAAA
CAAGTGCAGACTTTCCTCATTTTAAAAAGGAAATCATTGACCACCTTGAT
AACCTCAACTCGACATGGGCGGAATTATCCAAAGCCCTTGAAGAAAAACT
ACAGAATTTGGCACATTTCAACAGAGAAAAGTTGTTTGAAGAATCTACGC
AATCAATGATGAAATGGCTCAAAAATATTGAAGGCCAAATTGTAGCCGAT
GATGAACCTGATGGATCTCGATCGGGAATTACTTCAATTACAAACCAACT
AAAAAAGCTAGATTCACATAACATGGAGTTAGAAAACAAGAAAAAACTTC
TCGAAAACCTCAAGGATCATTCGGAATTATTGAAACAACAGAATCCTGAC
AAAGCATCGAAATACGAGCAACTTGAAACCCAGGTCAAAGTAACAATGGA
TGGTCTATCAGTTCCATTGGAAAGCAAGCTGTCAATTGCAAATCAAAAAA
TAATTGCGGAACAGTTTCTCCAAGATTGTGACGATGAAATCGATTGGATG
AACGAAAAAATTGACTTGATTCGAAACAGATCTAAACAAATGGAAACAAT
TTGCACCTTACTACAATTTCAGCAGCTCCAGATGAGACATAAATCCATGA
AAAACGAAATCAGAAATCGGAGTGTCAAGGTTGATTCATTGATACAGGAA
GCTCAGAGAATGATTGATGAGAATCATTTGAAAAGAGCGCTGGTTGTGGA
TACTGTAAATCAGCTAAAGAAAACTCGAGAGAATTTAAATGAAGAAATGG
AAAAGTTTCAAAACATGCTATCAAATCAACTTGCTGTCCAAGAATTTTTG
CTGGATGTTTCAGAAGTGAGCTCTTGGATTAGTGAAAAGGAGCTCGATCT
CATGGGACTTGTAATTAATTCAAAGGATGATCAACTGATTCGCCGAGTCA
TTCGCAAAGAACAAAACTTAGAGATGGAAATCAAAAATTATTATCCTAAA
ATAGAGGAATTCAAAAAGTCATGCGTATCACTTCCAGATGAATATAAAGG
AATTGTGAAGGATGTTGAAGATAATTTCAATTCCTTGAAGATAATTTGCG
CTGAAAAAAAGACTGAAATATCTTTATTTGTCATATATTGTGACACTTAT
GAACTGTATCAAAATATTGAAGCATGGATCGTGGAGAGAACTAAAATCGC
TAGGAGTGATGATTCTGGTAAAGATTTAGATCAGTGTACATTGCTGAGAG
ATCGGTTTGTAATTTTTTCATCTGAAACTAACAAAATTGGAAGCAGCAAA
GTTAATGAAGCTAATAAGCGTTTTGATGAATTAATTCAAGGAAAACACCC
GTTTGCACATTCGATATCAGTTTGGAAAGATAGAATCAACGAAATCTGGG
CAGATCTCCTAGAACTCATTGATACTCGCATACAGCTTTTGAAATCTGCT
TGGGACCTTCACAGATGGTATTGTGACAGTCAGTTTCTTTTGGAGTGCAT
TCAAGAGAAGAAATCATCAATGGAAGTTGTCAATGATTTAGGCAAGGATC
CAAAATCAGTTTCCTTGCTACAAAGAAAACTAAAGAATTTCGAAAAAGAT
TTATTGAAATTGGATTCAGATATTAATAACGCAATTACGGTCTCCAACAC
CTTGTTACCTTTATATTGCAAAGATAAGGAAGCAACTCTGATAAAGAAAC
GCCAAGAACTCATTGATGCGTTTAGGTCTTTGAGGAAAATTTTAGAAGAT
CGAAAATTGAATAATTTGGAATTGGCAGATTTTCACAACTTTTTGTCGAT
GGTGAGAGAACTGTTACACTGGATTGAAGAGGTAACGATTCAAATGGAAA
TGAGACACAAACCTAGAGATGTGAGTGGAATTGAATTGTTGCTCGCCAAT
CATCGCTCATTGAAAATTGAAATGGATTCAAAGGAGGAAAACTTTTCCAT
CTGTTTGAATCTAGGGCGGACATTGCTGAGAACAAAGCACATTCGATCTC
CGGAAATTAAATCCAAATGCAAAGAAATTACCGATAAACGGGACATTCTT
TTCCAAAAATGGTTCAATGTTCTCGATCACTTGTCACTGATGGTTGAGGT
TTACCAATGGGCACGAGATGCCGCCTCGGCTGAGGCCTGGGTCATTTCAC
AGGAATCTTATTTAAACAATGAGAACTTAGGAATGACGCTTGATGAGACT
CTTGCGCTGTTGAAAAAGTTTATTCTATTCCAGAAAGCAAACATGAATCA
AGAGGAAAAGTTCGAGCAATTAAAAAGATTAACTACAATGGAAATACGAT
CAAAGAAATTGAACACTGATCGTCAGTTCATTAACGAAGCATTAATAAAT
ATTGAGCAAACGGCCGAGCATGAAGTTCATGAAATCATTCAACCAATAAC
TGAAAACGTCCAAACATTTGAACACAAGCCAATAATTCATAGGCCATTTG
AGCAGCACCAACAAAACATCCGTAGATTCAATAGTATTGATAGTTCGTTA
GATCAAGATTCAGAAATAAAGGATACTGGTTATTTCCAAAAGGTCAATTC
TCGGCAATCTATGATGCGTCCGTTCCCACAAAGTTCAGCCCTGTCTCCAG
TTCCACAAATGAAACAATCGAAAAGACCGCAACCGTCTAACATGTCTAAA
CCCGTGCACAATTTATCCGTTTCTACAGACATGCTGTCAGCTTCTCCGAA
ACCTGCCACCACTAGAACTATACCACCGGAAGAGGTTCTCATGAAAGGAC
CGCTTTATCGCAAACATCAATGGGAAAATCGAAATCAAAAAGCCTCAAAT
CGTACATGGCACTCCTTGTATGTTTTGCTGTCCCAGTCTCGCATGACTTT
CTTTAAGGATGAAAGACATTTCAAAGAGAAACCCAAGCAATTTTACAAGC
ATGAAATGCCTCTTGTTCTCTGTGAAGTCGTTGCGGCACCTGCACAAGAT
TATCTCAAGCGACCATGTGTATTTCGCGTTCGATTTCGCAACGGAGCAGA
ATATCTTTTCCAAGGCAGTTCTGTGGTAGACATGACGAGATGGGTCGATG
CAATAAATTCTGCGTCTCGTCCTATGCGTCAAGTGAATCCCAGCAATACA
AATCCATCAACGACACAATCACATCCCAACCTCAGCTCATCCTTACCGCC
ACAGGCACAGCACCATAAGGGTTTAAAGCGCTTTTTCTCATCCATTCGTC
TGAAGAAATAGATTATCACAATGATACATATCCTTTTGACGTATTGCCTT
TTTACTCTAACTCTGCATATCGTATTTCTTGGCTTATGTCATACAGTTAT
TGAAATATTTTATACTACATAATATTATTATTATTATTATTAT
back to top

protein sequence of SMED30003374-orf-1

>SMED30003374-orf-1 ID=SMED30003374-orf-1|Name=SMED30003374-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2409bp
MEICVPYLNGNYCDSLSSDYQNALSDEDEVQYANVTSKVFERSRIKALAD
ERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFLLVLLELLSNEIV
PKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLI
WTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTN
SWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSL
LDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLED
EQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNFYRTG
EKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELN
TAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSL
GNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISII
NTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAK
QRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQ
DFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIV
DASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLE
NKLMEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLD
YYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVEN
YRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEK
LLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVF
ESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIV
DSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQR
QRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEW
EILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQ
SEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNR
IESINQDWKILNDLSEEKEKRLEKYLKSLMFFEDARQIEKILNAQEKYLM
KDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKT
LILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVLLHELLQDI
DDLDDSLLEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELN
KRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKL
FEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMELE
NKKKLLENLKDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLS
IANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQM
RHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTVNQLKKTREN
LNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLVINSKDDQ
LIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSLPDEYKGIVKDVEDNFNS
LKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQ
CTLLRDRFVIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDR
INEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVN
DLGKDPKSVSLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEA
TLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEV
TIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRT
KHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAE
AWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLT
TMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPI
IHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQS
SALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEE
VLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTFFKDERHFKEKP
KQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDM
TRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRF
FSSIRLKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0008091spectrin
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR041681PH_9
IPR001605PH_dom-spectrin-type
IPR018159Spectrin/alpha-actinin
IPR001849PH_domain
IPR001715CH-domain
IPR002017Spectrin_repeat
IPR011993PH-like_dom_sf
IPR001589Actinin_actin-bd_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005543phospholipid binding
GO:0003779actin binding
GO:0005200structural constituent of cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0007010cytoskeleton organization
GO:0051693actin filament capping
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1432..1469
NoneNo IPR availableCOILSCoilCoilcoord: 791..818
NoneNo IPR availableCOILSCoilCoilcoord: 1966..1986
NoneNo IPR availableCOILSCoilCoilcoord: 1584..1618
NoneNo IPR availableCOILSCoilCoilcoord: 570..590
NoneNo IPR availableCOILSCoilCoilcoord: 830..850
NoneNo IPR availableCOILSCoilCoilcoord: 1103..1130
NoneNo IPR availableGENE3DG3DSA:1.20.58.1940coord: 1619..1916
e-value: 4.4E-57
score: 195.7
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 1071..1171
e-value: 1.9E-12
score: 49.5
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 1498..1609
e-value: 8.0E-12
score: 47.2
NoneNo IPR availableGENE3DG3DSA:1.20.58.1940coord: 641..852
e-value: 1.5E-29
score: 105.2
coord: 853..1070
e-value: 6.6E-39
score: 135.8
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 1172..1292
e-value: 2.0E-12
score: 49.0
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 1928..2036
e-value: 3.9E-26
score: 93.3
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 2037..2111
e-value: 1.4E-17
score: 65.4
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 537..640
e-value: 3.1E-11
score: 45.5
NoneNo IPR availableGENE3DG3DSA:1.20.58.1940coord: 1321..1497
e-value: 1.2E-10
score: 43.4
NoneNo IPR availableGENE3DG3DSA:1.20.58.1940coord: 283..536
e-value: 1.8E-65
score: 223.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2361..2395
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2361..2391
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2190..2222
NoneNo IPR availablePANTHERPTHR11915SPECTRIN/FILAMIN RELATED CYTOSKELETAL PROTEINcoord: 26..2400
NoneNo IPR availablePANTHERPTHR11915:SF248SPECTRIN BETA CHAIN, ERYTHROCYTICcoord: 26..2400
NoneNo IPR availableCDDcd00176SPECcoord: 647..855
e-value: 1.1325E-24
score: 102.139
NoneNo IPR availableCDDcd00176SPECcoord: 305..528
e-value: 7.21017E-13
score: 67.8559
NoneNo IPR availableCDDcd00176SPECcoord: 1180..1392
e-value: 9.66813E-13
score: 67.4707
NoneNo IPR availableCDDcd00176SPECcoord: 858..1066
e-value: 5.05855E-24
score: 100.213
NoneNo IPR availableCDDcd00176SPECcoord: 1329..1498
e-value: 5.77124E-12
score: 65.1596
NoneNo IPR availableCDDcd00176SPECcoord: 423..643
e-value: 8.6132E-22
score: 94.0495
NoneNo IPR availableCDDcd00176SPECcoord: 1508..1709
e-value: 1.26861E-20
score: 90.5827
NoneNo IPR availableCDDcd00176SPECcoord: 1932..2099
e-value: 1.89876E-16
score: 78.2563
NoneNo IPR availableCDDcd00176SPECcoord: 1725..1924
e-value: 4.09558E-17
score: 80.1823
NoneNo IPR availableCDDcd00176SPECcoord: 966..1176
e-value: 6.13224E-30
score: 117.547
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 499..601
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1070..1182
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1565..1709
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1880..2033
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 2246..2361
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1772..1908
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1242..1392
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1457..1613
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 909..1064
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 609..736
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1993..2117
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 295..416
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 418..531
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 705..851
IPR001605Pleckstrin homology domain, spectrin-typePRINTSPR00683SPECTRINPHcoord: 2317..2334
score: 34.57
coord: 2273..2294
score: 37.37
coord: 2337..2355
score: 40.35
coord: 2253..2272
score: 43.89
IPR018159Spectrin/alpha-actininSMARTSM00150SPEC_4coord: 646..746
e-value: 2.3E-16
score: 70.3
coord: 1179..1288
e-value: 0.23
score: 17.5
coord: 531..640
e-value: 1.4E-6
score: 37.9
coord: 1509..1613
e-value: 1.6E-11
score: 54.3
coord: 1071..1173
e-value: 2.0E-12
score: 57.3
coord: 1619..1713
e-value: 0.0034
score: 26.6
coord: 1399..1503
e-value: 0.18
score: 18.6
coord: 752..852
e-value: 2.7E-9
score: 46.9
coord: 1719..1820
e-value: 7.2E-9
score: 45.5
coord: 2040..2135
e-value: 0.23
score: 17.5
coord: 1826..1929
e-value: 0.0088
score: 25.2
coord: 1934..2034
e-value: 5.0E-13
score: 59.3
coord: 1294..1393
e-value: 1.1E-8
score: 44.9
coord: 858..958
e-value: 3.2E-12
score: 56.6
coord: 964..1065
e-value: 2.0E-13
score: 60.6
coord: 425..525
e-value: 9.3E-18
score: 75.0
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 2251..2364
e-value: 2.4E-17
score: 73.6
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 2250..2362
score: 14.21
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 56..156
e-value: 1.2E-23
score: 94.5
coord: 175..273
e-value: 1.0E-22
score: 91.5
IPR001715Calponin homology domainPFAMPF00307CHcoord: 55..158
e-value: 7.3E-19
score: 68.0
coord: 174..278
e-value: 4.0E-23
score: 81.7
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 54..158
score: 22.991
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 173..278
score: 24.498
IPR001715Calponin homology domainCDDcd00014CHcoord: 55..158
e-value: 9.85815E-14
score: 67.3359
IPR001715Calponin homology domainCDDcd00014CHcoord: 174..278
e-value: 2.27115E-22
score: 91.9887
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 168..282
e-value: 1.2E-44
score: 152.9
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 34..165
e-value: 5.7E-45
score: 154.2
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 37..276
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 2248..2362
e-value: 4.2E-29
score: 102.8
IPR041681Pleckstrin homology domain 9PFAMPF15410PH_9coord: 2254..2359
e-value: 3.5E-18
score: 66.1
IPR002017Spectrin repeatPFAMPF00435Spectrincoord: 423..525
e-value: 2.1E-14
score: 53.9
coord: 1509..1612
e-value: 5.7E-11
score: 42.8
coord: 1069..1173
e-value: 3.1E-11
score: 43.7
coord: 1932..2026
e-value: 4.0E-10
score: 40.1
coord: 303..411
e-value: 1.1E-5
score: 25.8
coord: 962..1065
e-value: 3.7E-14
score: 53.1
coord: 859..958
e-value: 8.5E-11
score: 42.3
coord: 1726..1820
e-value: 6.4E-9
score: 36.3
coord: 750..852
e-value: 3.4E-10
score: 40.3
coord: 1292..1392
e-value: 3.5E-10
score: 40.3
coord: 644..747
e-value: 1.9E-12
score: 47.6
IPR001589Actinin-type actin-binding domain, conserved sitePROSITEPS00019ACTININ_1coord: 56..65
IPR001589Actinin-type actin-binding domain, conserved sitePROSITEPS00020ACTININ_2coord: 130..154