Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30003365
Length (bp)2262
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30003365) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30003365) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30003365) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30003365) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003365

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30003365h1SMcG0007725 Contig24337newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30003365h1SMcG0007725 dd_Smed_v4_6377_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003365h1SMcG0007725 dd_Smed_v4_6377_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: AAK1 (AP2 associated kinase 1 [Source:HGNC Symbol;Acc:HGNC:19679])

HSP 1 Score: 309.301 bits (791), Expect = 2.940e-94
Identity = 175/367 (47.68%), Postives = 226/367 (61.58%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSD-IINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKTLLXXXXXXXXXXXXXXXXXXXXXXPRIRPRANKT 1305
            +IG+ F IGR  V V+E++AEGGF +VF VR+      ALKR+ VNN  DL+VCKREI IM  L+ HKNI+  IDS IN     D++EVL+L+ +C    V +LM   Q++    +EN +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT +   P   G+   E+EI KYTTL+YR+PEMV L S  II  K+DIWALGCLLY LCYFTLPF +  +AI  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  +F +   + PI N+    +P     P+  S    +K  P  +   LT+  P T                    TSI PR RP+A +T
Sbjct:   34 YIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPD-NSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKAR---LTDPIPTT-------------------ETSIAPRQRPKAGQT 375          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: AAK1 (AP2 associated kinase 1 [Source:HGNC Symbol;Acc:HGNC:19679])

HSP 1 Score: 310.842 bits (795), Expect = 4.213e-93
Identity = 175/367 (47.68%), Postives = 226/367 (61.58%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSD-IINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKTLLXXXXXXXXXXXXXXXXXXXXXXPRIRPRANKT 1305
            +IG+ F IGR  V V+E++AEGGF +VF VR+      ALKR+ VNN  DL+VCKREI IM  L+ HKNI+  IDS IN     D++EVL+L+ +C    V +LM   Q++    +EN +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT +   P   G+   E+EI KYTTL+YR+PEMV L S  II  K+DIWALGCLLY LCYFTLPF +  +AI  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  +F +   + PI N+    +P     P+  S    +K  P  +   LT+  P T                    TSI PR RP+A +T
Sbjct:   34 YIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPD-NSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKAR---LTDPIPTT-------------------ETSIAPRQRPKAGQT 375          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: AAK1 (AP2 associated kinase 1 [Source:HGNC Symbol;Acc:HGNC:19679])

HSP 1 Score: 311.227 bits (796), Expect = 1.693e-92
Identity = 175/367 (47.68%), Postives = 226/367 (61.58%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSD-IINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKTLLXXXXXXXXXXXXXXXXXXXXXXPRIRPRANKT 1305
            +IG+ F IGR  V V+E++AEGGF +VF VR+      ALKR+ VNN  DL+VCKREI IM  L+ HKNI+  IDS IN     D++EVL+L+ +C    V +LM   Q++    +EN +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT +   P   G+   E+EI KYTTL+YR+PEMV L S  II  K+DIWALGCLLY LCYFTLPF +  +AI  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  +F +   + PI N+    +P     P+  S    +K  P  +   LT+  P T                    TSI PR RP+A +T
Sbjct:   34 YIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPD-NSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKAR---LTDPIPTT-------------------ETSIAPRQRPKAGQT 375          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: BMP2K (BMP2 inducible kinase [Source:HGNC Symbol;Acc:HGNC:18041])

HSP 1 Score: 296.204 bits (757), Expect = 1.895e-89
Identity = 153/311 (49.20%), Postives = 202/311 (64.95%), Query Frame = 1
Query:  232 FQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINEQQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKA 1155
            F +GR  V +EE +AEGGF  VF VR+      ALKR+ VNN  DL VCKREITIM  L+ HKNI+  +D  +N   ++++EVL+L+ YC    V + M   +K+    +E  +++I CD  EAVARLH C+TP+IHRDLKVENIL+++  NYVLCDFGSAT + + P + G+   EEEI KYTTL+YR+PEM+ L G   I  K+DIWALGCLLY LC+FTLPF +  +AI  G FTIP  +  YS  I  LI++ML  +P  RP I+QVS  AF  A    P+ N++   +P     P+  S    RK+
Sbjct:   44 FAVGRHQVTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMN--KKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPD-NSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTASEAAARKS 351          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: BMP2K (BMP2 inducible kinase [Source:HGNC Symbol;Acc:HGNC:18041])

HSP 1 Score: 285.034 bits (728), Expect = 7.948e-89
Identity = 149/290 (51.38%), Postives = 195/290 (67.24%), Query Frame = 1
Query:  232 FQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINEQQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDK 1092
            F +GR  V +EE +AEGGF  VF VR+      ALKR+ VNN  DL VCKREITIM  L+ HKNI+  +D  +N   ++++EVL+L+ YC    V + M   +K+    +E  +++I CD  EAVARLH C+TP+IHRDLKVENIL+++  NYVLCDFGSAT + + P + G+   EEEI KYTTL+YR+PEM+ L G   I  K+DIWALGCLLY LC+FTLPF +  +AI  G FTIP  +  YS  I  LI++ML  +P  RP I+QVS  AF  A    P+ N++K
Sbjct:   44 FAVGRHQVTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMN--KKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPD-NSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINK 330          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: sel-5 (Serine/threonine-protein kinase sel-5 [Source:UniProtKB/Swiss-Prot;Acc:G5ECQ3])

HSP 1 Score: 220.705 bits (561), Expect = 8.298e-62
Identity = 123/290 (42.41%), Postives = 175/290 (60.34%), Query Frame = 1
Query:  223 GKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKR-LCVNNRIDLKVCKREITIMSS-LTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERN--NYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPI 1077
            G   ++    V +E+ IAEGGF +V+    + ++ FALKR    +N   L+ C RE + +   + HKNI+  +DS  N   N I+E ++L  Y  KNV  LM  +   NQ+L+ + I+ I  D+ EAV+ +H    P+IHRDLKVEN+LI      +YVLCDFGSAT + +   +YG+   + E+ + TT+ YRSPEM+   S + I  KSDIWALG LLY LC+F +PF +  LAIQS  +  P +  +  D+I  LI  +L ++   RPSIYQ SVLAF  AN + P+
Sbjct:   37 GVTLKLDHTRVTIEKQIAEGGFAIVYVASDRKNNKFALKRQFTKDNEKQLEACCREHSFLKQCIGHKNIVEFVDSYTNCLGNGIWECMLLTEYHQKNVLQLMNERISQNQYLTNDEILSIFTDLCEAVSFIHNRPQPIIHRDLKVENVLISSHKPPHYVLCDFGSATTQILSVEKYGVEYVKSEVERNTTMCYRSPEMIDFYSGLEIGLKSDIWALGVLLYRLCFFCVPFEESPLAIQSVNYQFPSVPNI-PDEIKVLIYMLLDIDVNRRPSIYQTSVLAFE-ANHRKPL 324          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: sel-5 (Serine/threonine-protein kinase sel-5 [Source:UniProtKB/Swiss-Prot;Acc:G5ECQ3])

HSP 1 Score: 221.09 bits (562), Expect = 2.233e-60
Identity = 123/290 (42.41%), Postives = 175/290 (60.34%), Query Frame = 1
Query:  223 GKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKR-LCVNNRIDLKVCKREITIMSS-LTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERN--NYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPI 1077
            G   ++    V +E+ IAEGGF +V+    + ++ FALKR    +N   L+ C RE + +   + HKNI+  +DS  N   N I+E ++L  Y  KNV  LM  +   NQ+L+ + I+ I  D+ EAV+ +H    P+IHRDLKVEN+LI      +YVLCDFGSAT + +   +YG+   + E+ + TT+ YRSPEM+   S + I  KSDIWALG LLY LC+F +PF +  LAIQS  +  P +  +  D+I  LI  +L ++   RPSIYQ SVLAF  AN + P+
Sbjct:   37 GVTLKLDHTRVTIEKQIAEGGFAIVYVASDRKNNKFALKRQFTKDNEKQLEACCREHSFLKQCIGHKNIVEFVDSYTNCLGNGIWECMLLTEYHQKNVLQLMNERISQNQYLTNDEILSIFTDLCEAVSFIHNRPQPIIHRDLKVENVLISSHKPPHYVLCDFGSATTQILSVEKYGVEYVKSEVERNTTMCYRSPEMIDFYSGLEIGLKSDIWALGVLLYRLCFFCVPFEESPLAIQSVNYQFPSVPNI-PDEIKVLIYMLLDIDVNRRPSIYQTSVLAFE-ANHRKPL 324          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: sel-5 (Serine/threonine-protein kinase sel-5 [Source:UniProtKB/Swiss-Prot;Acc:G5ECQ3])

HSP 1 Score: 221.09 bits (562), Expect = 2.233e-60
Identity = 123/290 (42.41%), Postives = 175/290 (60.34%), Query Frame = 1
Query:  223 GKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKR-LCVNNRIDLKVCKREITIMSS-LTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERN--NYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPI 1077
            G   ++    V +E+ IAEGGF +V+    + ++ FALKR    +N   L+ C RE + +   + HKNI+  +DS  N   N I+E ++L  Y  KNV  LM  +   NQ+L+ + I+ I  D+ EAV+ +H    P+IHRDLKVEN+LI      +YVLCDFGSAT + +   +YG+   + E+ + TT+ YRSPEM+   S + I  KSDIWALG LLY LC+F +PF +  LAIQS  +  P +  +  D+I  LI  +L ++   RPSIYQ SVLAF  AN + P+
Sbjct:   37 GVTLKLDHTRVTIEKQIAEGGFAIVYVASDRKNNKFALKRQFTKDNEKQLEACCREHSFLKQCIGHKNIVEFVDSYTNCLGNGIWECMLLTEYHQKNVLQLMNERISQNQYLTNDEILSIFTDLCEAVSFIHNRPQPIIHRDLKVENVLISSHKPPHYVLCDFGSATTQILSVEKYGVEYVKSEVERNTTMCYRSPEMIDFYSGLEIGLKSDIWALGVLLYRLCFFCVPFEESPLAIQSVNYQFPSVPNI-PDEIKVLIYMLLDIDVNRRPSIYQTSVLAFE-ANHRKPL 324          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gakh-1 (GAK Homolog [Source:UniProtKB/TrEMBL;Acc:Q20483])

HSP 1 Score: 130.183 bits (326), Expect = 2.096e-31
Identity = 89/273 (32.60%), Postives = 139/273 (50.92%), Query Frame = 1
Query:  223 GKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLTHKNILSLIDSQINEQQND--IFEVLMLLAYCPKNVAH-LMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGK---TEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTI-PKIDVVYSDKILKLIQYMLTVNPADR 1017
            G+ F I      VE++IA+GGFG VF   +      A+K +  ++    K    EI +M  L H+NI+ L D+    + ++  + E  + + YC  ++A  L+K K+     +S + +++I+     A+  LH      IHRD+K EN+LI+      LCDFGSAT + I        +    +EE+ KYTT   RSPE+  + S+  I  + D WA+GCL+Y++ +   PF    LAI +GK+   P +          LI   LT NP +R
Sbjct:   29 GQTFSINGNNYRVEKVIAKGGFGTVFLATNTKGKQVAVKIMLSHDAAATKDIDNEIDMMKKLQHENIIQLFDASAESRSSNRSVKEYKISMEYCKFSIADVLLKYKE-----VSIDFVVRIIYFTTRALVYLHSVG--AIHRDIKAENLLINGNGKLKLCDFGSATTKSIEMAPLSNSERLAVQEEMFKYTTPITRSPEVCDVYSNWPIGKQQDNWAMGCLIYFVAFGEHPFDGSALAIINGKYKKPPPVQQNQLSAFADLIAKCLTPNPDER 294          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-82 (pep chromosome:WBcel235:IV:7424498:7444660:1 gene:WBGene00006814.1 transcript:B0496.3e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-82)

HSP 1 Score: 98.2117 bits (243), Expect = 1.199e-20
Identity = 83/273 (30.40%), Postives = 127/273 (46.52%), Query Frame = 1
Query:  265 EIIAEGGFGLVFKVRSQTDHIFA-------LKRLCVNNRIDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSA---TARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDIINCKSDIWALGCLLYYLCYFTLPFADR-----VLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVS 1038
            EI  + G G   KV    DH F        +K+  + ++ DL   +REI IMS+L H NI+     QI E   +  ++++++ Y      +   S+      L E    +I   I  AV   H  +  V HRDLK+ENIL+D+ NN  + DFG +     + ++ T  G            +  Y SPE++  G+     + D W+LG LLY L Y ++PF  R     V  I+ G +  P+     S     LI+ ML VNP  R +I+ ++
Sbjct:  298 EITKKLGSGTYGKVSLAYDHKFDREVAVKLIKKSAIESKADLVRIRREIRIMSALNHPNII-----QIYEVFENKDKIILVMEYSSGGELYDYVSR---CGSLPEAEARRIFRQITSAVLYCHKHR--VAHRDLKLENILLDQNNNAKIADFGLSNYFADKNLLTTFCG------------SPLYASPEIIN-GTPYKGPEVDCWSLGILLYTLVYGSMPFDGRDFNRMVRQIKRGAYFEPETPSTAS----MLIRNMLRVNPERRATIFDIA 543          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Nak (gene:FBgn0015772 transcript:FBtr0081189)

HSP 1 Score: 320.857 bits (821), Expect = 9.955e-99
Identity = 156/311 (50.16%), Postives = 213/311 (68.49%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVR-----SQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            F+GK F +GR  V VE+++AEGGF +VF  R     S +   +ALKR+ VNN  DL V KREI I S+L+ HKNI+  +DS I    N + EVL+L+ YC  ++  +M ++  V    +E  ++ I CDI EAV+RLHYCQTP+IHRDLKVENIL  +  N+VLCDFGSATA+ + P ++G+   +EEI KYTTL+YR+PEM+ L G   I  K+DIWALGC+LY LC+F+LPF +  LAIQ+G+F+IP     YS  + +LI+YML  +   RP+I+QV  +AF +A   NP+QNL K  +P +D L +P
Sbjct:   34 FVGKVFTVGRVTVTVEDVLAEGGFAMVFLARGNGGGSSSATKYALKRMYVNNEHDLNVAKREIQIASNLSGHKNIIGYVDSSITPTGNGVCEVLLLMPYCKHHMLAMMNARLHVG--FTEPEVLNIFCDIAEAVSRLHYCQTPIIHRDLKVENILQTDAGNFVLCDFGSATAKTLNPQQHGVTVVQEEIQKYTTLSYRAPEMIDLYGGKSITTKADIWALGCMLYKLCFFSLPFGESTLAIQNGQFSIPD-SSKYSKGMHQLIKYMLEPDMEKRPNIWQVCEVAFRLAGKDNPVQNLHKTPIPNFDLLVVP 341          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Nak (gene:FBgn0015772 transcript:FBtr0340326)

HSP 1 Score: 320.472 bits (820), Expect = 1.885e-98
Identity = 156/311 (50.16%), Postives = 213/311 (68.49%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVR-----SQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            F+GK F +GR  V VE+++AEGGF +VF  R     S +   +ALKR+ VNN  DL V KREI I S+L+ HKNI+  +DS I    N + EVL+L+ YC  ++  +M ++  V    +E  ++ I CDI EAV+RLHYCQTP+IHRDLKVENIL  +  N+VLCDFGSATA+ + P ++G+   +EEI KYTTL+YR+PEM+ L G   I  K+DIWALGC+LY LC+F+LPF +  LAIQ+G+F+IP     YS  + +LI+YML  +   RP+I+QV  +AF +A   NP+QNL K  +P +D L +P
Sbjct:   34 FVGKVFTVGRVTVTVEDVLAEGGFAMVFLARGNGGGSSSATKYALKRMYVNNEHDLNVAKREIQIASNLSGHKNIIGYVDSSITPTGNGVCEVLLLMPYCKHHMLAMMNARLHVG--FTEPEVLNIFCDIAEAVSRLHYCQTPIIHRDLKVENILQTDAGNFVLCDFGSATAKTLNPQQHGVTVVQEEIQKYTTLSYRAPEMIDLYGGKSITTKADIWALGCMLYKLCFFSLPFGESTLAIQNGQFSIPD-SSKYSKGMHQLIKYMLEPDMEKRPNIWQVCEVAFRLAGKDNPVQNLHKTPIPNFDLLVVP 341          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Nak (gene:FBgn0015772 transcript:FBtr0081187)

HSP 1 Score: 322.013 bits (824), Expect = 3.012e-94
Identity = 156/311 (50.16%), Postives = 213/311 (68.49%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVR-----SQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            F+GK F +GR  V VE+++AEGGF +VF  R     S +   +ALKR+ VNN  DL V KREI I S+L+ HKNI+  +DS I    N + EVL+L+ YC  ++  +M ++  V    +E  ++ I CDI EAV+RLHYCQTP+IHRDLKVENIL  +  N+VLCDFGSATA+ + P ++G+   +EEI KYTTL+YR+PEM+ L G   I  K+DIWALGC+LY LC+F+LPF +  LAIQ+G+F+IP     YS  + +LI+YML  +   RP+I+QV  +AF +A   NP+QNL K  +P +D L +P
Sbjct:   34 FVGKVFTVGRVTVTVEDVLAEGGFAMVFLARGNGGGSSSATKYALKRMYVNNEHDLNVAKREIQIASNLSGHKNIIGYVDSSITPTGNGVCEVLLLMPYCKHHMLAMMNARLHVG--FTEPEVLNIFCDIAEAVSRLHYCQTPIIHRDLKVENILQTDAGNFVLCDFGSATAKTLNPQQHGVTVVQEEIQKYTTLSYRAPEMIDLYGGKSITTKADIWALGCMLYKLCFFSLPFGESTLAIQNGQFSIPD-SSKYSKGMHQLIKYMLEPDMEKRPNIWQVCEVAFRLAGKDNPVQNLHKTPIPNFDLLVVP 341          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Nak (gene:FBgn0015772 transcript:FBtr0340325)

HSP 1 Score: 322.013 bits (824), Expect = 3.012e-94
Identity = 156/311 (50.16%), Postives = 213/311 (68.49%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVR-----SQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            F+GK F +GR  V VE+++AEGGF +VF  R     S +   +ALKR+ VNN  DL V KREI I S+L+ HKNI+  +DS I    N + EVL+L+ YC  ++  +M ++  V    +E  ++ I CDI EAV+RLHYCQTP+IHRDLKVENIL  +  N+VLCDFGSATA+ + P ++G+   +EEI KYTTL+YR+PEM+ L G   I  K+DIWALGC+LY LC+F+LPF +  LAIQ+G+F+IP     YS  + +LI+YML  +   RP+I+QV  +AF +A   NP+QNL K  +P +D L +P
Sbjct:   34 FVGKVFTVGRVTVTVEDVLAEGGFAMVFLARGNGGGSSSATKYALKRMYVNNEHDLNVAKREIQIASNLSGHKNIIGYVDSSITPTGNGVCEVLLLMPYCKHHMLAMMNARLHVG--FTEPEVLNIFCDIAEAVSRLHYCQTPIIHRDLKVENILQTDAGNFVLCDFGSATAKTLNPQQHGVTVVQEEIQKYTTLSYRAPEMIDLYGGKSITTKADIWALGCMLYKLCFFSLPFGESTLAIQNGQFSIPD-SSKYSKGMHQLIKYMLEPDMEKRPNIWQVCEVAFRLAGKDNPVQNLHKTPIPNFDLLVVP 341          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CG1227 (gene:FBgn0037491 transcript:FBtr0339736)

HSP 1 Score: 125.946 bits (315), Expect = 1.972e-31
Identity = 78/275 (28.36%), Postives = 148/275 (53.82%), Query Frame = 1
Query:  259 VEEIIAEGGFGLV-FKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEV-----LMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQ-TPVIHRDLKVENILIDERNNYVLCDFGSAT-ARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPF------ADRV-LAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQV 1035
            + E +A GGF L+     + T   +A+KR+  ++  D  +  REI     +  +N++ ++D ++  Q + +        ++L  Y   ++A  ++ + +   H+ E  I++I   + E +  +H     P+ HRDLK  NI + +    ++ D GS T AR  I  +    + ++E  + +++ YR+PE+  + +   I+ ++DIW+LGC+LY +CYF  P+       D V LA+ SG   IP+ D +Y++ + +LI+YML  +P +RP ++ V
Sbjct:   32 IRERLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNIALREIENCRKIDSENVIRVVDYELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGDSVALAVLSGNINIPE-DSIYTEDMHELIKYMLRTDPMERPFVFSV 305          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: aak1a (AP2 associated kinase 1a [Source:ZFIN;Acc:ZDB-GENE-081105-101])

HSP 1 Score: 300.827 bits (769), Expect = 2.061e-92
Identity = 158/308 (51.30%), Postives = 203/308 (65.91%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            FIG+ F IGR+ V VEE +AEGGF +VF VR+      ALKR+ VNN  DL+VCK EI IM  L  +KNI+  +DS I      D++EVL+L+ +C    V +LM   Q++    SE+ +++I CD  EAVARLH C+ P+IHRDLKVENIL+ +R +YVLCDFGSA  R   P   G+   EEEI KYTTL+YR+PEMV L G  +I  K+DIWALGCLLY LCYFTLPF +  +AI  G FTIP  +  YS  +  LI+YML  +P  RP I+QVS  AF ++    P+QN+    +P   +LP P
Sbjct:   31 FIGRVFSIGRYQVTVEETVAEGGFAIVFLVRTHQGVRCALKRMYVNNEHDLQVCKMEIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFSESEVLQIFCDTCEAVARLHQCKPPIIHRDLKVENILLHDRGHYVLCDFGSAINRSQNPQTEGVAVVEEEIKKYTTLSYRAPEMVNLYGGMVITTKADIWALGCLLYKLCYFTLPFGESQVAICDGSFTIPD-NSRYSHDMHCLIRYMLEPDPDMRPDIFQVSYFAFKLSRRDCPVQNVHNSPIP--TKLPEP 333          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: aak1a (AP2 associated kinase 1a [Source:ZFIN;Acc:ZDB-GENE-081105-101])

HSP 1 Score: 304.294 bits (778), Expect = 7.098e-91
Identity = 158/308 (51.30%), Postives = 203/308 (65.91%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            FIG+ F IGR+ V VEE +AEGGF +VF VR+      ALKR+ VNN  DL+VCK EI IM  L  +KNI+  +DS I      D++EVL+L+ +C    V +LM   Q++    SE+ +++I CD  EAVARLH C+ P+IHRDLKVENIL+ +R +YVLCDFGSA  R   P   G+   EEEI KYTTL+YR+PEMV L G  +I  K+DIWALGCLLY LCYFTLPF +  +AI  G FTIP  +  YS  +  LI+YML  +P  RP I+QVS  AF ++    P+QN+    +P   +LP P
Sbjct:   31 FIGRVFSIGRYQVTVEETVAEGGFAIVFLVRTHQGVRCALKRMYVNNEHDLQVCKMEIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFSESEVLQIFCDTCEAVARLHQCKPPIIHRDLKVENILLHDRGHYVLCDFGSAINRSQNPQTEGVAVVEEEIKKYTTLSYRAPEMVNLYGGMVITTKADIWALGCLLYKLCYFTLPFGESQVAICDGSFTIPD-NSRYSHDMHCLIRYMLEPDPDMRPDIFQVSYFAFKLSRRDCPVQNVHNSPIP--TKLPEP 333          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: bmp2k (BMP2 inducible kinase [Source:ZFIN;Acc:ZDB-GENE-041212-72])

HSP 1 Score: 296.204 bits (757), Expect = 8.224e-90
Identity = 151/316 (47.78%), Postives = 208/316 (65.82%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAV 1158
            +IGK F +GR+ V VEE+IAEGGF +VF  R+ +    ALKR+ VNN  DL + +REITIM  L+ HKNI+  +DS  N   + ++EVL+L+ YC K    + +  Q+++   +E  ++ I CD  EAVARLH C+TP+IHRDLKVENIL++++ NYVLCDFGSAT + ++P + GI   E+EI KYTTL+YR+PEM+ L     I  K+DIWALGCLLY LC+FTLPF +  +AI  G F +P     +S K+  LI+YML  +   RP IYQVS  AF +A  + P+ NL    +P     P   S+   +K++
Sbjct:   28 YIGKVFAVGRYQVTVEELIAEGGFSMVFLARTHSGVRCALKRMYVNNVHDLNIFRREITIMKELSGHKNIVRYLDSTTNAVGDSVWEVLILMEYC-KAGQVVKQMNQRLHIGFTEAEVLNIFCDACEAVARLHQCKTPIIHRDLKVENILLNDQGNYVLCDFGSATHKVLLPHKDGITAVEDEIKKYTTLSYRAPEMINLYQGKAITTKADIWALGCLLYKLCFFTLPFGESQVAICDGTFAVPD-GSKFSSKLHGLIRYMLEPDQEKRPDIYQVSYFAFRLAGKECPVPNLFNSPLPTSLPEPFTASDIAAKKSL 341          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: bmp2k (BMP2 inducible kinase [Source:ZFIN;Acc:ZDB-GENE-041212-72])

HSP 1 Score: 296.204 bits (757), Expect = 8.726e-90
Identity = 151/316 (47.78%), Postives = 208/316 (65.82%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAV 1158
            +IGK F +GR+ V VEE+IAEGGF +VF  R+ +    ALKR+ VNN  DL + +REITIM  L+ HKNI+  +DS  N   + ++EVL+L+ YC K    + +  Q+++   +E  ++ I CD  EAVARLH C+TP+IHRDLKVENIL++++ NYVLCDFGSAT + ++P + GI   E+EI KYTTL+YR+PEM+ L     I  K+DIWALGCLLY LC+FTLPF +  +AI  G F +P     +S K+  LI+YML  +   RP IYQVS  AF +A  + P+ NL    +P     P   S+   +K++
Sbjct:   28 YIGKVFAVGRYQVTVEELIAEGGFSMVFLARTHSGVRCALKRMYVNNVHDLNIFRREITIMKELSGHKNIVRYLDSTTNAVGDSVWEVLILMEYC-KAGQVVKQMNQRLHIGFTEAEVLNIFCDACEAVARLHQCKTPIIHRDLKVENILLNDQGNYVLCDFGSATHKVLLPHKDGITAVEDEIKKYTTLSYRAPEMINLYQGKAITTKADIWALGCLLYKLCFFTLPFGESQVAICDGTFAVPD-GSKFSSKLHGLIRYMLEPDQEKRPDIYQVSYFAFRLAGKECPVPNLFNSPLPTSLPEPFTASDIAAKKSL 341          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: aak1b (AP2 associated kinase 1b [Source:ZFIN;Acc:ZDB-GENE-091118-25])

HSP 1 Score: 304.294 bits (778), Expect = 1.699e-89
Identity = 162/333 (48.65%), Postives = 210/333 (63.06%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKT 1203
            FIG+ F +GR  V VEE +AEGGF +VF VR+      ALKR+ VNN  DL+VCKREI IM  L  HKNI+  +DS I      D++EV +L+ +C    V +LM   Q++    SE   ++I CD  EAVARLH  +TP+IHRDLKVENIL+ +R +YVLCDFGSAT +   P   G+   E+EI KYTTL+YR+PEMV L    II  K+DIWA+GCLLY LC+FTLPF +  +AI  G FTIP  +  YS  + +LI+YML  +P  RP IYQVS  AF +A    P+QN+    +P     P+  S    +K+    K  +LT+  P T
Sbjct:   35 FIGRNFTVGRHQVTVEETLAEGGFAIVFLVRTNQGVRCALKRMYVNNEHDLQVCKREIQIMRDLNGHKNIVGFLDSSITAVGGGDVWEVFILMDFCRGGQVVNLMN--QRLQTGFSEQEALQIFCDTCEAVARLHQYKTPIIHRDLKVENILLHDRGHYVLCDFGSATMKFQNPQSEGVTAVEDEIKKYTTLSYRAPEMVNLYNGKIITTKADIWAMGCLLYKLCFFTLPFGESQVAICDGNFTIPD-NSRYSQDMHRLIRYMLEPDPDKRPDIYQVSFFAFKLARRDCPVQNVKNSPIPAKLPEPIRASEAAAKKSQTQTKA-RLTDPIPTT 363          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: aak1 (AP2 associated kinase 1 [Source:NCBI gene;Acc:100135375])

HSP 1 Score: 306.605 bits (784), Expect = 3.401e-94
Identity = 164/333 (49.25%), Postives = 216/333 (64.86%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSD-IINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKT 1203
            +IG+ F IGR  V V+E++AEGGF LVF VR+      ALKR+ VNN  DL+VCKREI IM  L+ HKNI+  IDS IN     D++EVL+L+ YC    V +LM   Q++    +E+ +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT +   P   G+   E+EI KYTTL+YR+PEMV L S  +I  K+DIWALGCLLY LC+FTLPF +  ++I  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  +F +A  + P+QN+    +P     P+       +K  P  +   LT+  P T
Sbjct:   30 YIGRVFTIGRHQVTVDEVLAEGGFALVFLVRTSNGMRRALKRMYVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINSVSSGDVWEVLILMDYCRGGQVVNLMN--QRLQTGFTESEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKCQNPQTEGVTAVEDEIKKYTTLSYRAPEMVNLYSGKMITTKADIWALGCLLYKLCFFTLPFGESQVSICDGNFTIPD-NSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLAKRECPVQNVHDAVIPVKLPEPIKAGEAAAKKTQPKAR---LTDPVPTT 356          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: aak1 (AP2 associated kinase 1 [Source:NCBI gene;Acc:100135375])

HSP 1 Score: 306.99 bits (785), Expect = 7.380e-94
Identity = 164/333 (49.25%), Postives = 216/333 (64.86%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSD-IINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKT 1203
            +IG+ F IGR  V V+E++AEGGF LVF VR+      ALKR+ VNN  DL+VCKREI IM  L+ HKNI+  IDS IN     D++EVL+L+ YC    V +LM   Q++    +E+ +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT +   P   G+   E+EI KYTTL+YR+PEMV L S  +I  K+DIWALGCLLY LC+FTLPF +  ++I  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  +F +A  + P+QN+    +P     P+       +K  P  +   LT+  P T
Sbjct:   30 YIGRVFTIGRHQVTVDEVLAEGGFALVFLVRTSNGMRRALKRMYVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINSVSSGDVWEVLILMDYCRGGQVVNLMN--QRLQTGFTESEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKCQNPQTEGVTAVEDEIKKYTTLSYRAPEMVNLYSGKMITTKADIWALGCLLYKLCFFTLPFGESQVSICDGNFTIPD-NSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLAKRECPVQNVHDAVIPVKLPEPIKAGEAAAKKTQPKAR---LTDPVPTT 356          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: aak1 (AP2 associated kinase 1 [Source:NCBI gene;Acc:100135375])

HSP 1 Score: 308.145 bits (788), Expect = 3.352e-92
Identity = 164/333 (49.25%), Postives = 216/333 (64.86%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSD-IINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKT 1203
            +IG+ F IGR  V V+E++AEGGF LVF VR+      ALKR+ VNN  DL+VCKREI IM  L+ HKNI+  IDS IN     D++EVL+L+ YC    V +LM   Q++    +E+ +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT +   P   G+   E+EI KYTTL+YR+PEMV L S  +I  K+DIWALGCLLY LC+FTLPF +  ++I  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  +F +A  + P+QN+    +P     P+       +K  P  +   LT+  P T
Sbjct:   30 YIGRVFTIGRHQVTVDEVLAEGGFALVFLVRTSNGMRRALKRMYVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINSVSSGDVWEVLILMDYCRGGQVVNLMN--QRLQTGFTESEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKCQNPQTEGVTAVEDEIKKYTTLSYRAPEMVNLYSGKMITTKADIWALGCLLYKLCFFTLPFGESQVSICDGNFTIPD-NSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLAKRECPVQNVHDAVIPVKLPEPIKAGEAAAKKTQPKAR---LTDPVPTT 356          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: aak1 (AP2 associated kinase 1 [Source:NCBI gene;Acc:100135375])

HSP 1 Score: 309.686 bits (792), Expect = 3.499e-91
Identity = 164/333 (49.25%), Postives = 216/333 (64.86%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSD-IINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKT 1203
            +IG+ F IGR  V V+E++AEGGF LVF VR+      ALKR+ VNN  DL+VCKREI IM  L+ HKNI+  IDS IN     D++EVL+L+ YC    V +LM   Q++    +E+ +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT +   P   G+   E+EI KYTTL+YR+PEMV L S  +I  K+DIWALGCLLY LC+FTLPF +  ++I  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  +F +A  + P+QN+    +P     P+       +K  P  +   LT+  P T
Sbjct:   30 YIGRVFTIGRHQVTVDEVLAEGGFALVFLVRTSNGMRRALKRMYVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINSVSSGDVWEVLILMDYCRGGQVVNLMN--QRLQTGFTESEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKCQNPQTEGVTAVEDEIKKYTTLSYRAPEMVNLYSGKMITTKADIWALGCLLYKLCFFTLPFGESQVSICDGNFTIPD-NSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLAKRECPVQNVHDAVIPVKLPEPIKAGEAAAKKTQPKAR---LTDPVPTT 356          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:Xenbase;Acc:XB-GENE-946051])

HSP 1 Score: 292.738 bits (748), Expect = 6.683e-91
Identity = 156/315 (49.52%), Postives = 206/315 (65.40%), Query Frame = 1
Query:  220 IGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINEQQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKA 1155
            +G+ F IGR  V VEE++AEGGF  VF VR+      ALKR+ VNN  DL +CKREITIM  L+ HKNI+  +D  IN   N+++EVL+L+ YC    V + M   Q++    +E  I++I CD  EAVARLH C+TP++HRDLKVENIL+++  NYVLCDFGS+T R + P + G+   EEEI KYTTL+YR+PEM+ L G   I  K+DIWALGCLLY LC+FTLPF +  +AI  G FTIP  +  Y+ K+  LI+YML  +   RP IYQVS  AF +A    P+ N+    +P     P+  S    +K+
Sbjct:   30 VGRCFCIGRNQVTVEELLAEGGFSTVFLVRTHGGIRCALKRMYVNNVSDLNICKREITIMKELSGHKNIVGYLDCVINSAGNNVWEVLILMEYCRAGQVVNQMN--QRLQSGFTEPEILRIFCDTCEAVARLHQCKTPIVHRDLKVENILLNDNGNYVLCDFGSSTNRILNPQKDGVNIVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPD-NSRYNHKLHCLIRYMLEPDQDKRPDIYQVSYFAFKLAKRDCPLPNIYNSPIPHVLPEPMTASEAASKKS 341          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Aak1 (AP2 associated kinase 1 [Source:MGI Symbol;Acc:MGI:1098687])

HSP 1 Score: 310.457 bits (794), Expect = 6.838e-93
Identity = 175/367 (47.68%), Postives = 226/367 (61.58%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSD-IINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKTLLXXXXXXXXXXXXXXXXXXXXXXPRIRPRANKT 1305
            +IG+ F IGR  V V+E++AEGGF LVF VR+      ALKR+ VNN  DL+VCKREI IM  L+ HKNI+  IDS IN     D++EVL+L+ +C    V +LM   Q++    +EN +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT +   P   G+   E+EI KYTTL+YR+PEMV L S  II  K+DIWALGCLLY LCYFTLPF +  +AI  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  +F +   + P+ N+    +P     P+  S    +K  P  +   LT+  P T                    TSI PR RP+A +T
Sbjct:   34 YIGRVFGIGRQQVTVDEVLAEGGFALVFLVRTSNGVKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQAEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGSFTIPD-NSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPVPNVQNSPIPAKLPEPVKASEAAVKKTQPKAR---LTDPIPTT-------------------ETSIAPRQRPKAGQT 375          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Aak1 (AP2 associated kinase 1 [Source:MGI Symbol;Acc:MGI:1098687])

HSP 1 Score: 310.457 bits (794), Expect = 2.906e-92
Identity = 175/367 (47.68%), Postives = 226/367 (61.58%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSD-IINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKTLLXXXXXXXXXXXXXXXXXXXXXXPRIRPRANKT 1305
            +IG+ F IGR  V V+E++AEGGF LVF VR+      ALKR+ VNN  DL+VCKREI IM  L+ HKNI+  IDS IN     D++EVL+L+ +C    V +LM   Q++    +EN +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT +   P   G+   E+EI KYTTL+YR+PEMV L S  II  K+DIWALGCLLY LCYFTLPF +  +AI  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  +F +   + P+ N+    +P     P+  S    +K  P  +   LT+  P T                    TSI PR RP+A +T
Sbjct:   34 YIGRVFGIGRQQVTVDEVLAEGGFALVFLVRTSNGVKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQAEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGSFTIPD-NSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPVPNVQNSPIPAKLPEPVKASEAAVKKTQPKAR---LTDPIPTT-------------------ETSIAPRQRPKAGQT 375          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Bmp2k (BMP2 inducible kinase [Source:MGI Symbol;Acc:MGI:2155456])

HSP 1 Score: 295.819 bits (756), Expect = 1.447e-89
Identity = 150/311 (48.23%), Postives = 205/311 (65.92%), Query Frame = 1
Query:  232 FQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINEQQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKA 1155
            F +GR+ V +EE +AEGGF  VF VR+ +    ALKR+ VNN  DL +CKREITIM  L+ HKNI+  +D  +N   ++++EVL+L+ YC    V + M   +K+    +E+ +++I CD  EAVARLH C+TP+IHRDLKVENIL+++  NYVLCDFGSAT + + P + G+   EEEI KYTTL+YR+PEM+ L G   I  K+DIWALGCLLY LC+FTLPF +  +AI  G FTIP  +  YS  +  LI++ML  +P  RP I+QVS  AF  A    P+ N++   +P     P+  +    RK+
Sbjct:   41 FAVGRYQVTLEESLAEGGFSTVFLVRTHSGIRCALKRMYVNNTPDLNICKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMN--KKLQTGFTESEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDAGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPD-NSRYSHNVHCLIRFMLEPDPECRPDIFQVSYFAFKFAKKDCPVSNINNSFLPSTLPEPMTATEAAARKS 348          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Bmp2k (BMP2 inducible kinase [Source:MGI Symbol;Acc:MGI:2155456])

HSP 1 Score: 298.13 bits (762), Expect = 9.339e-87
Identity = 150/311 (48.23%), Postives = 205/311 (65.92%), Query Frame = 1
Query:  232 FQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINEQQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKA 1155
            F +GR+ V +EE +AEGGF  VF VR+ +    ALKR+ VNN  DL +CKREITIM  L+ HKNI+  +D  +N   ++++EVL+L+ YC    V + M   +K+    +E+ +++I CD  EAVARLH C+TP+IHRDLKVENIL+++  NYVLCDFGSAT + + P + G+   EEEI KYTTL+YR+PEM+ L G   I  K+DIWALGCLLY LC+FTLPF +  +AI  G FTIP  +  YS  +  LI++ML  +P  RP I+QVS  AF  A    P+ N++   +P     P+  +    RK+
Sbjct:   41 FAVGRYQVTLEESLAEGGFSTVFLVRTHSGIRCALKRMYVNNTPDLNICKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMN--KKLQTGFTESEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDAGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPD-NSRYSHNVHCLIRFMLEPDPECRPDIFQVSYFAFKFAKKDCPVSNINNSFLPSTLPEPMTATEAAARKS 348          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Gak (cyclin G associated kinase [Source:MGI Symbol;Acc:MGI:2442153])

HSP 1 Score: 165.622 bits (418), Expect = 1.020e-41
Identity = 111/307 (36.16%), Postives = 163/307 (53.09%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRS-QTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDS-QINEQQNDI--FEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGK-----TEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRV-LAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQV-----SVLAFSMANGKNPIQNL 1086
            F+G+  ++G   + V  ++AEGGF  V++ +   +   +ALKRL  N     +   +E+  +  L+ H NI+    +  I ++++D    E L+L   C   +   +K + +    LS + I+KI      AV  +H  + P+IHRDLKVEN+L+  +    LCDFGSAT     P +Y          EEEI++ TT  YR+PE+V L S+  I  K DIWALGC+LY LC+   PF D   L I +GK++IP  D  Y+     LI+ ML VNP +R SI +V      + A    N K PI  L
Sbjct:   28 FVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSGREYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLK-RVECKGPLSCDSILKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYP-DYSWSAQKRAMVEEEITRNTTPMYRTPEIVDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPVNDTRYT-VFHDLIRAMLKVNPEERLSIAEVVRQLQEIAAARNVNPKAPITEL 331          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2M2I8|AAK1_HUMAN (AP2-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=AAK1 PE=1 SV=3)

HSP 1 Score: 311.227 bits (796), Expect = 8.133e-92
Identity = 175/367 (47.68%), Postives = 226/367 (61.58%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSD-IINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKTLLXXXXXXXXXXXXXXXXXXXXXXPRIRPRANKT 1305
            +IG+ F IGR  V V+E++AEGGF +VF VR+      ALKR+ VNN  DL+VCKREI IM  L+ HKNI+  IDS IN     D++EVL+L+ +C    V +LM   Q++    +EN +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT +   P   G+   E+EI KYTTL+YR+PEMV L S  II  K+DIWALGCLLY LCYFTLPF +  +AI  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  +F +   + PI N+    +P     P+  S    +K  P  +   LT+  P T                    TSI PR RP+A +T
Sbjct:   34 YIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPD-NSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKAR---LTDPIPTT-------------------ETSIAPRQRPKAGQT 375          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|F1MH24|AAK1_BOVIN (AP2-associated protein kinase 1 OS=Bos taurus OX=9913 GN=AAK1 PE=1 SV=2)

HSP 1 Score: 310.842 bits (795), Expect = 1.255e-91
Identity = 174/367 (47.41%), Postives = 226/367 (61.58%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSD-IINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKTLLXXXXXXXXXXXXXXXXXXXXXXPRIRPRANKT 1305
            +IG+ F IGR  V V+E++AEGGF +VF VR+      ALKR+ VNN  DL+VCKREI IM  L+ HKNI+  IDS IN     D++EVL+L+ +C    V +LM   Q++    +EN +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT +   P   G+   E+EI KYTTL+YR+PEMV L S  +I  K+DIWALGCLLY LCYFTLPF +  +AI  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  +F +   + PI N+    +P     P+  S    +K  P  +   LT+  P T                    TSI PR RP+A +T
Sbjct:   34 YIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINSVSSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKVITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPD-NSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPTKLPEPVKASEAAAKKTQPKAR---LTDPIPTT-------------------ETSIAPRQRPKAGQT 375          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3UHJ0|AAK1_MOUSE (AP2-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Aak1 PE=1 SV=2)

HSP 1 Score: 310.457 bits (794), Expect = 2.033e-91
Identity = 175/367 (47.68%), Postives = 226/367 (61.58%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSD-IINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKTLLXXXXXXXXXXXXXXXXXXXXXXPRIRPRANKT 1305
            +IG+ F IGR  V V+E++AEGGF LVF VR+      ALKR+ VNN  DL+VCKREI IM  L+ HKNI+  IDS IN     D++EVL+L+ +C    V +LM   Q++    +EN +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT +   P   G+   E+EI KYTTL+YR+PEMV L S  II  K+DIWALGCLLY LCYFTLPF +  +AI  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  +F +   + P+ N+    +P     P+  S    +K  P  +   LT+  P T                    TSI PR RP+A +T
Sbjct:   34 YIGRVFGIGRQQVTVDEVLAEGGFALVFLVRTSNGVKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQAEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGSFTIPD-NSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPVPNVQNSPIPAKLPEPVKASEAAVKKTQPKAR---LTDPIPTT-------------------ETSIAPRQRPKAGQT 375          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|F1SPM8|AAK1_PIG (AP2-associated protein kinase 1 OS=Sus scrofa OX=9823 GN=AAK1 PE=2 SV=2)

HSP 1 Score: 308.531 bits (789), Expect = 1.012e-90
Identity = 173/367 (47.14%), Postives = 226/367 (61.58%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSD-IINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKTLLXXXXXXXXXXXXXXXXXXXXXXPRIRPRANKT 1305
            +IG+ F IGR  V V+E++AEGGF +VF VR+      ALKR+ VNN  DL+VCKREI IM  L+ HKNI+  IDS IN     D++EVL+L+ +C    V +LM   Q++    +E+ +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT +   P   G+   E+EI KYTTL+YR+PEMV L S  II  K+DIWALGCLLY LCYFTLPF +  +AI  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  +F +   + P+ N+    +P     P+  S    +K  P  +   LT+  P T                    TSI PR RP+A +T
Sbjct:   34 YIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFTESEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPD-NSRYSQDMHCLIRYMLEPDPDKRPDIYQVSFFSFKLLKKECPVPNVQNSPIPAKLPEPVKASEAAAKKTQPKAR---LTDPIPTT-------------------ETSIAPRQRPKAGQT 375          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P0C1X8|AAK1_RAT (AP2-associated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Aak1 PE=1 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 7.414e-90
Identity = 175/367 (47.68%), Postives = 225/367 (61.31%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSD-IINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKTLLXXXXXXXXXXXXXXXXXXXXXXPRIRPRANKT 1305
            +IG+ F IGR  V V+E++AEGGF LVF VR+      ALKR+ VNN  DL+VCKREI IM  L+ HKNI+  IDS IN     D++EVL+L+ +C    V +LM   Q++    +EN +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT +   P   G+   E+EI KYTTL+YR+PEMV L S  II  K+DIWALGCLLY LCYFTLPF +  +AI  G FTIP  +  YS  +  LI YML  +P  RP IYQVS  +F +   + P+ N+    +P     P+  S    +K  P  +   LT+  P T                    TSI PR RP+A +T
Sbjct:   34 YIGRVFGIGRQQVTVDEVLAEGGFALVFLVRTSNGVKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQAEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGSFTIPD-NSRYSQDMHCLI-YMLEPDPDKRPDIYQVSYFSFKLLKKECPVPNVQNSPIPTKLPEPVKASEAAVKKTQPKAR---LTDPIPTT-------------------ETSIAPRQRPKAGQT 374          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A4S2L7X9 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009198 PE=4 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 8.710e-116
Identity = 172/305 (56.39%), Postives = 234/305 (76.72%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            F+G+ F+IG+  +VV+EIIAEGGFG+VF+VRSQ    +ALKR CVN+  ++ +CKREITI+SSL+HKNIL  IDS+IN  Q+ IFEVL+L AY P +++HL+  +Q+ +Q L+E  +++I CD+ EAV RLH+C+TP+IHRDLKVENILIDER N+VLCDFGSAT+R + P  +G+ + +EEI+KYTTLAYR+PEM+ L S++ +  + DIWALGCLLY LC+  LPF D  LAIQSG ++IP     YS+++ +LI Y+L ++ A RP I+QVS LAFS+    NP QNL+   VP W +L +P
Sbjct:   35 FLGRHFRIGKLSLVVDEIIAEGGFGVVFRVRSQQGQHYALKRTCVNSAQNMAICKREITIVSSLSHKNILRSIDSRINRIQDGIFEVLLLTAYYPGSLSHLLSERQQHHQRLTEVEVLRIFCDLCEAVCRLHHCKTPIIHRDLKVENILIDERQNFVLCDFGSATSRVLHPAVHGLERCQEEINKYTTLAYRAPEMINLYSNVPLGPQIDIWALGCLLYCLCFTALPFGDSALAIQSGIYSIPDTS-PYSERLHRLIGYLLQIDAAKRPDIFQVSALAFSLTARPNPAQNLNNLPVPHWQDLSIP 338          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A075A1S5 (Protein kinase domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_03885 PE=4 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 1.169e-115
Identity = 174/305 (57.05%), Postives = 233/305 (76.39%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            F+G+ F+IG+  +VV+EIIAEGGFG+VF+VRSQ    +ALKR CVN+  +L +CKREITI+SSL+HKNIL  IDS+IN  Q+ IFEVL+L AY P +++HL+  +Q+  Q L+E  +++I CD+ EAV RLH+C+TP+IHRDLKVENILIDER N+VLCDFGSAT+R + P  +G+ + +EEI+KYTTLAYR+PEM+ L S++ +  + DIWALGCLLY LC+  LPF D  LAIQSG ++IP     YS+++ +LI Y+L ++ A RP I+QVS LAFS+    NP QNL+   VP W +L LP
Sbjct:   35 FLGRHFRIGKLSLVVDEIIAEGGFGVVFRVRSQQGQYYALKRTCVNSAQNLAICKREITIVSSLSHKNILRSIDSRINRIQDGIFEVLLLTAYYPGSLSHLLSERQQHQQRLTEVEVLRIFCDLCEAVCRLHHCKTPIIHRDLKVENILIDERQNFVLCDFGSATSRVLHPAVHGLERCQEEINKYTTLAYRAPEMINLYSNVPLGPQIDIWALGCLLYCLCFTALPFGDSALAIQSGIYSIPDTS-PYSERLHRLIGYLLQIDAAKRPDIFQVSALAFSLTARPNPAQNLNNLPVPHWQDLSLP 338          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A3R7H2D9 (AP2-associated protein kinase 1 OS=Clonorchis sinensis OX=79923 GN=AAK1 PE=4 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 1.943e-115
Identity = 173/305 (56.72%), Postives = 233/305 (76.39%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            F+G+ F+IG+  +VV+EIIAEGGFG+VF+VRSQ    +ALKR CVN+  +L +CKREITI+SSL+HKNIL  IDS+IN  Q+ IFEVL+L AY P +++HL+  +Q+  Q L+E  +++I CD+ EAV RLH+C+TP+IHRDLKVENILIDER N+VLCDFGSAT+R + P  +G+ + +EEI+KYTTLAYR+PEM+ L S++ +  + DIWALGCLLY LC+  LPF D  LAIQSG ++IP     YS+++ +LI Y+L ++ A RP I+QVS LAFS+    NP QNL+   VP W +L +P
Sbjct:   35 FLGRHFRIGKLSLVVDEIIAEGGFGVVFRVRSQQGQYYALKRTCVNSAQNLAICKREITIVSSLSHKNILRSIDSRINRIQDGIFEVLLLTAYYPGSLSHLLSERQQHQQRLTEVEVLRIFCDLCEAVCRLHHCKTPIIHRDLKVENILIDERQNFVLCDFGSATSRVLHPAVHGLERCQEEINKYTTLAYRAPEMINLYSNVPLGPQIDIWALGCLLYCLCFTALPFGDSALAIQSGIYSIPDTS-PYSERLHRLIGYLLQIDAAKRPDIFQVSALAFSLTARPNPAQNLNNLPVPHWQDLSMP 338          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A4S2L9Y2 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009198 PE=4 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 3.493e-115
Identity = 172/305 (56.39%), Postives = 234/305 (76.72%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            F+G+ F+IG+  +VV+EIIAEGGFG+VF+VRSQ    +ALKR CVN+  ++ +CKREITI+SSL+HKNIL  IDS+IN  Q+ IFEVL+L AY P +++HL+  +Q+ +Q L+E  +++I CD+ EAV RLH+C+TP+IHRDLKVENILIDER N+VLCDFGSAT+R + P  +G+ + +EEI+KYTTLAYR+PEM+ L S++ +  + DIWALGCLLY LC+  LPF D  LAIQSG ++IP     YS+++ +LI Y+L ++ A RP I+QVS LAFS+    NP QNL+   VP W +L +P
Sbjct:   35 FLGRHFRIGKLSLVVDEIIAEGGFGVVFRVRSQQGQHYALKRTCVNSAQNMAICKREITIVSSLSHKNILRSIDSRINRIQDGIFEVLLLTAYYPGSLSHLLSERQQHHQRLTEVEVLRIFCDLCEAVCRLHHCKTPIIHRDLKVENILIDERQNFVLCDFGSATSRVLHPAVHGLERCQEEINKYTTLAYRAPEMINLYSNVPLGPQIDIWALGCLLYCLCFTALPFGDSALAIQSGIYSIPDTS-PYSERLHRLIGYLLQIDAAKRPDIFQVSALAFSLTARPNPAQNLNNLPVPHWQDLSIP 338          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1S8X9G1 (Kinase domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_00787 PE=4 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 1.035e-111
Identity = 174/321 (54.21%), Postives = 233/321 (72.59%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAE----------------GGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            F+G+ F+IG+  +VV+EIIAE                GGFG+VF+VRSQ    +ALKR CVN+  +L +CKREITI+SSL+HKNIL  IDS+IN  Q+ IFEVL+L AY P +++HL+  +Q+  Q L+E  +++I CD+ EAV RLH+C+TP+IHRDLKVENILIDER N+VLCDFGSAT+R + P  +G+ + +EEI+KYTTLAYR+PEM+ L S++ +  + DIWALGCLLY LC+  LPF D  LAIQSG ++IP     YS+++ +LI Y+L ++ A RP I+QVS LAFS+    NP QNL+   VP W +L LP
Sbjct:   35 FLGRHFRIGKLSLVVDEIIAEVPSFNSIYVRAVLSVTGGFGVVFRVRSQQGQYYALKRTCVNSAQNLAICKREITIVSSLSHKNILRSIDSRINRIQDGIFEVLLLTAYYPGSLSHLLSERQQHQQRLTEVEVLRIFCDLCEAVCRLHHCKTPIIHRDLKVENILIDERQNFVLCDFGSATSRVLHPAVHGLERCQEEINKYTTLAYRAPEMINLYSNVPLGPQIDIWALGCLLYCLCFTALPFGDSALAIQSGIYSIPDTS-PYSERLHRLIGYLLQIDAAKRPDIFQVSALAFSLTARPNPAQNLNNLPVPHWQDLSLP 354          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: aak1b (AP2 associated kinase 1b [Source:ZFIN;Acc:ZDB-GENE-091118-25])

HSP 1 Score: 296.204 bits (757), Expect = 3.845e-92
Identity = 161/333 (48.35%), Postives = 212/333 (63.66%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYCPKN-VAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKT 1203
            FIG+ F +GR  V VEE +AEGGF +VF VR+      ALKR+ VNN  DL+VC+REI IM  L+ HKNI+  +DS + +    D++EV +L+ +C    V +LM   Q++    SE  +++I CD  EAVA+LH C+TP+IHRDLKVENIL+ E+ +YVLCDFGSAT +   P   G+   EEEI KYTTL+YR+PEMV L    II  K+DIWALGCLLY LCYF+LPF +  +AI  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  A  +A    P+QN+    +P     P+  S    +K+    K  +LT+  P T
Sbjct:   34 FIGRNFTVGRHQVTVEETLAEGGFAIVFLVRTNQGVRCALKRMYVNNEYDLQVCRREIQIMRDLSGHKNIVGFLDSSVTQVGGGDVWEVFILMDFCKGGQVVNLMN--QRLQTGFSEAEVLQIFCDSCEAVAQLHQCKTPIIHRDLKVENILLHEKGHYVLCDFGSATKKFQNPQSEGVTIVEEEIKKYTTLSYRAPEMVNLYNGKIITTKADIWALGCLLYKLCYFSLPFGESQVAICDGNFTIPD-NSRYSHDMHCLIRYMLEPDPDKRPDIYQVSHFACRLARRDCPVQNVKNSPLPNKLPEPVRASEAAAKKSQTQTKA-RLTDPIPTT 362          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000003200.2 (AP2-associated protein kinase 1 [Source:NCBI gene;Acc:103021556])

HSP 1 Score: 305.064 bits (780), Expect = 1.579e-90
Identity = 161/308 (52.27%), Postives = 203/308 (65.91%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            FIG+ F IGR+ V V+E IAEGGF +VF VR+      ALKR+ VNN  DL+VCKREI IM  L  +KNI+  +DS I      D++EVL+L+ +C    V +LM   Q++    SE  +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT R   P   G    EEEI KYTTL+YR+PEMV L G  +I  K+DIWALGCLLY LC+FTLPF +  +AI  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  AF +A     +QN+    +P   +LP P
Sbjct:   34 FIGRVFTIGRYQVTVDETIAEGGFAIVFLVRTHQGVRCALKRMYVNNEHDLQVCKREIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFSEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNRFQNPQAEGAATVEEEIKKYTTLSYRAPEMVNLYGGKMITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPD-NSRYSQDMHCLIRYMLEPDPDIRPDIYQVSHFAFKLARKDCSVQNVHNSPIP--TKLPEP 336          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: bmp2k (BMP2 inducible kinase [Source:ZFIN;Acc:ZDB-GENE-041212-72])

HSP 1 Score: 297.36 bits (760), Expect = 2.774e-90
Identity = 154/316 (48.73%), Postives = 210/316 (66.46%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAV 1158
            FIG+ F IGR+ V V+E+IAEGGF +VF  R+ +    ALKR+ VNN  DL + KREITIM  L+ HKNI+S +DS IN   + ++EVL+L+ +C K    + +  Q+++   SE  ++ I CD  EAVARLH C+TPVIHRDLKVENIL++++ NYVLCDFGSAT + + P   G+   E+EI +YTTL+YR+PEM+ L     I  K+DIWALGCLLY LC+FTLPF +  +AI  G F++P     +S K+  LI+YML  +   RP IYQVS  AF +A  + P+ NL    +P     PL  S+   +K++
Sbjct:   30 FIGRVFAIGRYQVTVDELIAEGGFSMVFLARTHSGVRCALKRMYVNNVPDLNIFKREITIMKELSGHKNIVSYLDSTINAVGDSVWEVLILMEFC-KAGQVVKQMNQRLHVGFSEAEVLTIFCDTCEAVARLHQCKTPVIHRDLKVENILLNDQGNYVLCDFGSATHKVLHPLRDGVTAVEDEIKRYTTLSYRAPEMINLYQGKAITTKTDIWALGCLLYKLCFFTLPFGESQVAICDGIFSVPD-GSKFSSKLHCLIRYMLEPDQEKRPDIYQVSHFAFRLAGKECPVPNLFNSPIPTTLPEPLTASDIAAKKSL 343          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000054610.1 (AP2-associated protein kinase 1 [Source:NCBI gene;Acc:103021556])

HSP 1 Score: 305.449 bits (781), Expect = 1.335e-89
Identity = 161/308 (52.27%), Postives = 203/308 (65.91%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            FIG+ F IGR+ V V+E IAEGGF +VF VR+      ALKR+ VNN  DL+VCKREI IM  L  +KNI+  +DS I      D++EVL+L+ +C    V +LM   Q++    SE  +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT R   P   G    EEEI KYTTL+YR+PEMV L G  +I  K+DIWALGCLLY LC+FTLPF +  +AI  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  AF +A     +QN+    +P   +LP P
Sbjct:   34 FIGRVFTIGRYQVTVDETIAEGGFAIVFLVRTHQGVRCALKRMYVNNEHDLQVCKREIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFSEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNRFQNPQAEGAATVEEEIKKYTTLSYRAPEMVNLYGGKMITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPD-NSRYSQDMHCLIRYMLEPDPDIRPDIYQVSHFAFKLARKDCSVQNVHNSPIP--TKLPEP 336          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000030716.1 (AP2-associated protein kinase 1 [Source:NCBI gene;Acc:103021556])

HSP 1 Score: 305.449 bits (781), Expect = 2.176e-89
Identity = 161/308 (52.27%), Postives = 203/308 (65.91%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            FIG+ F IGR+ V V+E IAEGGF +VF VR+      ALKR+ VNN  DL+VCKREI IM  L  +KNI+  +DS I      D++EVL+L+ +C    V +LM   Q++    SE  +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT R   P   G    EEEI KYTTL+YR+PEMV L G  +I  K+DIWALGCLLY LC+FTLPF +  +AI  G FTIP  +  YS  +  LI+YML  +P  RP IYQVS  AF +A     +QN+    +P   +LP P
Sbjct:   34 FIGRVFTIGRYQVTVDETIAEGGFAIVFLVRTHQGVRCALKRMYVNNEHDLQVCKREIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFSEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNRFQNPQAEGAATVEEEIKKYTTLSYRAPEMVNLYGGKMITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPD-NSRYSQDMHCLIRYMLEPDPDIRPDIYQVSHFAFKLARKDCSVQNVHNSPIP--TKLPEP 336          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006448.1 (pep scaffold:Pmarinus_7.0:GL476771:264361:311032:-1 gene:ENSPMAG00000005802.1 transcript:ENSPMAT00000006448.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 303.138 bits (775), Expect = 2.016e-90
Identity = 157/316 (49.68%), Postives = 210/316 (66.46%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINEQ-QNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRK 1152
            F+G+ + +GR  V VEE++AEGGF +VF V++      ALKR+ VNN  DLKVC+REITIM  L+ HKNI+  +DS IN Q  + ++EVL+L+  C    V + M   Q+++   +E  +++I CD  EAVARLH C+TP+IHRDLKVENIL+ +  NYVLCDFGSAT + + P  +G+   E+EI KYTTL+YR+PEMV L +   I  KSDIWALGCLLY LC+FTLPF +  +AI  G FTIP     YS ++  LI+YML  +P  RP IYQV+  AF ++  + PI N++   +P     PL  S    RK
Sbjct:   33 FVGRVYAVGRHQVTVEEVLAEGGFAIVFLVKTSGGVRSALKRMYVNNEHDLKVCQREITIMKELSGHKNIVGYLDSSINAQTSSGVWEVLILMEICRAGQVVNQMN--QRLSTGFTECEVLRIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDNGNYVLCDFGSATNKILNPQAHGVSAVEDEIKKYTTLSYRAPEMVNLYNGTPITAKSDIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPD-HSRYSHEMHCLIRYMLEPDPDSRPEIYQVACFAFKLSGKECPILNVNGLSLPNKLPEPLKASEAAARK 345          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007073.1 (pep scaffold:Pmarinus_7.0:GL477321:233302:247915:1 gene:ENSPMAG00000006397.1 transcript:ENSPMAT00000007073.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 275.789 bits (704), Expect = 1.453e-84
Identity = 145/295 (49.15%), Postives = 189/295 (64.07%), Query Frame = 1
Query:  280 GGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINEQQ-NDIFEVLMLLAYCPKNVAHLM-KSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRK 1152
            GGF +VF  R+ +    ALKR+ VNN  DLKVCKREITIM  L+ HKNI+  +DS IN Q   +++EVL+L+ +C      ++ +  +++    SE  ++ I CD  EAVARLH C+TP+IHRDLKVENIL+ +  NYVLCDFGSAT + +     G+   EEEI KYTTL+YRSPEMV L S I I  K+DIWALGCLLY LC+F+LPF +  +AI  G FT+P  +  YS  +  LI+YML   P  RP I+QV+ + F +A    P+ NL    VP     PL  S    R+
Sbjct:    1 GGFSVVFLARTHSGIQCALKRMYVNNEHDLKVCKREITIMKELSGHKNIVGYLDSAINAQAATEVWEVLVLMEFCKGAAGQVVNQMNRRLQNGFSEREVLSIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDNGNYVLCDFGSATNKVLNTQVSGVPAVEEEIQKYTTLSYRSPEMVNLYSGIPITTKADIWALGCLLYKLCFFSLPFGESQVAICDGSFTVPD-NSKYSHDLHCLIRYMLEPEPDTRPDIFQVASVGFKLAKKDCPVPNLHSAPVPSRLPEPLLASEAAARR 294          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: stk16 (serine/threonine kinase 16 [Source:ZFIN;Acc:ZDB-GENE-050417-102])

HSP 1 Score: 100.138 bits (248), Expect = 2.168e-23
Identity = 82/266 (30.83%), Postives = 135/266 (50.75%), Query Frame = 1
Query:  265 EIIAEGGFGLVFKVR-SQTDHIFALKRLCVNNRIDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKV-NQH--LSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSA-TARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSD-IINCKSDIWALGCLLYYLCYFTLPF------ADRV-LAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPS 1023
            E + EGGF  V  V  +     +ALKR+  +++ D K   RE+ +  +  H N+L L  S++ E+     EV +LL Y  +    L    +K+ N+H  ++E  I+ I   I   +  +H       HRDLK  N+L+ + +  VL D GS   AR  I         +   +   T++YR+PE+  + S  II+ ++DIW+LGC+L+ + +   PF       D V LA+QS    +P     YS  + KL+  ++ V+P++RP+
Sbjct:   24 EQLGEGGFSYVDLVEGAHNGRFYALKRIVCHDKDDHKGALREVEMHRAFRHPNVLPLEGSRVVERGPKC-EVWLLLPYYQRGT--LWDELEKLRNKHSFMTEERIVGIFRGICSGLKDIH--DKGFAHRDLKPTNVLLSDEDVPVLMDLGSMEKARIEIKNSREAMALQVTRAVRCTISYRAPELFTVPSHCIIDARTDIWSLGCVLFAMMFLEGPFDGVFQRGDSVALAVQS-SVNVPS-SSRYSQPLRKLLTSLMDVDPSERPT 282          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: nek2 (NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-752])

HSP 1 Score: 100.908 bits (250), Expect = 7.470e-23
Identity = 74/226 (32.74%), Postives = 114/226 (50.44%), Query Frame = 1
Query:  385 EITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCP-KNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLH---YCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDIINCKSDIWALGCLLYYLCYFTLPFA---DRVLA--IQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQV 1035
            E+ ++  L H NI+   D  I+     ++   +++ YC   ++A L+   ++  + L E  ++++L  ++ A+   H        V+HRDLK  N+ +D R+N  L DFG A   +I+  +    KT        T  Y SPE  Q      N KSDIW+LGCLLY LC    PF     + LA  I+ GKF   +I   YSD++ ++I  ML +    RPSI Q+
Sbjct:   24 EVNLLRELKHPNIVRYFDRIIDRSNTTLY---IVMEYCECGDLASLISRCRRDRRFLEEEFVLRVLAQLVLALRECHRRTAGGRTVLHRDLKPANVFLDARHNVKLGDFGLA---RILQHDTSFAKT-----FVGTPYYMSPE--QFSRMSYNEKSDIWSLGCLLYELCALVPPFTAMNQKQLAEKIKEGKFR--RIPYRYSDELNEIISKMLNLKDYLRPSIEQI 234          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: STK36 (serine/threonine kinase 36 [Source:HGNC Symbol;Acc:HGNC:17209])

HSP 1 Score: 93.5893 bits (231), Expect = 7.881e-20
Identity = 71/216 (32.87%), Postives = 112/216 (51.85%), Query Frame = 1
Query:  259 VEEIIAEGGFGLVFKVRSQ-TDHIFALKRLCVNNRID--LKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDIINCKSDIWALGCLLYYLCYFTLPF 897
            V E+I EG FG V+K R + T  + ALK +    R D  L+  +REI IM  L H NI+ ++DS   ++     EV+++  Y    +  +++     + +L E  + +I C ++ A+  LH  +  ++HRD+K +NIL+ +     LCDFG A A  I         T    S   T  Y SPE+V+      +  +D+W++GC+LY L   T PF
Sbjct:    6 VLEMIGEGSFGKVYKGRKRYTGQVVALKFIPKVGRSDKELRNLRREIDIMRGLQHPNIVQMLDSFETDK-----EVVVVTDYAEGELFQILED----DGNLPEEQVREIACQLVSALYYLHSHR--ILHRDMKPQNILLGKGGVVKLCDFGFARAMSI--------NTLVLTSIKGTPLYMSPELVE--EKPYDHTADLWSMGCILYELFVGTPPF 200          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: AKL1 (Ser-Thr protein kinase; member (with Ark1p and Prk1p) of the Ark kinase family; involved in endocytosis and actin cytoskeleton organization [Source:SGD;Acc:S000000263])

HSP 1 Score: 164.081 bits (414), Expect = 2.624e-42
Identity = 106/287 (36.93%), Postives = 159/287 (55.40%), Query Frame = 1
Query:  238 IGRFIVVVEEIIAEGGFGLVFKVR-----SQTDH----------IFALKRLCVNNRIDLKVCKREITIMSSLTHK-NILSLIDSQINEQQNDI--FEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGS-ATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFA-DRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQV 1035
            +G   V V   +AEGGF  ++ V+     ++ D+          +  LKR+ V +   L   + E+ +M  L    NI+   DS  + +++ +  FEVL+L+  CP N + L    Q+++  L+E  I+KI+ D+  +++++HY    +IHRD+K+EN+L+D +NN+ L DFGS +T   I+ T   I    + I  +TT  YRSPEM+ L   + IN KSDIWALG  LY L +FT PF      AI   K+  P     YS K++ LI  ML  NP  RP+IYQV
Sbjct:   30 VGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCP-NKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK--YSSKLINLIIIMLAENPNLRPNIYQV 313          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: ARK1 (Serine/threonine protein kinase; involved in regulation of the cortical actin cytoskeleton; involved in control of endocytosis; ARK1 has a paralog, PRK1, that arose from the whole genome duplication [Source:SGD;Acc:S000004965])

HSP 1 Score: 158.688 bits (400), Expect = 2.996e-41
Identity = 103/308 (33.44%), Postives = 160/308 (51.95%), Query Frame = 1
Query:  220 IGKKFQIGRFIVVVEEIIAEGGFGLVFKVR------SQTDHIFALKRLCVNNRIDLKVCKREITIMSSL-THKNILSLIDSQINEQ--QNDIFEVLMLLAYCPKN-VAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIP-TEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRV-LAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVP 1104
            +G +  +G   V + + +  GGF  V+              +  LKR+ V ++  L   + E+  M  L  ++ ++S IDS   +    N  +EV +L+ YC +  +   M ++  +   L E  I++I+  + + VA +H  Q P+IHRD+K+EN+LI   N Y LCDFGS       P     +   +++I K TT  YRSPEM+     + I+ KSDIWALG  LY LCY+T PF     LAI SGKF  P +   YS+++  LI+ +L  +P  RP++YQ+      M N   PI ++   + P
Sbjct:   11 VGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTR--LQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFP-LYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAP 315          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: PRK1 (Protein serine/threonine kinase; regulates the organization and function of the actin cytoskeleton and reduces endocytic ability of cell through the phosphorylation of the Pan1p-Sla1p-End3p protein complex; PRK1 has a paralog, ARK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001357])

HSP 1 Score: 146.362 bits (368), Expect = 8.265e-37
Identity = 96/300 (32.00%), Postives = 150/300 (50.00%), Query Frame = 1
Query:  223 GKKFQIGRFIVVVEEIIAEGGFGLVFKVR------SQTDHIFALKRLCVNNRIDLKVCKREITIMSSL-THKNILSLIDSQINEQQNDI-FEVLMLLAYCPKN-VAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIP-TEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRVLA-IQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNL 1086
            G    +G     + + +  GGF  V+             +I  LKR+ V ++  L   + E+  M  L  +K+++S IDS      N I +EV +L+ +C +  +   M ++  +   L E+ I++I+   ++ +  +H  Q P+IHRD+K+EN+LI     Y +CDFGS +     P         + +I   TT  YRSPEM+ L   + I+ KSDIWALG  LY +CY+T PF     A I   ++  P     YSD++  LI+ ML   P+ RP+I QV      + N   PI+N 
Sbjct:   12 GTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIVPHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSVNGIAYEVFVLMEFCERGGLIDFMNTR--LQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILHARYQYPSFP-QYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQNKPCPIRNF 308          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 95.9005 bits (237), Expect = 6.753e-21
Identity = 85/308 (27.60%), Postives = 140/308 (45.45%), Query Frame = 1
Query:  223 GKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKR---EITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDIINCKSDIWALGCLLYYLCYFTLPFADRVL-----AIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELP 1122
            GK +  G F+        EGGF   F+++  +  IFA K +   +    K  K+   EI I  S++H NI+  ID        D   V +LL  CP      +  ++KV   L+E  +      I  A+  +H     VIHRDLK+ NI  D   N  + DFG A    ++  E     +E + +   T  Y +PE++       + + DIW+LG +LY L     PF  R +      I+   F+ P+ D   SD+   LI+ +L+++P +RPS+ ++    +        I +    + P ++++P
Sbjct:   79 GKDYHRGHFL-------GEGGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCF-----EDDSNVYILLEICPNGSLMELLKRRKV---LTEPEVRFFTTQICGAIKYMH--SRRVIHRDLKLGNIFFDSNYNLKIGDFGLAA---VLANE-----SERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPR-DKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEAPNFEDIP 360          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 85.5001 bits (210), Expect = 1.137e-17
Identity = 81/279 (29.03%), Postives = 130/279 (46.59%), Query Frame = 1
Query:  235 QIGRFIVVVEEIIAEGGFGLV-FKVRSQTDHIFALKRLCVNNRIDLKV-----CKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQT-PVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDIINCKSDIWALGCLLYYLCYFTLPFADRVLA-----IQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQV 1035
             IG + +V  + + EG FG V     + T    ALK   +N ++  K       +REI+ +  L H +I+ L D   ++      E++M++ Y    +   +  + K    +SE    +    II AV    YC    ++HRDLK EN+L+DE  N  + DFG +     I T+    KT        +  Y +PE++  G      + D+W+ G +LY +    LPF D  +      I +G +T+PK     S     LI+ ML VNP +R SI+++
Sbjct:   51 HIGNYQIV--KTLGEGSFGKVKLAYHTTTGQKVALK--IINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKD-----EIIMVIEYAGNELFDYIVQRDK----MSEQEARRFFQQIISAV---EYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSN----IMTDGNFLKT-----SCGSPNYAAPEVIS-GKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKF---LSPGAAGLIKRMLIVNPLNRISIHEI 300          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO39786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S938])

HSP 1 Score: 304.679 bits (779), Expect = 5.301e-97
Identity = 162/307 (52.77%), Postives = 206/307 (67.10%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINEQQNDIFEVLMLLAYCPKN-VAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSD-IINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            F+GK + IGRF   VEEIIAEGGF LVF V++      ALKR+ VNN  DL +CK+EI+IM  ++ HKN +  IDS+I +   DIFEVL+L+ YC +  V  LM   +++N   SE++++KI  D  EAVA LH    PVIHRDLKVENIL  +R ++VLCDFGSAT +   P   G+   EEEI KYTTL YR+PEMV L S  II+ KSDIWALGCLLY LC+FTLPF +  LAIQ+ +FT P+ +  YS  +  LI Y+L  +P  RP IYQVS  AF +     P+ N++K  VPQ+  LP P
Sbjct:   17 FVGKIYSIGRFHCTVEEIIAEGGFALVFLVKTPQGQRLALKRVSVNNSHDLDICKQEISIMKLVSGHKNTIRFIDSKILQTSPDIFEVLILMEYCKEGHVVQLMN--ERINTGFSESLVLKIFTDACEAVALLHQASPPVIHRDLKVENILCSDRRDFVLCDFGSATRKDTDPQADGVTHVEEEIQKYTTLPYRAPEMVDLYSGKIISTKSDIWALGCLLYKLCFFTLPFGESPLAIQNAQFTFPE-NSRYSKGLHSLISYILDPDPDTRPDIYQVSFEAFRLRGQDCPVLNVNKSSVPQF--LPEP 318          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO43926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX98])

HSP 1 Score: 163.696 bits (413), Expect = 4.067e-42
Identity = 102/284 (35.92%), Postives = 155/284 (54.58%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVR-SQTDHIFALKRLCVNNRIDLKVCKREITIMSSL-THKNILSLIDSQI---NEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIP----TEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRV-LAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQV 1035
            F+G+  ++G   + ++ +IAEGG+G VF  +  +T   +ALKRL   +    K   +EI ++  L  H N++    +      E  + + E L+L   C   V  + + +    Q  S + I++I   +  AV+ +H    P+IHRDLK+EN+LI  +    LCDFGSAT   + P    T       E+EI + TT  YR+PEMV L S++ +  K+DIWALGC+L+YLC+   PF D   L I + K+TIP++D  Y+     LI   L V+P DRP I  +
Sbjct:    3 FVGQFVELGPLELKIKRVIAEGGYGFVFVAQDGKTGKEYALKRLMAGDEAANKNILQEINMLKRLRGHPNVVQFYSAASLGEKESGHGMTEYLILTELCTGIVDRVYQVRD--GQPFSPDQILRIFYQLCRAVSHMHKQSPPIIHRDLKIENMLIGSKGQIKLCDFGSATTEPLTPDDSWTALNRSLAEDEIQRNTTPMYRAPEMVDLYSNLPVTEKADIWALGCVLFYLCFMEHPFEDSAKLRIINAKYTIPEMDREYT-MYHDLINSTLVVHPEDRPCIRDI 283          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO44518 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVW0])

HSP 1 Score: 100.908 bits (250), Expect = 4.532e-24
Identity = 71/216 (32.87%), Postives = 110/216 (50.93%), Query Frame = 1
Query:  241 GRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSAT-ARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCY 882
            GR   VV+++  EG F  V  VR Q    FALKRL +      +  +RE+    S+ H N++++ D +I  ++N     ++L  Y    V  L++      +H+ E  I+ +     EAV   H  Q P+ HRDLK  N+LI   N  ++ D GS T AR  I +       +E  +   T AYR+PE+ ++ S   I+  +D+W+LGC LY + Y
Sbjct:   17 GRSYRVVKDL-GEGAFSYVCLVR-QGRRQFALKRLRLQLPEQERAFEREVEAHRSIDHPNVMAMHDVEIVSKKNYKEARMLLDYYKEGTVQDLIERTHDRGRHIQELEILHMFRSACEAVMAFHDLQPPLAHRDLKPHNLLIGPNNTVIIFDLGSVTKARVSITSRREALALQERCACECTAAYRAPELFEVPSQCEIDEMTDVWSLGCTLYAMAY 230          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO37413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFU9])

HSP 1 Score: 98.9821 bits (245), Expect = 7.694e-23
Identity = 81/266 (30.45%), Postives = 133/266 (50.00%), Query Frame = 1
Query:  265 EIIAEGGFGLVFKVRSQTDH-IFALKRLCVN--NRIDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPK-NVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTP--VIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDIINCKSDIWALGCLLYYLCYFTLPFA--DRV---LAIQSGKFT-IPKIDVVYSDKILKLIQYMLTVNPADRPSI 1026
            E I  G +G+  K+R + D+ +   K L     +  + ++   E+ ++  L H +I+   D  I+     I+   +++ +C   ++  L+K  ++  ++ +E+++ K+L  ++ AV   H  +    V+HRDLK  N+ +D   N  L DFG A   +++  +    KT        T  Y SPE V   S   N KSDIW+LGCL+Y LC  + PF   D++     I+ G+F  IP     YS  + +LI  ML VN   RPSI
Sbjct:   13 ERIGSGSYGICKKIRRKKDNKVLVWKELDYGQMSETEKQMLVSEVNLLRELKHPHIVRYYDRIIDRTNTTIY---IVMEFCENGDLGALIKKHKREKRYTAEDLVWKLLYQLVLAVQECHRRKDGGHVLHRDLKPANVFLDANMNVKLGDFGLA---RVLSHDTSFAKT-----FVGTPYYMSPEQVNKRS--YNEKSDIWSLGCLMYELCALSPPFTAMDQIRLEAKIKVGRFHPIPS---HYSSSLSQLINSMLQVNDEMRPSI 262          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH03])

HSP 1 Score: 96.2857 bits (238), Expect = 3.361e-22
Identity = 90/273 (32.97%), Postives = 128/273 (46.89%), Query Frame = 1
Query:  265 EIIAEGGFGLVFKVRS-QTDHIFALKRLCVNN--RIDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSAT--------ARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDIINCKSDIWALGCLLYYLCYFTLPF-ADR----VLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQV 1035
            +II +G FG  + V S Q+  ++ALK L        D  +   E+ I+S+L H+NI+   D+    ++   F ++M   Y      H  K KQ V    SE  I+  L  ++ A+  +H     ++HRDLK +NI + + +   + DFG A         AR  + T Y                Y SPE+ Q      N KSDIWALGC+LY L   T PF AD     V+ I  G +  P I   Y   +  L+  ML +NPADRPS  Q+
Sbjct:    8 DIIGKGTFGSAWLVESRQSKRLYALKELNATAMPSEDRHLALNEVKILSTLKHRNIVRYRDA---FEETGRFYIVM--EYAEGGDLH-TKIKQAVEPFSSER-ILNWLAQLLLALKHIH--GQNILHRDLKTQNIFLTKDDVVKIGDFGIARILDSTCDHARTTVGTPY----------------YLSPEICQ--RQPYNNKSDIWALGCVLYELTTRTHPFTADNLTNLVVKILHGNY--PPIPRFYGPLLEDLVAVMLKINPADRPSAKQL 251          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: bmp2k (BMP2 inducible kinase [Source:NCBI gene;Acc:101161412])

HSP 1 Score: 305.449 bits (781), Expect = 1.030e-93
Identity = 154/314 (49.04%), Postives = 212/314 (67.52%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRK 1152
            F GK F +GR+ V VEE++AEGGF +VF  R+ +    ALKR+ VNN  DL VCKREITIM  L+ HKNI++ +DS I+   ++++EVL+L+ +C K    + +  Q++N   SE  ++ I CD  EAVARLH C+TP+IHRDLKVENIL++++ NYVLCDFGSAT + ++P + G+   E+EI KYTTL+YR+PEM+ L +   I  K+DIWALGCLLY LC+FTLPF +  +AI  G F +P  +  +S ++  LI+YML  +   RP IYQVS  AF +A  +NP+ NL    +P     PL  S    +K
Sbjct:   26 FFGKVFAVGRYQVTVEELVAEGGFSVVFMARTHSGVRCALKRMYVNNVQDLNVCKREITIMKELSGHKNIVTYLDSTISSFSDNVWEVLILMEFC-KAGQVVKQMNQRLNVGFSEAEVLHIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDQGNYVLCDFGSATHKVLLPHKDGVTAVEDEIKKYTTLSYRAPEMINLYAGTGITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFIVPD-NSKFSCRLHCLIRYMLEPDLEKRPDIYQVSHFAFKLAGRENPVPNLCSSAIPTSLPEPLTASEVAAKK 337          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: aak1a (AP2-associated protein kinase 1 [Source:NCBI gene;Acc:101173792])

HSP 1 Score: 301.212 bits (770), Expect = 5.373e-90
Identity = 164/308 (53.25%), Postives = 209/308 (67.86%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            FIG+ F IGR+ V VEEIIAEGGF +VF VR+   H  ALKR+ VNN  DL++CK EI IM  L  +KNI+  +DS I      D++EVL+L+ +C    V +LM   Q++    SE  +++I CD  EAVARLH+C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT R   P E G+   EEEI KYTTL+YR+PEMV L G + I  K+DIWALGCLLY LC+FTLPF +  +AI  G FTIP  +  YS ++  LI+YML  +P  RP IYQVS  AF +A  + P+ NL    +P   +LP P
Sbjct:   34 FIGRMFSIGRYQVTVEEIIAEGGFAIVFLVRTHQGHRCALKRMYVNNEHDLQICKLEIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFSEAEVLQIFCDTCEAVARLHHCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNRFQNPQEEGVAAVEEEIKKYTTLSYRAPEMVNLYGGEAITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPD-NSRYSQEMHCLIRYMLEPHPDIRPDIYQVSYFAFKLARRECPVPNLHNSPIPA--KLPEP 336          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: aak1a (AP2-associated protein kinase 1 [Source:NCBI gene;Acc:101173792])

HSP 1 Score: 301.212 bits (770), Expect = 5.373e-90
Identity = 164/308 (53.25%), Postives = 209/308 (67.86%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            FIG+ F IGR+ V VEEIIAEGGF +VF VR+   H  ALKR+ VNN  DL++CK EI IM  L  +KNI+  +DS I      D++EVL+L+ +C    V +LM   Q++    SE  +++I CD  EAVARLH+C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT R   P E G+   EEEI KYTTL+YR+PEMV L G + I  K+DIWALGCLLY LC+FTLPF +  +AI  G FTIP  +  YS ++  LI+YML  +P  RP IYQVS  AF +A  + P+ NL    +P   +LP P
Sbjct:   34 FIGRMFSIGRYQVTVEEIIAEGGFAIVFLVRTHQGHRCALKRMYVNNEHDLQICKLEIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFSEAEVLQIFCDTCEAVARLHHCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNRFQNPQEEGVAAVEEEIKKYTTLSYRAPEMVNLYGGEAITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPD-NSRYSQEMHCLIRYMLEPHPDIRPDIYQVSYFAFKLARRECPVPNLHNSPIPA--KLPEP 336          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: aak1a (AP2-associated protein kinase 1 [Source:NCBI gene;Acc:101173792])

HSP 1 Score: 302.753 bits (774), Expect = 1.707e-89
Identity = 164/308 (53.25%), Postives = 209/308 (67.86%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            FIG+ F IGR+ V VEEIIAEGGF +VF VR+   H  ALKR+ VNN  DL++CK EI IM  L  +KNI+  +DS I      D++EVL+L+ +C    V +LM   Q++    SE  +++I CD  EAVARLH+C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT R   P E G+   EEEI KYTTL+YR+PEMV L G + I  K+DIWALGCLLY LC+FTLPF +  +AI  G FTIP  +  YS ++  LI+YML  +P  RP IYQVS  AF +A  + P+ NL    +P   +LP P
Sbjct:   34 FIGRMFSIGRYQVTVEEIIAEGGFAIVFLVRTHQGHRCALKRMYVNNEHDLQICKLEIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFSEAEVLQIFCDTCEAVARLHHCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNRFQNPQEEGVAAVEEEIKKYTTLSYRAPEMVNLYGGEAITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPD-NSRYSQEMHCLIRYMLEPHPDIRPDIYQVSYFAFKLARRECPVPNLHNSPIPA--KLPEP 336          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: aak1a (AP2-associated protein kinase 1 [Source:NCBI gene;Acc:101173792])

HSP 1 Score: 302.753 bits (774), Expect = 1.851e-89
Identity = 164/308 (53.25%), Postives = 209/308 (67.86%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLT-HKNILSLIDSQINE-QQNDIFEVLMLLAYC-PKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL-GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            FIG+ F IGR+ V VEEIIAEGGF +VF VR+   H  ALKR+ VNN  DL++CK EI IM  L  +KNI+  +DS I      D++EVL+L+ +C    V +LM   Q++    SE  +++I CD  EAVARLH+C+TP+IHRDLKVENIL+ +R +YVLCDFGSAT R   P E G+   EEEI KYTTL+YR+PEMV L G + I  K+DIWALGCLLY LC+FTLPF +  +AI  G FTIP  +  YS ++  LI+YML  +P  RP IYQVS  AF +A  + P+ NL    +P   +LP P
Sbjct:   34 FIGRMFSIGRYQVTVEEIIAEGGFAIVFLVRTHQGHRCALKRMYVNNEHDLQICKLEIQIMRDLVGNKNIVGFLDSSITAVGSGDVWEVLILMDFCRGGQVVNLMN--QRLQTGFSEAEVLQIFCDTCEAVARLHHCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNRFQNPQEEGVAAVEEEIKKYTTLSYRAPEMVNLYGGEAITTKADIWALGCLLYKLCFFTLPFGESQVAICDGSFTIPD-NSRYSQEMHCLIRYMLEPHPDIRPDIYQVSYFAFKLARRECPVPNLHNSPIPA--KLPEP 336          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000071701.1 (SMESG000071701.1)

HSP 1 Score: 1057.36 bits (2733), Expect = 0.000e+0
Identity = 599/600 (99.83%), Postives = 600/600 (100.00%), Query Frame = 1
Query:   61 MKKLISKLKEVPDLESKHPWSSVPQNYSLSIHXXXXXXXXXXXXXXXXXXXXFIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKTLLXXXXXXXXXXXXXXXXXXXXXXPRIRPRANKTPLEKSDSADNEKSKEKSTPHXXXXXXXXXXXXXXKTNLPKPTSVKLYSAPPIPXXXXXXXXXXXTTVEVEVSNTLQNVPLKDELTVERNDSLRTRIGHRRMXXXXXXXXXXXXNMKPGKSLLELTRKYSIDQNHSLTDVDQVDNSNFQTVPIKISDDEMENDAMFGEEFDKIRHQSDTSGGVGGD 1860
            MKKLISKLKEVPDLESKHPWSSVPQNYSLSIHNDSANAINN+SNSSHNHLSNFIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKTLLSSNANKVKSVSNQSKSISTSINPRIRPRANKTPLEKSDSADNEKSKEKSTPHISQSNSFNISLSSIKTNLPKPTSVKLYSAPPIPQDNQNQSNSQDTTVEVEVSNTLQNVPLKDELTVERNDSLRTRIGHRRMVSESSSKSVVEENMKPGKSLLELTRKYSIDQNHSLTDVDQVDNSNFQTVPIKISDDEMENDAMFGEEFDKIRHQSDTSGGVGGD
Sbjct:    1 MKKLISKLKEVPDLESKHPWSSVPQNYSLSIHNDSANAINNVSNSSHNHLSNFIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPNSNHTPRKAVPHIKGDQLTNETPKTLLSSNANKVKSVSNQSKSISTSINPRIRPRANKTPLEKSDSADNEKSKEKSTPHISQSNSFNISLSSIKTNLPKPTSVKLYSAPPIPQDNQNQSNSQDTTVEVEVSNTLQNVPLKDELTVERNDSLRTRIGHRRMVSESSSKSVVEENMKPGKSLLELTRKYSIDQNHSLTDVDQVDNSNFQTVPIKISDDEMENDAMFGEEFDKIRHQSDTSGGVGGD 600          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000051989.1 (SMESG000051989.1)

HSP 1 Score: 266.929 bits (681), Expect = 1.810e-79
Identity = 138/297 (46.46%), Postives = 198/297 (66.67%), Query Frame = 1
Query:  253 VVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNRIDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLH-YCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQL----GSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLP 1128
            VV+++ IA+GG+G V+K  S     +ALK+LCVNN   L  C REI I+ ++  + IL  +DS I +  +DIFEV +L  + P N++  MK+    +Q  +E+ ++ I+ +I EAVA LH +  TP+IHRDLKVEN+LI     YVLCDFGSAT +++ P +      ++EIS++TTLAYRSPEM  L    G  +I  K+DIWALG L+Y +C+F+LPF D VL+I SG+FT+P     YSD +LK++ Y+LT  P  RP+IYQ++ + FSM +  NP+QN +K + P  + L LP
Sbjct:   39 VVIDDKIAQGGYGTVYKAHSFHKQ-YALKKLCVNNEDKLLNCIREIFILRNVHCEYILHFVDSIIYQTDSDIFEVFILTNFYPDNLSSEMKTMCSSSQCFTESDVLLIMTNISEAVACLHHFTSTPIIHRDLKVENVLIGYPMRYVLCDFGSATLKEVRPCDVNRQDLQDEISQFTTLAYRSPEMADLYYDGGEHVIGRKADIWALGVLMYNICFFSLPFGDSVLSILSGQFTVPD-HCPYSDDLLKVLNYILTPEPESRPNIYQLASVLFSMTSKSNPVQNCEKSREPDLNALNLP 333          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000081891.1 (SMESG000081891.1)

HSP 1 Score: 163.31 bits (412), Expect = 3.377e-41
Identity = 109/284 (38.38%), Postives = 152/284 (53.52%), Query Frame = 1
Query:  217 FIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRS-QTDHIFALKRLCVNNRIDLKVCKREITIMSSL-THKNILSLIDSQI--NEQQNDI-FEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIG----KTEEEISKYTTLAYRSPEMVQLGSDI-INCKSDIWALGCLLYYLCYFTLPFADRV-LAIQSGKFTIPKIDVVYSDKILKLIQYMLTVNPADRPSIYQV 1035
             +G   +IG     V   IAEGGF +VF+ +  +T+  FALKRL  +     K   +EI  +  L  H NI+ L  +     E+Q  +  + L+L   C  N   L +  QK N+ L  N+ ++I   +  A+  +H    P+IHRDLKVEN+LI+      LCDFGSAT     P     G    + +EEI K+TT  YR+PEM+ L  +  IN   DIWALGC+LYYLC+   PF D   LAI +  +TIP  +V  +D    LI  ML ++P  RP I ++
Sbjct:   24 LVGNCIEIGNQSFKVLHTIAEGGFSVVFEAQDVKTNKCFALKRLISHEADTNKEIMQEINFLKKLHGHPNIIKLYSAASIGQERQRHVGTDFLILTELC--NGGQLTQLIQKRNKTLPYNVSLQIFNQVAAAIEHMHSQTPPIIHRDLKVENLLINCHGVIKLCDFGSATTVAHYPDSSWTGLKRSEVQEEIEKHTTPMYRTPEMLDLYQNYPINQACDIWALGCVLYYLCFNKHPFEDSAKLAILNANYTIP-TNVDVNDSCCGLIYQMLLIDPNQRPKISEI 304          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000000804.1 (SMESG000000804.1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.244e-18
Identity = 60/205 (29.27%), Postives = 106/205 (51.71%), Query Frame = 1
Query:  265 EIIAEGGFGLVFKVRS-QTDHIFALKRLCVNNRIDL--KVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQT-PVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQLGSDIINCKSDIWALGCLL 867
            E I EG +G VFK ++ ++  I ALKR+ ++   +       REI ++  L H NI+ LID  +++++     + M+  YC +++     S    N  + +N +   +  ++     LHYC +  V+HRDLK +N+LI++     L DFG A A  I   +Y         ++  TL YR P+++  G+ + +   D+W+ GC+ 
Sbjct:   13 EKIGEGTYGTVFKAKNRESFEIVALKRVRLDEDDEGIPSSALREICLLKELKHPNIVKLIDVLLSDRR-----LTMVFEYCDQDLKKYFDS---CNGEIDQNTVKSFMYQLLRG---LHYCHSHNVLHRDLKPQNLLINDNGELKLADFGLARAFGIPVRQYS--------AEVVTLWYRPPDVL-FGAKLYSTTIDMWSAGCIF 197          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000055481.1 (SMESG000055481.1)

HSP 1 Score: 86.2705 bits (212), Expect = 4.581e-18
Identity = 82/303 (27.06%), Postives = 138/303 (45.54%), Query Frame = 1
Query:  259 VEEIIAEGGFGLVFKV--RSQTDHIFALKRLCVNNRIDLKV---CKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNVAHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENILIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPE-MVQLGSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDV------VYSDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQWDELPLPN 1131
            +++ I  G F  V++       D I ALK++ +   +D K    C +EI ++  L H +I+ LI S I +  N++  VL L      +++ ++K   K  + + E  I K    I  A+  +H     ++HRD+K  N+ I  +    L DFG           +   +T    S   T  Y SPE +++ G D+   KSDIW+LGC+LY +     PF    L +      I + D       +YS ++  L+   +  +P  RP+I  +  +A    N     ++ DK + P+   L LP+
Sbjct:   24 IQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIED--NELIIVLELAD--AGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMH--SQRIMHRDIKPANVFITSKGEVKLGDFGLG--------RFFSTQTSNVHSLVGTPYYMSPERILETGYDM---KSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVA---KNMHEKTRSPDKVQNPESPSLNLPS 306          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AAK12.940e-9447.68AP2 associated kinase 1 [Source:HGNC Symbol;Acc:HG... [more]
AAK14.213e-9347.68AP2 associated kinase 1 [Source:HGNC Symbol;Acc:HG... [more]
AAK11.693e-9247.68AP2 associated kinase 1 [Source:HGNC Symbol;Acc:HG... [more]
BMP2K1.895e-8949.20BMP2 inducible kinase [Source:HGNC Symbol;Acc:HGNC... [more]
BMP2K7.948e-8951.38BMP2 inducible kinase [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sel-58.298e-6242.41Serine/threonine-protein kinase sel-5 [Source:Uni... [more]
sel-52.233e-6042.41Serine/threonine-protein kinase sel-5 [Source:Uni... [more]
sel-52.233e-6042.41Serine/threonine-protein kinase sel-5 [Source:Uni... [more]
gakh-12.096e-3132.60GAK Homolog [Source:UniProtKB/TrEMBL;Acc:Q20483][more]
unc-821.199e-2030.40pep chromosome:WBcel235:IV:7424498:7444660:1 gene:... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nak9.955e-9950.16gene:FBgn0015772 transcript:FBtr0081189[more]
Nak1.885e-9850.16gene:FBgn0015772 transcript:FBtr0340326[more]
Nak3.012e-9450.16gene:FBgn0015772 transcript:FBtr0081187[more]
Nak3.012e-9450.16gene:FBgn0015772 transcript:FBtr0340325[more]
CG12271.972e-3128.36gene:FBgn0037491 transcript:FBtr0339736[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aak1a2.061e-9251.30AP2 associated kinase 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
aak1a7.098e-9151.30AP2 associated kinase 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
bmp2k8.224e-9047.78BMP2 inducible kinase [Source:ZFIN;Acc:ZDB-GENE-04... [more]
bmp2k8.726e-9047.78BMP2 inducible kinase [Source:ZFIN;Acc:ZDB-GENE-04... [more]
aak1b1.699e-8948.65AP2 associated kinase 1b [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aak13.401e-9449.25AP2 associated kinase 1 [Source:NCBI gene;Acc:1001... [more]
aak17.380e-9449.25AP2 associated kinase 1 [Source:NCBI gene;Acc:1001... [more]
aak13.352e-9249.25AP2 associated kinase 1 [Source:NCBI gene;Acc:1001... [more]
aak13.499e-9149.25AP2 associated kinase 1 [Source:NCBI gene;Acc:1001... [more]
psmd106.683e-9149.52proteasome 26S subunit, non-ATPase 10 [Source:Xenb... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aak16.838e-9347.68AP2 associated kinase 1 [Source:MGI Symbol;Acc:MGI... [more]
Aak12.906e-9247.68AP2 associated kinase 1 [Source:MGI Symbol;Acc:MGI... [more]
Bmp2k1.447e-8948.23BMP2 inducible kinase [Source:MGI Symbol;Acc:MGI:2... [more]
Bmp2k9.339e-8748.23BMP2 inducible kinase [Source:MGI Symbol;Acc:MGI:2... [more]
Gak1.020e-4136.16cyclin G associated kinase [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2M2I8|AAK1_HUMAN8.133e-9247.68AP2-associated protein kinase 1 OS=Homo sapiens OX... [more]
sp|F1MH24|AAK1_BOVIN1.255e-9147.41AP2-associated protein kinase 1 OS=Bos taurus OX=9... [more]
sp|Q3UHJ0|AAK1_MOUSE2.033e-9147.68AP2-associated protein kinase 1 OS=Mus musculus OX... [more]
sp|F1SPM8|AAK1_PIG1.012e-9047.14AP2-associated protein kinase 1 OS=Sus scrofa OX=9... [more]
sp|P0C1X8|AAK1_RAT7.414e-9047.68AP2-associated protein kinase 1 OS=Rattus norvegic... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2L7X98.710e-11656.39Protein kinase domain-containing protein OS=Opisth... [more]
A0A075A1S51.169e-11557.05Protein kinase domain-containing protein OS=Opisth... [more]
A0A3R7H2D91.943e-11556.72AP2-associated protein kinase 1 OS=Clonorchis sine... [more]
A0A4S2L9Y23.493e-11556.39Protein kinase domain-containing protein OS=Opisth... [more]
A0A1S8X9G11.035e-11154.21Kinase domain protein (Fragment) OS=Opisthorchis v... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aak1b3.845e-9248.35AP2 associated kinase 1b [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSAMXT00000003200.21.579e-9052.27AP2-associated protein kinase 1 [Source:NCBI gene;... [more]
bmp2k2.774e-9048.73BMP2 inducible kinase [Source:ZFIN;Acc:ZDB-GENE-04... [more]
ENSAMXT00000054610.11.335e-8952.27AP2-associated protein kinase 1 [Source:NCBI gene;... [more]
ENSAMXT00000030716.12.176e-8952.27AP2-associated protein kinase 1 [Source:NCBI gene;... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006448.12.016e-9049.68pep scaffold:Pmarinus_7.0:GL476771:264361:311032:-... [more]
ENSPMAT00000007073.11.453e-8449.15pep scaffold:Pmarinus_7.0:GL477321:233302:247915:1... [more]
stk162.168e-2330.83serine/threonine kinase 16 [Source:ZFIN;Acc:ZDB-GE... [more]
nek27.470e-2332.74NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
STK367.881e-2032.87serine/threonine kinase 36 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AKL12.624e-4236.93Ser-Thr protein kinase; member (with Ark1p and Prk... [more]
ARK12.996e-4133.44Serine/threonine protein kinase; involved in regul... [more]
PRK18.265e-3732.00Protein serine/threonine kinase; regulates the org... [more]
CDC56.753e-2127.60Polo-like kinase; controls targeting and activatio... [more]
SNF11.137e-1729.03AMP-activated S/T protein kinase; forms a complex ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO397865.301e-9752.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439264.067e-4235.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445184.532e-2432.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374137.694e-2330.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491383.361e-2232.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bmp2k1.030e-9349.04BMP2 inducible kinase [Source:NCBI gene;Acc:101161... [more]
aak1a5.373e-9053.25AP2-associated protein kinase 1 [Source:NCBI gene;... [more]
aak1a5.373e-9053.25AP2-associated protein kinase 1 [Source:NCBI gene;... [more]
aak1a1.707e-8953.25AP2-associated protein kinase 1 [Source:NCBI gene;... [more]
aak1a1.851e-8953.25AP2-associated protein kinase 1 [Source:NCBI gene;... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071701.10.000e+099.83SMESG000071701.1[more]
SMESG000051989.11.810e-7946.46SMESG000051989.1[more]
SMESG000081891.13.377e-4138.38SMESG000081891.1[more]
SMESG000000804.11.244e-1829.27SMESG000000804.1[more]
SMESG000055481.14.581e-1827.06SMESG000055481.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003365 ID=SMED30003365|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2262bp
ACTATATCAAACACACTTAAATATAATCTAGTAGCTTGAGATAATCAGTT
TAAAGTTACAATGAAAAAATTAATATCTAAATTGAAAGAAGTGCCTGACT
TAGAAAGTAAGCATCCGTGGTCATCAGTTCCTCAAAATTACAGTTTAAGC
ATACATAATGACAGTGCAAATGCTATTAATAATCTCAGTAATTCAAGTCA
TAATCATTTGAGCAATTTTATTGGGAAAAAATTTCAAATCGGACGCTTTA
TAGTAGTAGTGGAAGAAATAATTGCCGAAGGTGGTTTTGGTTTGGTTTTC
AAAGTCAGATCACAAACAGACCATATTTTTGCATTGAAAAGATTATGTGT
CAATAACCGAATAGATTTGAAAGTGTGTAAAAGAGAAATCACAATAATGA
GTTCCCTGACTCATAAAAACATTCTATCATTGATTGACTCTCAAATAAAT
GAACAACAAAACGACATATTTGAAGTCCTAATGCTCCTTGCTTATTGTCC
CAAAAACGTTGCACATTTAATGAAAAGTAAGCAAAAAGTGAACCAACATC
TCTCAGAAAATATGATAATCAAGATTCTATGTGACATTATTGAAGCTGTG
GCTCGACTTCACTACTGTCAAACCCCTGTTATTCACAGAGATTTAAAAGT
GGAAAATATTTTGATAGATGAAAGGAACAATTATGTTCTTTGTGATTTCG
GAAGTGCTACCGCTCGGCAGATCATTCCCACTGAATACGGAATCGGGAAA
ACAGAAGAAGAAATTTCAAAATACACGACTCTGGCCTATCGGTCACCGGA
AATGGTGCAGTTAGGCAGTGACATTATAAATTGTAAATCAGACATTTGGG
CACTTGGATGTCTTTTGTATTATCTCTGCTATTTTACTTTGCCTTTTGCT
GATCGAGTTCTTGCTATTCAATCTGGTAAATTTACCATTCCAAAAATAGA
TGTTGTTTATTCAGATAAAATTCTCAAATTAATTCAATATATGTTAACAG
TGAATCCAGCAGACCGTCCCAGCATATATCAAGTGTCAGTATTAGCATTT
TCAATGGCCAATGGGAAAAATCCTATTCAAAACCTTGATAAAGAAAAGGT
TCCACAATGGGACGAACTTCCTTTGCCAAATAGTAATCACACTCCCAGGA
AAGCAGTTCCTCACATTAAAGGGGACCAATTGACCAATGAAACTCCAAAG
ACCTTACTGTCCAGCAATGCCAATAAAGTGAAATCAGTTTCCAACCAAAG
TAAAAGCATTTCAACATCTATCAATCCCCGTATCAGACCCCGAGCCAATA
AAACACCTCTGGAGAAAAGTGATTCAGCCGACAATGAAAAGTCGAAAGAA
AAATCAACTCCTCACATTTCACAGTCGAATTCCTTCAATATTAGTCTTTC
ATCTATCAAAACAAATTTGCCAAAACCGACCTCTGTCAAGCTTTATAGCG
CTCCGCCAATACCTCAAGATAATCAAAATCAATCTAATTCACAGGATACA
ACAGTGGAAGTTGAAGTTTCGAATACCCTTCAAAACGTACCACTTAAAGA
CGAGTTAACTGTCGAAAGAAATGACAGCTTACGAACTCGTATTGGTCATC
GTCGAATGGTCAGTGAATCGTCGTCCAAATCAGTCGTAGAAGAAAACATG
AAGCCTGGTAAAAGTCTGTTGGAATTGACGAGAAAATATTCTATTGATCA
AAATCATTCATTGACCGATGTTGATCAAGTCGATAATTCTAATTTTCAAA
CTGTCCCCATCAAAATTAGTGACGACGAGATGGAAAATGATGCAATGTTT
GGTGAAGAATTCGATAAAATCCGGCATCAATCTGACACTTCCGGCGGTGT
TGGTGGTGATTGACAGATAAACGGCTCGTATTGAAATCTAACCAATAACA
GTTTATTCAGCCTTCGACCAATGAAAAATGTGCATACTTCGGCCTTATTA
TTGATAATAATCGTTTTGTTGAATGTATTCTATTATCTACTCTTGTCCGA
TAAATTACGCGATTTTATTTCCAATACTCATTTCGAGTCTATTCAATTTT
ATTATTACTACCATTGATTGTGAATTTGGAATTATTTCTTTTCCGTCGGT
AAAAAAGCCATCAATTTTTATTAAAATAGTTTAGATGCGAATATCTAAAA
GTAAATTATCATTTCTATTGAATTGTCTTTTTATCTTACAAAAAACTCAT
GATCATAATAACAATTATATATAGCGTGTCGAGACAGTGGCGTAACAACA
GCTTGGCATTGG
back to top

protein sequence of SMED30003365-orf-1

>SMED30003365-orf-1 ID=SMED30003365-orf-1|Name=SMED30003365-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=601bp
MKKLISKLKEVPDLESKHPWSSVPQNYSLSIHNDSANAINNLSNSSHNHL
SNFIGKKFQIGRFIVVVEEIIAEGGFGLVFKVRSQTDHIFALKRLCVNNR
IDLKVCKREITIMSSLTHKNILSLIDSQINEQQNDIFEVLMLLAYCPKNV
AHLMKSKQKVNQHLSENMIIKILCDIIEAVARLHYCQTPVIHRDLKVENI
LIDERNNYVLCDFGSATARQIIPTEYGIGKTEEEISKYTTLAYRSPEMVQ
LGSDIINCKSDIWALGCLLYYLCYFTLPFADRVLAIQSGKFTIPKIDVVY
SDKILKLIQYMLTVNPADRPSIYQVSVLAFSMANGKNPIQNLDKEKVPQW
DELPLPNSNHTPRKAVPHIKGDQLTNETPKTLLSSNANKVKSVSNQSKSI
STSINPRIRPRANKTPLEKSDSADNEKSKEKSTPHISQSNSFNISLSSIK
TNLPKPTSVKLYSAPPIPQDNQNQSNSQDTTVEVEVSNTLQNVPLKDELT
VERNDSLRTRIGHRRMVSESSSKSVVEENMKPGKSLLELTRKYSIDQNHS
LTDVDQVDNSNFQTVPIKISDDEMENDAMFGEEFDKIRHQSDTSGGVGGD
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 65..331
e-value: 1.6E-43
score: 160.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 67..325
e-value: 1.4E-40
score: 139.3
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 65..331
score: 34.577
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 55..358
e-value: 3.9E-86
score: 290.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 355..443
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 374..409
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 412..433
NoneNo IPR availablePANTHERPTHR22967:SF57NUMB-ASSOCIATED KINASE, ISOFORM Acoord: 42..544
NoneNo IPR availablePANTHERPTHR22967SERINE/THREONINE PROTEIN KINASEcoord: 42..544
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 190..202
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 66..327