FAD-binding FR-type domain-containing protein

Overview
NameFAD-binding FR-type domain-containing protein
Smed IDSMED30003361
Length (bp)735
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FAD-binding FR-type domain-containing protein (SMED30003361) t-SNE clustered cells

Violin plots show distribution of expression levels for FAD-binding FR-type domain-containing protein (SMED30003361) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FAD-binding FR-type domain-containing protein (SMED30003361) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FAD-binding FR-type domain-containing protein (SMED30003361) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003361

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30003361h1SMcG0005215 dd_Smed_v4_10782_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Human
Match: OXNAD1 (oxidoreductase NAD binding domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25128])

HSP 1 Score: 119.783 bits (299), Expect = 9.568e-32
Identity = 76/252 (30.16%), Postives = 131/252 (51.98%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYANRKLITKPSDSSKYF-----LFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSS----FIHRRISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLV-KYLVVDKVIIEKWW 717
            K+    + SP VK ++L +    +Q F ++ GQWVDF +P      G+SI S       +  +ELAVK ++   + W+HN+  +   V++++GG F FD    + +   + IAGG+GINP++ IL +A   L  + +  + Y      LFYS+KN  EL+F   +  ++    +       +T++ +  ++    +I  RI+ ++I+D ISK        +ICGP  M D+F   L   ++  + +  EKWW
Sbjct:   67 KVCGAASESPSVKSLRLLV---ADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFPEKIACSLHVTKQTTQINAELKPYITGRITEKEIRDHISK----ETLFYICGPPPMTDFFSKQLENNHVPKEHICFEKWW 311          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Human
Match: OXNAD1 (oxidoreductase NAD binding domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25128])

HSP 1 Score: 119.013 bits (297), Expect = 1.684e-31
Identity = 84/263 (31.94%), Postives = 133/263 (50.57%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYANRKLITKPSDSSKYF-----LFYSSKNVEELIF----LDRL----ERIL-------KTNGKNFQFKYFITEEISANSSFIHRRISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLV-KYLVVDKVIIEKWW 717
            K+    + SP VK ++L +    +Q F ++ GQWVDF +P      G+SI S       +  +ELAVK ++   + W+HN+  +   V++++GG F FD    + +   + IAGG+GINP++ IL +A   L  + +  + Y      LFYS+KN  EL+F    LD +    E+I        +T   N + K +ITE           RI+ ++I+D ISK        +ICGP  M D+F   L   ++  + +  EKWW
Sbjct:   67 KVCGAASESPSVKSLRLLV---ADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFPEKIACSLHVTKQTTQINAELKPYITEG----------RITEKEIRDHISK----ETLFYICGPPPMTDFFSKQLENNHVPKEHICFEKWW 312          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Human
Match: OXNAD1 (oxidoreductase NAD binding domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25128])

HSP 1 Score: 119.013 bits (297), Expect = 1.684e-31
Identity = 84/263 (31.94%), Postives = 133/263 (50.57%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYANRKLITKPSDSSKYF-----LFYSSKNVEELIF----LDRL----ERIL-------KTNGKNFQFKYFITEEISANSSFIHRRISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLV-KYLVVDKVIIEKWW 717
            K+    + SP VK ++L +    +Q F ++ GQWVDF +P      G+SI S       +  +ELAVK ++   + W+HN+  +   V++++GG F FD    + +   + IAGG+GINP++ IL +A   L  + +  + Y      LFYS+KN  EL+F    LD +    E+I        +T   N + K +ITE           RI+ ++I+D ISK        +ICGP  M D+F   L   ++  + +  EKWW
Sbjct:   67 KVCGAASESPSVKSLRLLV---ADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFPEKIACSLHVTKQTTQINAELKPYITEG----------RITEKEIRDHISK----ETLFYICGPPPMTDFFSKQLENNHVPKEHICFEKWW 312          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Human
Match: OXNAD1 (oxidoreductase NAD binding domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25128])

HSP 1 Score: 119.398 bits (298), Expect = 2.230e-31
Identity = 84/263 (31.94%), Postives = 133/263 (50.57%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYANRKLITKPSDSSKYF-----LFYSSKNVEELIF----LDRL----ERIL-------KTNGKNFQFKYFITEEISANSSFIHRRISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLV-KYLVVDKVIIEKWW 717
            K+    + SP VK ++L +    +Q F ++ GQWVDF +P      G+SI S       +  +ELAVK ++   + W+HN+  +   V++++GG F FD    + +   + IAGG+GINP++ IL +A   L  + +  + Y      LFYS+KN  EL+F    LD +    E+I        +T   N + K +ITE           RI+ ++I+D ISK        +ICGP  M D+F   L   ++  + +  EKWW
Sbjct:   85 KVCGAASESPSVKSLRLLV---ADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFPEKIACSLHVTKQTTQINAELKPYITEG----------RITEKEIRDHISK----ETLFYICGPPPMTDFFSKQLENNHVPKEHICFEKWW 330          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Human
Match: OXNAD1 (oxidoreductase NAD binding domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25128])

HSP 1 Score: 119.398 bits (298), Expect = 2.230e-31
Identity = 84/263 (31.94%), Postives = 133/263 (50.57%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYANRKLITKPSDSSKYF-----LFYSSKNVEELIF----LDRL----ERIL-------KTNGKNFQFKYFITEEISANSSFIHRRISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLV-KYLVVDKVIIEKWW 717
            K+    + SP VK ++L +    +Q F ++ GQWVDF +P      G+SI S       +  +ELAVK ++   + W+HN+  +   V++++GG F FD    + +   + IAGG+GINP++ IL +A   L  + +  + Y      LFYS+KN  EL+F    LD +    E+I        +T   N + K +ITE           RI+ ++I+D ISK        +ICGP  M D+F   L   ++  + +  EKWW
Sbjct:   85 KVCGAASESPSVKSLRLLV---ADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFPEKIACSLHVTKQTTQINAELKPYITEG----------RITEKEIRDHISK----ETLFYICGPPPMTDFFSKQLENNHVPKEHICFEKWW 330          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Zebrafish
Match: oxnad1 (oxidoreductase NAD-binding domain containing 1 [Source:NCBI gene;Acc:558500])

HSP 1 Score: 115.931 bits (289), Expect = 7.629e-31
Identity = 76/251 (30.28%), Postives = 119/251 (47.41%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYA---NRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITE-----EISANSSFIHRRISHEDIKDVISKIDTNNCNAFICGPNQMIDYF-YDFLVKYLVVDKVIIEKWW 717
            ++ DI + S  VK ++L + +     F +R GQWVDF +P      G+SI S       +  +ELAVK +    + W+H    V   V++++GG+F FD    N     + +AGG+GINP+  IL +A   +R   +         L YS+KN  EL+F D +  I       F   + +T+     E       I  RIS E+++     +D      ++CGP  MI+    D     L  D+++ EKWW
Sbjct:   31 RVCDIISESDTVKRLRLEVAHP---DFSFRAGQWVDFFIPGVDTVGGFSICSSPGLLKREGVIELAVKYARHPPAHWIHTECSVDSQVAVRVGGNFYFDPQPSNPVVDLLLVAGGVGINPLYSILLHAADLHRHTHSHRYTPGHTHLCYSAKNTTELLFKDTIIDICHERPDKFSCHFHVTQQSSDIEPQLQPYTIRGRISAEELQRY---VDPERTLCYLCGPPPMIEKVSSDLQSTGLPEDRILFEKWW 275          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Zebrafish
Match: oxnad1 (oxidoreductase NAD-binding domain containing 1 [Source:NCBI gene;Acc:558500])

HSP 1 Score: 115.931 bits (289), Expect = 8.912e-31
Identity = 76/251 (30.28%), Postives = 119/251 (47.41%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYA---NRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITE-----EISANSSFIHRRISHEDIKDVISKIDTNNCNAFICGPNQMIDYF-YDFLVKYLVVDKVIIEKWW 717
            ++ DI + S  VK ++L + +     F +R GQWVDF +P      G+SI S       +  +ELAVK +    + W+H    V   V++++GG+F FD    N     + +AGG+GINP+  IL +A   +R   +         L YS+KN  EL+F D +  I       F   + +T+     E       I  RIS E+++     +D      ++CGP  MI+    D     L  D+++ EKWW
Sbjct:   26 RVCDIISESDTVKRLRLEVAH---PDFSFRAGQWVDFFIPGVDTVGGFSICSSPGLLKREGVIELAVKYARHPPAHWIHTECSVDSQVAVRVGGNFYFDPQPSNPVVDLLLVAGGVGINPLYSILLHAADLHRHTHSHRYTPGHTHLCYSAKNTTELLFKDTIIDICHERPDKFSCHFHVTQQSSDIEPQLQPYTIRGRISAEELQRY---VDPERTLCYLCGPPPMIEKVSSDLQSTGLPEDRILFEKWW 270          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Zebrafish
Match: oxnad1 (oxidoreductase NAD-binding domain containing 1 [Source:NCBI gene;Acc:558500])

HSP 1 Score: 115.931 bits (289), Expect = 1.534e-30
Identity = 76/251 (30.28%), Postives = 120/251 (47.81%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYA---NRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEIS-----ANSSFIHRRISHEDIKDVISKIDTNNCNAFICGPNQMIDYF-YDFLVKYLVVDKVIIEKWW 717
            ++ DI + S  VK ++L + +     F +R GQWVDF +P      G+SI S       +  +ELAVK +    + W+H    V   V++++GG+F FD    N     + +AGG+GINP+  IL +A   +R   +         L YS+KN  EL+F D +  I       F   + +T++ S          I  RIS E+++     +D      ++CGP  MI+    D     L  D+++ EKWW
Sbjct:   62 RVCDIISESDTVKRLRLEVAHP---DFSFRAGQWVDFFIPGVDTVGGFSICSSPGLLKREGVIELAVKYARHPPAHWIHTECSVDSQVAVRVGGNFYFDPQPSNPVVDLLLVAGGVGINPLYSILLHAADLHRHTHSHRYTPGHTHLCYSAKNTTELLFKDTIIDICHERPDKFSCHFHVTQQSSDIEPQLQPYTIRGRISAEELQRY---VDPERTLCYLCGPPPMIEKVSSDLQSTGLPEDRILFEKWW 306          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Zebrafish
Match: oxnad1 (oxidoreductase NAD-binding domain containing 1 [Source:NCBI gene;Acc:558500])

HSP 1 Score: 95.5153 bits (236), Expect = 4.498e-23
Identity = 65/222 (29.28%), Postives = 105/222 (47.30%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYA---NRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEIS-----ANSSFIHRRISHEDIKDVISKIDTNNCNAFIC 633
            ++ DI + S  VK ++L + +     F +R GQWVDF +P      G+SI S       +  +ELAVK +    + W+H    V   V++++GG+F FD    N     + +AGG+GINP+  IL +A   +R   +         L YS+KN  EL+F D +  I       F   + +T++ S          I  RIS E+++     +D      ++C
Sbjct:   62 RVCDIISESDTVKRLRLEVAHP---DFSFRAGQWVDFFIPGVDTVGGFSICSSPGLLKREGVIELAVKYARHPPAHWIHTECSVDSQVAVRVGGNFYFDPQPSNPVVDLLLVAGGVGINPLYSILLHAADLHRHTHSHRYTPGHTHLCYSAKNTTELLFKDTIIDICHERPDKFSCHFHVTQQSSDIEPQLQPYTIRGRISAEELQRY---VDPERTLCYLC 277          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Xenopus
Match: got1 (glutamic-oxaloacetic transaminase 1 [Source:Xenbase;Acc:XB-GENE-954930])

HSP 1 Score: 119.013 bits (297), Expect = 1.691e-31
Identity = 78/250 (31.20%), Postives = 127/250 (50.80%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFD--DSYLNGTNIFIAGGIGINPIICILDYA-----NRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSSFIHRRISHEDI--KDVISKIDTNNCNAFICGPNQMIDYFYDFLVKYLVV-DKVIIEKWW 717
            K+ +I N S  VK V+L I N   ++F ++ GQWVDF +P   K  G+SI SC      +  +ELAVK +    + W+H+   +G  V++++GG F FD   S L    + IAGG+GINP+  IL +        ++  +        L+Y +KN  EL+F   +  ++K+        + +T++ S     +   I+   I  KD+ S + T+    +ICGP  MI+     L    V  ++++ EKWW
Sbjct:   69 KVCEITNESATVKRVRLAIAN---REFTFKAGQWVDFFIPGVPKVGGFSICSCPGLLETEGVLELAVKYNLHPPAHWIHSQCTLGSEVAVRVGGEFCFDPQPSDLPLDLVLIAGGVGINPLFSILLHVADLHKTHEMTGRGFQMGNVKLYYCAKNTGELLFKRNILDLVKSFPGKITCSFHVTQQSSPVCVELQPFITEGRITEKDLASYVSTDQL-CYICGPPPMIESTCKQLESLHVPKEQILFEKWW 314          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Xenopus
Match: got1 (glutamic-oxaloacetic transaminase 1 [Source:Xenbase;Acc:XB-GENE-954930])

HSP 1 Score: 119.013 bits (297), Expect = 2.401e-31
Identity = 78/250 (31.20%), Postives = 127/250 (50.80%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFD--DSYLNGTNIFIAGGIGINPIICILDYA-----NRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSSFIHRRISHEDI--KDVISKIDTNNCNAFICGPNQMIDYFYDFLVKYLVV-DKVIIEKWW 717
            K+ +I N S  VK V+L I N   ++F ++ GQWVDF +P   K  G+SI SC      +  +ELAVK +    + W+H+   +G  V++++GG F FD   S L    + IAGG+GINP+  IL +        ++  +        L+Y +KN  EL+F   +  ++K+        + +T++ S     +   I+   I  KD+ S + T+    +ICGP  MI+     L    V  ++++ EKWW
Sbjct:   83 KVCEITNESATVKRVRLAIAN---REFTFKAGQWVDFFIPGVPKVGGFSICSCPGLLETEGVLELAVKYNLHPPAHWIHSQCTLGSEVAVRVGGEFCFDPQPSDLPLDLVLIAGGVGINPLFSILLHVADLHKTHEMTGRGFQMGNVKLYYCAKNTGELLFKRNILDLVKSFPGKITCSFHVTQQSSPVCVELQPFITEGRITEKDLASYVSTDQL-CYICGPPPMIESTCKQLESLHVPKEQILFEKWW 328          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Mouse
Match: Oxnad1 (oxidoreductase NAD-binding domain containing 1 [Source:MGI Symbol;Acc:MGI:1916953])

HSP 1 Score: 122.479 bits (306), Expect = 5.614e-33
Identity = 77/258 (29.84%), Postives = 131/258 (50.78%), Query Frame = 1
Query:    1 MKCCKIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYANRKLITKPSDSSKYF------LFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSSFIHR-----RISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLVK-YLVVDKVIIEKWW 717
            M   K+ +I + SP VK ++L + +   + F ++ GQWVDF +P      G+SI S       D  +ELAVK +D   + W+HN   +   V++++GG F FD    +     I IAGG+GINP++ IL ++   L    +D  + +      LFYS+KN  EL+F   +  ++    +     + +T++ +  S+ +       RI+ ++I+D IS         ++CGP  M D+F   L   ++  + +  EKWW
Sbjct:   62 MAAAKVCEITHESPSVKSLRLLVAD---KDFSFKAGQWVDFFIPGVSVVGGFSICSSPQRLERDRIIELAVKYADHPPAVWVHNKCTLDSEVALRVGGEFFFDPQPTDAPRNLILIAGGVGINPLLSILRHSA-DLHRDHADKGRSYEIGTVKLFYSAKNTSELLFKKDILDLVHEFPEKISCSFHVTKQTAQISAELKPYVTDGRITEKEIRDHISA----ETLFYVCGPPPMTDFFSKHLESCHVPKEHICFEKWW 311          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Mouse
Match: Oxnad1 (oxidoreductase NAD-binding domain containing 1 [Source:MGI Symbol;Acc:MGI:1916953])

HSP 1 Score: 58.151 bits (139), Expect = 3.388e-10
Identity = 39/120 (32.50%), Postives = 57/120 (47.50%), Query Frame = 1
Query:    1 MKCCKIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTNIFIAGGIGI 345
            M   K+ +I + SP VK ++L + +   + F ++ GQWVDF +P      G+SI S       D  +ELAVK +D   + W+HN                   D+  N   I IAGG+GI
Sbjct:   62 MAAAKVCEITHESPSVKSLRLLVAD---KDFSFKAGQWVDFFIPGVSVVGGFSICSSPQRLERDRIIELAVKYADHPPAVWVHNKP----------------TDAPRN--LILIAGGVGI 160          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Mouse
Match: Oxnad1 (oxidoreductase NAD-binding domain containing 1 [Source:MGI Symbol;Acc:MGI:1916953])

HSP 1 Score: 56.9954 bits (136), Expect = 7.288e-10
Identity = 31/91 (34.07%), Postives = 47/91 (51.65%), Query Frame = 1
Query:    1 MKCCKIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDN 258
            M   K+ +I + SP VK ++L + +   + F ++ GQWVDF +P      G+SI S       D  +ELAVK +D   + W+HN    G  
Sbjct:   62 MAAAKVCEITHESPSVKSLRLLVAD---KDFSFKAGQWVDFFIPGVSVVGGFSICSSPQRLERDRIIELAVKYADHPPAVWVHNKISTGTT 149          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Mouse
Match: Oxnad1 (oxidoreductase NAD-binding domain containing 1 [Source:MGI Symbol;Acc:MGI:1916953])

HSP 1 Score: 53.9138 bits (128), Expect = 7.202e-9
Identity = 29/83 (34.94%), Postives = 45/83 (54.22%), Query Frame = 1
Query:    1 MKCCKIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLH 234
            M   K+ +I + SP VK ++L + +   + F ++ GQWVDF +P      G+SI S       D  +ELAVK +D   + W+H
Sbjct:   62 MAAAKVCEITHESPSVKSLRLLVAD---KDFSFKAGQWVDFFIPGVSVVGGFSICSSPQRLERDRIIELAVKYADHPPAVWVH 141          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Mouse
Match: Oxnad1 (oxidoreductase NAD-binding domain containing 1 [Source:MGI Symbol;Acc:MGI:1916953])

HSP 1 Score: 50.447 bits (119), Expect = 4.078e-8
Identity = 28/77 (36.36%), Postives = 41/77 (53.25%), Query Frame = 1
Query:   37 SPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVG 252
            SP VK ++L + +   + F ++ GQWVDF +P      G+SI S       D  +ELAVK +D   + W+HN    G
Sbjct:    3 SPSVKSLRLLVAD---KDFSFKAGQWVDFFIPGVSVVGGFSICSSPQRLERDRIIELAVKYADHPPAVWVHNKISTG 76          
BLAST of FAD-binding FR-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8VE38|OXND1_MOUSE (Oxidoreductase NAD-binding domain-containing protein 1 OS=Mus musculus OX=10090 GN=Oxnad1 PE=1 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 3.927e-32
Identity = 77/258 (29.84%), Postives = 131/258 (50.78%), Query Frame = 1
Query:    1 MKCCKIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYANRKLITKPSDSSKYF------LFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSSFIHR-----RISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLVK-YLVVDKVIIEKWW 717
            M   K+ +I + SP VK ++L + +   + F ++ GQWVDF +P      G+SI S       D  +ELAVK +D   + W+HN   +   V++++GG F FD    +     I IAGG+GINP++ IL ++   L    +D  + +      LFYS+KN  EL+F   +  ++    +     + +T++ +  S+ +       RI+ ++I+D IS         ++CGP  M D+F   L   ++  + +  EKWW
Sbjct:   62 MAAAKVCEITHESPSVKSLRLLVAD---KDFSFKAGQWVDFFIPGVSVVGGFSICSSPQRLERDRIIELAVKYADHPPAVWVHNKCTLDSEVALRVGGEFFFDPQPTDAPRNLILIAGGVGINPLLSILRHSA-DLHRDHADKGRSYEIGTVKLFYSAKNTSELLFKKDILDLVHEFPEKISCSFHVTKQTAQISAELKPYVTDGRITEKEIRDHISA----ETLFYVCGPPPMTDFFSKHLESCHVPKEHICFEKWW 311          
BLAST of FAD-binding FR-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96HP4|OXND1_HUMAN (Oxidoreductase NAD-binding domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OXNAD1 PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 8.089e-31
Identity = 84/263 (31.94%), Postives = 133/263 (50.57%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYANRKLITKPSDSSKYF-----LFYSSKNVEELIF----LDRL----ERIL-------KTNGKNFQFKYFITEEISANSSFIHRRISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLV-KYLVVDKVIIEKWW 717
            K+    + SP VK ++L +    +Q F ++ GQWVDF +P      G+SI S       +  +ELAVK ++   + W+HN+  +   V++++GG F FD    + +   + IAGG+GINP++ IL +A   L  + +  + Y      LFYS+KN  EL+F    LD +    E+I        +T   N + K +ITE           RI+ ++I+D ISK        +ICGP  M D+F   L   ++  + +  EKWW
Sbjct:   67 KVCGAASESPSVKSLRLLV---ADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFPEKIACSLHVTKQTTQINAELKPYITEG----------RITEKEIRDHISK----ETLFYICGPPPMTDFFSKQLENNHVPKEHICFEKWW 312          
BLAST of FAD-binding FR-type domain-containing protein vs. UniProt/SwissProt
Match: sp|A4IHY0|OXND1_XENTR (Oxidoreductase NAD-binding domain-containing protein 1 OS=Xenopus tropicalis OX=8364 GN=oxnad1 PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 8.958e-31
Identity = 78/250 (31.20%), Postives = 127/250 (50.80%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFD--DSYLNGTNIFIAGGIGINPIICILDYA-----NRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSSFIHRRISHEDI--KDVISKIDTNNCNAFICGPNQMIDYFYDFLVKYLVV-DKVIIEKWW 717
            K+ +I N S  VK V+L I N   ++F ++ GQWVDF +P   K  G+SI SC      +  +ELAVK +    + W+H+   +G  V++++GG F FD   S L    + IAGG+GINP+  IL +        ++  +        L+Y +KN  EL+F   +  ++K+        + +T++ S     +   I+   I  KD+ S + T+    +ICGP  MI+     L    V  ++++ EKWW
Sbjct:   69 KVCEITNESATVKRVRLAIAN---REFTFKAGQWVDFFIPGVPKVGGFSICSCPGLLETEGVLELAVKYNLHPPAHWIHSQCTLGSEVAVRVGGEFCFDPQPSDLPLDLVLIAGGVGINPLFSILLHVADLHKTHEMTGRGFQMGNVKLYYCAKNTGELLFKRNILDLVKSFPGKITCSFHVTQQSSPVCVELQPFITEGRITEKDLASYVSTDQL-CYICGPPPMIESTCKQLESLHVPKEQILFEKWW 314          
BLAST of FAD-binding FR-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5R4D2|OXND1_PONAB (Oxidoreductase NAD-binding domain-containing protein 1 OS=Pongo abelii OX=9601 GN=OXNAD1 PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 9.480e-31
Identity = 75/252 (29.76%), Postives = 131/252 (51.98%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYANRKLITKPSDSSKYF-----LFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSS----FIHRRISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLV-KYLVVDKVIIEKWW 717
            K+    + SP VK ++L +    +Q F ++ GQWVDF +P      G+SI S       +  +ELAVK ++   + W+HN+  +   V++++GG F FD    + +   + IAGG+GINP++ IL +A   L  + +  + Y      LFYS+K+  EL+F   +  ++    +       +T++ +  ++    +I  RI+ ++I+D ISK        +ICGP  M D+F   L   ++  + +  EKWW
Sbjct:   67 KVCGAASESPSVKSLRLLV---ADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDSEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKSTSELLFKKNILDLVNEFPEKIACSSHVTKQTTQINAELKPYITGRITEKEIRDHISK----ETLFYICGPPPMTDFFSKQLENNHVPKEHICFEKWW 311          
BLAST of FAD-binding FR-type domain-containing protein vs. UniProt/SwissProt
Match: sp|A3KP77|OXND1_DANRE (Oxidoreductase NAD-binding domain-containing protein 1 OS=Danio rerio OX=7955 GN=oxnad1 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 2.772e-30
Identity = 76/251 (30.28%), Postives = 119/251 (47.41%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYA---NRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITE-----EISANSSFIHRRISHEDIKDVISKIDTNNCNAFICGPNQMIDYF-YDFLVKYLVVDKVIIEKWW 717
            ++ DI + S  VK ++L + +     F +R GQWVDF +P      G+SI S       +  +ELAVK +    + W+H    V   V++++GG+F FD    N     + +AGG+GINP+  IL +A   +R   +         L YS+KN  EL+F D +  I       F   + +T+     E       I  RIS E+++     +D      ++CGP  MI+    D     L  D+++ EKWW
Sbjct:   26 RVCDIISESDTVKRLRLEVAH---PDFSFRAGQWVDFFIPGVDTVGGFSICSSPGLLKREGAIELAVKYARHPPAHWIHTECSVDSQVAVRVGGNFYFDPQPSNPVVDLLLVAGGVGINPLYSILLHAADLHRHTHSHRYTPGHTHLCYSAKNTTELLFKDTIIDICHERPDKFSCHFHVTQQSSDIEPQLQPYTIRGRISAEELQRY---VDPERTLCYLCGPPPMIEKVSSDLQSTGLPEDRILFEKWW 270          
BLAST of FAD-binding FR-type domain-containing protein vs. TrEMBL
Match: A0A2G8L8W7 (Putative oxidoreductase NAD-binding domain-containing protein 1 isoform X2 OS=Stichopus japonicus OX=307972 GN=BSL78_06418 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.768e-36
Identity = 85/260 (32.69%), Postives = 134/260 (51.54%), Query Frame = 1
Query:   10 CKIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSCNDNEVE-----LAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN---IFIAGGIGINPIICILDYA--------NRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFIT-------EEISANSSFIHRRISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLVKYLVV-DKVIIEKWW 717
             ++I I + S  VKL+ L +  +    F ++ GQWVDFVVP  ++  G+S+ +  D   E     LAVK+S+   + W+H    VG  VS+++GG     D   +  +   + IAGGIGINPI  +L+          N   + KP  +    L YS+    ELIF + +  ++K +      KYFIT       +E+    + I RRIS +D++  I++++ N+    +CGP  MID F + L K  +  D ++ EKWW
Sbjct:   19 AEVISISDASESVKLLTLKVTAN---DFTFKAGQWVDFVVPGVERVGGFSMYTSPDQLTENGTLGLAVKKSEHQPAMWVHTKCSVGSKVSLRVGGDQLLYDPQPDSPSWNLLLIAGGIGINPIFSVLNRVCGFHRQCKNVNGVYKPGVTE---LLYSASVPNELIFRESISEMVKQHPNEISSKYFITRGKDGSIQELKKTENVIERRISEDDLRSSITRLNNNSLLCMVCGPPPMIDSFEEILQKQGIPKDNILTEKWW 272          
BLAST of FAD-binding FR-type domain-containing protein vs. TrEMBL
Match: A0A1S3JTQ3 (oxidoreductase NAD-binding domain-containing protein 1 OS=Lingula unguis OX=7574 GN=LOC106176075 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 3.827e-36
Identity = 81/248 (32.66%), Postives = 131/248 (52.82%), Query Frame = 1
Query:    7 CCKII-DIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYANRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSSFIHR--RISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLVKYLVV-DKVIIEKWW 717
            C  ++ +++++SP VK +KL +     + F ++ GQWVDF +PD K   G+SI S      ++  ++L VK SD   + W+HN  K GD VS++ GG F +D          + +AGG+G NPI  IL +     +       K  L YSS   EEL++ D ++  L     N  +K+F+T++     S   R  RI  +D+ + + K++T     +ICGP+ M +    FL+   V  +K++ EKWW
Sbjct:   52 CPAVVNEVKHISPTVKQLKLHVKR---KDFTFKAGQWVDFFIPDVKTVGGFSISSAPKTLKDEGVIKLGVKASDHPPAHWVHNKCKEGDAVSVRAGGDFYYDPQTAEEQTDLLLVAGGVGKNPIYSILQHFVNLQLEYCDRERKVVLLYSSSAREELLYRDHIKE-LADKSSNIFYKFFVTQQPENKESTHMRNGRIGEDDVTEALEKLNTEKLLCYICGPSTMSNAVEGFLLNSGVPKNKIMYEKWW 295          
BLAST of FAD-binding FR-type domain-containing protein vs. TrEMBL
Match: H2ZJN9 (FAD-binding FR-type domain-containing protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.447e-34
Identity = 79/252 (31.35%), Postives = 138/252 (54.76%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSCNDNE-------VELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTNIFIAGGIGINPIICILDYANRKLITKPSDSS--KYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISA-------NSSFIHRRISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLVKYLVVDKVII-EKWW 717
            K++ ++ +SP VK +KLFI        +++ GQWVD V+P      G+SI  CN  +       +ELAVK SD   + W+H    VGD VS+++GG+F F D+      + IAGG+GINP+  IL +    ++  PS+++  +  + YS+K ++EL+F + + RI   N    +  + +T+E +          +  + ++S + +   ++ I+ N  N +ICGP + I+   ++L+   V+ + I  EKWW
Sbjct:   66 KVVSLEELSPTVKGLKLFIEKRERINAEFQAGQWVDMVIPGVDTVGGFSI--CNAPQDLQQNGIIELAVKFSDHPPAHWIHTKCSVGDEVSVRVGGNFYFQDNDRKHI-VLIAGGVGINPLYSILQHWRNLILKSPSNTADQQTAMVYSAKTIKELLFQEEILRI--CNEIKARCDFHVTKETTPILDLTNEAKTIRNEKVSRQSLSTSLNCINPNLANCYICGPPKFIERIEEYLMDMGVLKQHIFYEKWW 312          
BLAST of FAD-binding FR-type domain-containing protein vs. TrEMBL
Match: A0A2Z6R1S3 (FAD-binding FR-type domain-containing protein OS=Rhizophagus clarus OX=94130 GN=RclHR1_13040002 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.507e-33
Identity = 87/252 (34.52%), Postives = 128/252 (50.79%), Query Frame = 1
Query:   10 CKIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN----IFIAGGIGINPIICILDY--ANRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSS--FIHRRISHEDIKDVISKIDT--NNCNAFICGPNQMIDYFYDFLVKYLVVDK-VIIEKWW 717
             KII I   +P VK  K   N     +F + PGQW+D  +PD     G+S+ S        N  ELA+K S+   + W H  + +GD V++++GG F +D            IFIAGG+GINP+I +L+    ++ L  + S   K  LFYS +   EL+F  R+E + K   +  +  YF+T E   + S  +  +RI  + IKDVI K          F+CGP+ M D    FL +  V +K ++ EKWW
Sbjct:   39 SKIIKIIQETPTVKTFKF--NPSSASEFSFLPGQWLDVFIPDVSIVGGFSLTSTPQTYKETNTFELAIKYSNHPPAKWFHEQANIGDEVNVRVGGEFVWDSLKEKQEQTEHVIFIAGGVGINPLISMLESICQDKLLDKEKSFVKKIRLFYSVRTFNELLFYKRIEGLNKQFPEMLECSYFLTREDPVHKSEFYYKQRIGKKFIKDVIEKEREYLEKLKCFVCGPSAMEDDVIKFLKESGVDEKRILFEKWW 288          
BLAST of FAD-binding FR-type domain-containing protein vs. TrEMBL
Match: A0A3Q0JMN1 (oxidoreductase NAD-binding domain-containing protein 1-like isoform X2 OS=Ciona intestinalis OX=7719 GN=LOC100177554 PE=4 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 2.499e-33
Identity = 75/248 (30.24%), Postives = 134/248 (54.03%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTNIFIAGGIGINPIICILDYANRKLITKPS--DSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSS-----FIHRRISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLVKYLV-VDKVIIEKWW 717
            K++ I+++SP VK +KLFI ++      ++ GQW+D V+P      G+SI +      ++  ++LAVK SD   + W+H    VG+ VS+++GG F + ++      + IAGG+GINP+  IL +     I K +  +     L YS+K ++EL+F + + +I    G   Q  + +T+E+    S     F   +IS + +   +S I+ +  + +ICGP + I+   ++L++     D +  EKWW
Sbjct:   17 KVVSIEDISPSVKGLKLFIESNERPAATFKAGQWIDMVIPGVDTVGGFSICNAPKDLVDNGHLQLAVKFSDHPPAHWIHTKCTVGNKVSVRVGGKFFYQETNKKHL-VLIAGGVGINPLFSILQHRRNLTIGKSNGVNDQHTALVYSAKTLQELLFQEEIRKICTEIGA--QCDFHVTQEVVQKLSDISGNFNTEKISEKSLSFSLSSIEPDIADCYICGPPKFIERIEEYLLQLGYNQDHIFYEKWW 261          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Cavefish
Match: oxnad1 (oxidoreductase NAD binding domain containing 1 [Source:NCBI gene;Acc:103039872])

HSP 1 Score: 112.464 bits (280), Expect = 2.423e-29
Identity = 71/250 (28.40%), Postives = 124/250 (49.60%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYANRKLITKPSD--SSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSSFIHR-----RISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLVKY-LVVDKVIIEKWW 717
            ++  I + S  V+ ++L + +     F +R GQWVDF +P  +K  G+S+ S          +ELAVK ++   + W+H    V   V +++GG F FD    + T   + +AGG+GINP+  IL +    L+ +PS        L YS+KN EEL+F + +  +L          + +T++      ++       RIS E+++  +  + T     ++CGP  MI+     L +  L  ++++ EKWW
Sbjct:   61 RVCGITDESRKVRRLQLEVPHP---DFSFRAGQWVDFYIPGMEKVGGFSVCSSPGLLQRTGVIELAVKYTEHPPAHWIHTKCTVDSGVELRVGGDFFFDPRPSDPTVDLLLVAGGVGINPLYSILLHTA-DLLRQPSGYRPGHAHLCYSAKNTEELLFKNSIIGVLHEFPDKISCNFHVTQQGCEVEPYLQPHTTSGRISEEELRRYVDPVRT---LCYLCGPPPMIESVSTVLQRLGLPQNRILFEKWW 303          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Cavefish
Match: oxnad1 (oxidoreductase NAD binding domain containing 1 [Source:NCBI gene;Acc:103039872])

HSP 1 Score: 112.464 bits (280), Expect = 2.423e-29
Identity = 71/250 (28.40%), Postives = 124/250 (49.60%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYANRKLITKPSD--SSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSSFIHR-----RISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLVKY-LVVDKVIIEKWW 717
            ++  I + S  V+ ++L + +     F +R GQWVDF +P  +K  G+S+ S          +ELAVK ++   + W+H    V   V +++GG F FD    + T   + +AGG+GINP+  IL +    L+ +PS        L YS+KN EEL+F + +  +L          + +T++      ++       RIS E+++  +  + T     ++CGP  MI+     L +  L  ++++ EKWW
Sbjct:   61 RVCGITDESRKVRRLQLEVPHP---DFSFRAGQWVDFYIPGMEKVGGFSVCSSPGLLQRTGVIELAVKYTEHPPAHWIHTKCTVDSGVELRVGGDFFFDPRPSDPTVDLLLVAGGVGINPLYSILLHTA-DLLRQPSGYRPGHAHLCYSAKNTEELLFKNSIIGVLHEFPDKISCNFHVTQQGCEVEPYLQPHTTSGRISEEELRRYVDPVRT---LCYLCGPPPMIESVSTVLQRLGLPQNRILFEKWW 303          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Sea Lamprey
Match: oxnad1 (oxidoreductase NAD-binding domain containing 1 [Source:NCBI gene;Acc:558500])

HSP 1 Score: 105.916 bits (263), Expect = 9.950e-28
Identity = 77/257 (29.96%), Postives = 127/257 (49.42%), Query Frame = 1
Query:   16 IIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSCNDNE-------VELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFD----DSYLNGTNIFIAGGIGINPIICILDYA-----NRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFI-------TEEISANSSFIHRRISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLVKYLVV-DKVIIEKW 714
            ++ + + S  VK +KL I   +NQ+F ++ GQWVDF  P   +  G+S   C++ E        ELAVK S    + W+H   KVG  V++++GG F FD    D  +N   + +AGG+GINP+  IL +       R L        K  L ++++ + ELIF D L  +++        ++ I       TE++   ++    RI+ +D+     +    + + F+CGP+ M D+  D L    +  DK+  EKW
Sbjct:   33 VVGMWDESSTVKGLKLRI---HNQQFTFKAGQWVDFYAPGIAEMTGFSF--CSNPEQMESESIFELAVKDSVDNPAHWVHTQCKVGVEVTVRVGGDFYFDPRPSDPPVN--LLLVAGGVGINPLRSILMHCVHLMRQRVLTQAGYQLGKIHLIFTARTISELIFKDWLLSLVQEFPGKMSLRFHITRCKSPVTEDLKPYTTV--GRITGQDLL----QASQGSPHCFVCGPSSMYDFVTDALGGAGIPKDKIFYEKW 276          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Yeast
Match: CBR1 (Cytochrome b reductase; not essential for viability; also detected in mitochondria; mutation in conserved NADH binding domain of the human ortholog results in type I methemoglobinemia [Source:SGD;Acc:S000001305])

HSP 1 Score: 49.6766 bits (117), Expect = 9.547e-8
Identity = 40/163 (24.54%), Postives = 75/163 (46.01%), Query Frame = 1
Query:  187 ELAVKRSDCIVSSWLHNSSKVGDNVSIK-IGGSFTFDD---SYLNGTNIFIAGGIGINPIICILDYANRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFI----TEEISANSSFIHRRISHEDIKDVISKIDTNNCNAFICGPNQMI 651
            EL VK       S +    K+GD++ IK   G++ ++    S+L      IAGG GI P+  I+    + +   P D++K  L + + + E+++    LE ++      F+  Y++     E+ +    +I + +    IK+ +     +N    ICGP  M+
Sbjct:  106 ELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLG----MIAGGTGIAPMYQIM----KAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSPDREDWTGGVGYITKDV----IKEHLPAATMDNVQILICGPPAMV 256          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Nematostella
Match: EDO42208 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S220])

HSP 1 Score: 115.931 bits (289), Expect = 4.784e-31
Identity = 74/246 (30.08%), Postives = 118/246 (47.97%), Query Frame = 1
Query:   16 IIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTF-DDSYLNGTNIFIAGGIGINPIICILDYANRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSSFIHR-----RISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLVKY-LVVDKVIIEKWW 717
            ++DI+ +S  VK + L +    N  F ++PGQWVDF  P      G+SI S      +    ELAVK S    + W+H   K GD V +++GG F +          + IAGG+GINP+  ++ +     + +   +    L YS+   EEL+F D +  + + N  +   K+F+T+E       I +     RI+ + ++  IS  D +     +CGP  M  +  D LV   L   ++  EKWW
Sbjct:   64 VVDIKKLSDTVKGLTLKVAE--NSHFIFKPGQWVDFFAPGVSVVGGFSICSSPSQLHSHRSFELAVKYSTHPPAHWVHTKCKPGDEVQVRVGGDFHYIKQKGCKDDLLLIAGGVGINPLWSMMQF-----VCEEKHTGNISLLYSASTQEELLFKDSISTLCEKN-PSVTCKFFVTKE-KLERDMIDKYTQTGRITEDSLRSAISDKDRSTLRVLLCGPPNMTQFLLDNLVNLGLESSQIKFEKWW 300          
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Medaka
Match: oxnad1 (oxidoreductase NAD binding domain containing 1 [Source:NCBI gene;Acc:101157627])

HSP 1 Score: 108.227 bits (269), Expect = 1.235e-27
Identity = 67/254 (26.38%), Postives = 124/254 (48.82%), Query Frame = 1
Query:   13 KIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSC-----NDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTN--IFIAGGIGINPIICILDYANRKLITKPSDSSK------YFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSSFIHR-----RISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLVKY-LVVDKVIIEKWW 717
            ++  I + S  VK +++ +  D    F ++ GQWVDF +P  +K  G+S+ S       +  +ELA+K +    + W+H    VG  V++++GG F FD S  +     + +AGG+GINP+  IL +A   L    + + +        L YS+KN +EL+F   +    +         + +T++ +     +       RI+ E+++   + +D      ++CGP  MI+   + L    L  ++++ EKWW
Sbjct:   66 QVCGITSESETVKRLRIAVPPD----FVFKAGQWVDFFIPGVEKVGGFSMCSSPALLHREGVIELAIKYTKHPPAHWVHTMCAVGSRVAVRVGGDFFFDPSPSDPPVDLLLVAGGVGINPLYSILLHAKDLLHLSQASADRGCNIGSTHLCYSAKNTQELLFKTSIIEACREFPDKISCSFHVTQQSADVDPHLQPFVKSGRITEEELE---ASVDPQRTLCYLCGPPPMIEAISETLTDLGLPKNRILYEKWW 312          
BLAST of FAD-binding FR-type domain-containing protein vs. Planmine SMEST
Match: SMESG000050320.1 (SMESG000050320.1)

HSP 1 Score: 481.485 bits (1238), Expect = 3.562e-175
Identity = 238/239 (99.58%), Postives = 238/239 (99.58%), Query Frame = 1
Query:    1 MKCCKIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSCNDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTNIFIAGGIGINPIICILDYANRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSSFIHRRISHEDIKDVISKIDTNNCNAFICGPNQMIDYFYDFLVKYLVVDKVIIEKWW 717
            MKCCKIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSCNDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTNIFIAGGIGINPIICILDYANRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSSFIHRRISHEDIKDVI KIDTNNCNAFICGPNQMIDYFYDFLVKYLVVDKVIIEKWW
Sbjct:    1 MKCCKIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAAGYSIVSCNDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDSYLNGTNIFIAGGIGINPIICILDYANRKLITKPSDSSKYFLFYSSKNVEELIFLDRLERILKTNGKNFQFKYFITEEISANSSFIHRRISHEDIKDVIRKIDTNNCNAFICGPNQMIDYFYDFLVKYLVVDKVIIEKWW 239          
The following BLAST results are available for this feature:
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OXNAD19.568e-3230.16oxidoreductase NAD binding domain containing 1 [So... [more]
OXNAD11.684e-3131.94oxidoreductase NAD binding domain containing 1 [So... [more]
OXNAD11.684e-3131.94oxidoreductase NAD binding domain containing 1 [So... [more]
OXNAD12.230e-3131.94oxidoreductase NAD binding domain containing 1 [So... [more]
OXNAD12.230e-3131.94oxidoreductase NAD binding domain containing 1 [So... [more]
back to top
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
oxnad17.629e-3130.28oxidoreductase NAD-binding domain containing 1 [So... [more]
oxnad18.912e-3130.28oxidoreductase NAD-binding domain containing 1 [So... [more]
oxnad11.534e-3030.28oxidoreductase NAD-binding domain containing 1 [So... [more]
oxnad14.498e-2329.28oxidoreductase NAD-binding domain containing 1 [So... [more]
back to top
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
got11.691e-3131.20glutamic-oxaloacetic transaminase 1 [Source:Xenbas... [more]
got12.401e-3131.20glutamic-oxaloacetic transaminase 1 [Source:Xenbas... [more]
back to top
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Oxnad15.614e-3329.84oxidoreductase NAD-binding domain containing 1 [So... [more]
Oxnad13.388e-1032.50oxidoreductase NAD-binding domain containing 1 [So... [more]
Oxnad17.288e-1034.07oxidoreductase NAD-binding domain containing 1 [So... [more]
Oxnad17.202e-934.94oxidoreductase NAD-binding domain containing 1 [So... [more]
Oxnad14.078e-836.36oxidoreductase NAD-binding domain containing 1 [So... [more]
back to top
BLAST of FAD-binding FR-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VE38|OXND1_MOUSE3.927e-3229.84Oxidoreductase NAD-binding domain-containing prote... [more]
sp|Q96HP4|OXND1_HUMAN8.089e-3131.94Oxidoreductase NAD-binding domain-containing prote... [more]
sp|A4IHY0|OXND1_XENTR8.958e-3131.20Oxidoreductase NAD-binding domain-containing prote... [more]
sp|Q5R4D2|OXND1_PONAB9.480e-3129.76Oxidoreductase NAD-binding domain-containing prote... [more]
sp|A3KP77|OXND1_DANRE2.772e-3030.28Oxidoreductase NAD-binding domain-containing prote... [more]
back to top
BLAST of FAD-binding FR-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2G8L8W72.768e-3632.69Putative oxidoreductase NAD-binding domain-contain... [more]
A0A1S3JTQ33.827e-3632.66oxidoreductase NAD-binding domain-containing prote... [more]
H2ZJN91.447e-3431.35FAD-binding FR-type domain-containing protein OS=C... [more]
A0A2Z6R1S31.507e-3334.52FAD-binding FR-type domain-containing protein OS=R... [more]
A0A3Q0JMN12.499e-3330.24oxidoreductase NAD-binding domain-containing prote... [more]
back to top
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
oxnad12.423e-2928.40oxidoreductase NAD binding domain containing 1 [So... [more]
oxnad12.423e-2928.40oxidoreductase NAD binding domain containing 1 [So... [more]
back to top
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxnad19.950e-2829.96oxidoreductase NAD-binding domain containing 1 [So... [more]
back to top
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CBR19.547e-824.54Cytochrome b reductase; not essential for viabilit... [more]
back to top
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO422084.784e-3130.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FAD-binding FR-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxnad11.235e-2726.38oxidoreductase NAD binding domain containing 1 [So... [more]
back to top
BLAST of FAD-binding FR-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000050320.13.562e-17599.58SMESG000050320.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003361 ID=SMED30003361|Name=FAD-binding FR-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=735bp
ATGAAGTGTTGCAAAATAATAGATATTCAAAATGTTTCACCATTAGTTAA
ATTAGTTAAGTTGTTTATTAATAATGATTATAATCAAAAATTTCAATATC
GTCCTGGTCAGTGGGTAGATTTTGTAGTTCCAGATAAAAAGAAGGCCGCT
GGTTACTCTATAGTGTCTTGTAATGACAATGAAGTGGAATTAGCAGTAAA
AAGGAGTGATTGTATAGTTTCAAGTTGGCTACACAACTCATCTAAGGTTG
GTGATAATGTATCTATAAAAATTGGTGGCTCATTTACTTTCGACGATAGC
TATTTAAATGGAACCAATATTTTTATTGCTGGAGGTATCGGAATTAATCC
AATCATTTGTATATTAGATTATGCTAACAGAAAATTAATTACTAAACCAA
GTGATTCATCAAAATACTTTTTGTTCTATAGTTCTAAAAATGTAGAGGAA
TTAATATTTCTTGACAGATTAGAAAGAATTTTAAAAACAAATGGAAAAAA
TTTTCAGTTTAAATATTTCATTACTGAAGAAATCAGTGCAAATTCATCCT
TTATCCACCGACGGATTTCGCATGAAGACATTAAAGACGTTATAAGCAAA
ATAGATACTAATAACTGTAATGCATTTATTTGTGGTCCGAATCAAATGAT
TGATTATTTTTATGATTTTCTTGTTAAGTATTTGGTCGTTGATAAAGTTA
TAATAGAAAAATGGTGGTGAAAATATCAGATGAAC
back to top

protein sequence of SMED30003361-orf-1

>SMED30003361-orf-1 ID=SMED30003361-orf-1|Name=SMED30003361-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=240bp
MKCCKIIDIQNVSPLVKLVKLFINNDYNQKFQYRPGQWVDFVVPDKKKAA
GYSIVSCNDNEVELAVKRSDCIVSSWLHNSSKVGDNVSIKIGGSFTFDDS
YLNGTNIFIAGGIGINPIICILDYANRKLITKPSDSSKYFLFYSSKNVEE
LIFLDRLERILKTNGKNFQFKYFITEEISANSSFIHRRISHEDIKDVISK
IDTNNCNAFICGPNQMIDYFYDFLVKYLVVDKVIIEKWW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR039261FNR_nucleotide-bd
IPR001221Phe_hydroxylase
IPR001433OxRdtase_FAD/NAD-bd
IPR017927FAD-bd_FR_type
IPR017938Riboflavin_synthase-like_b-brl
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00410PHEHYDRXLASEcoord: 107..126
score: 37.89
coord: 33..45
score: 31.58
coord: 207..215
score: 36.84
NoneNo IPR availableGENE3DG3DSA:2.40.30.10coord: 2..92
e-value: 3.2E-14
score: 54.7
NoneNo IPR availablePANTHERPTHR46505FAMILY NOT NAMEDcoord: 4..239
NoneNo IPR availableCDDcd00322FNR_likecoord: 9..234
e-value: 9.20328E-39
score: 132.186
IPR039261Ferredoxin-NADP reductase (FNR), nucleotide-binding domainGENE3DG3DSA:3.40.50.80coord: 96..239
e-value: 2.1E-24
score: 88.2
IPR039261Ferredoxin-NADP reductase (FNR), nucleotide-binding domainSUPERFAMILYSSF52343Ferredoxin reductase-like, C-terminal NADP-linked domaincoord: 93..227
IPR001433Oxidoreductase FAD/NAD(P)-bindingPFAMPF00175NAD_binding_1coord: 108..219
e-value: 1.9E-11
score: 44.6
IPR017927FAD-binding domain, ferredoxin reductase-typePROSITEPS51384FAD_FRcoord: 1..100
score: 10.604
IPR017938Riboflavin synthase-like beta-barrelSUPERFAMILYSSF63380Riboflavin synthase domain-likecoord: 4..89