nucleoporin 50 kDa

Overview
Namenucleoporin 50 kDa (AKG62120.1)
Smed IDSMED30003359
Length (bp)1198
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of nucleoporin 50 kDa (SMED30003359) t-SNE clustered cells

Violin plots show distribution of expression levels for nucleoporin 50 kDa (SMED30003359) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of nucleoporin 50 kDa (SMED30003359) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for nucleoporin 50 kDa (SMED30003359) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003359

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30003359h1SMcG0017058 SmedASXL_007001SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30003359h1SMcG0017058 Contig40010newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003359h1SMcG0017058 Contig40010uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30003359h1SMcG0017058 dd_Smed_v4_5140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003359h1SMcG0017058 dd_Smed_v4_5140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003359h1SMcG0017058 dd_Smed_v4_5140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003359h1SMcG0017058 dd_Smed_v4_5140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003359h1SMcG0017058 dd_Smed_v4_5140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of nucleoporin 50 kDa vs. Ensembl Human
Match: NUP50 (nucleoporin 50 [Source:HGNC Symbol;Acc:HGNC:8065])

HSP 1 Score: 94.3597 bits (233), Expect = 1.850e-20
Identity = 97/303 (32.01%), Postives = 138/303 (45.54%), Query Frame = 1
Query:  343 LKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYPLTTMPDSKISSNWTEIGTTVSTPSTI--------PVFSFLKDKTEAVDNFQFGLKNADVPKPFTFSTTESLPLFGLPAASTAEVKNST---IGFS---NSSSLFGI------PSSSTMNTVAXXXXXXXXXXXXXXXXXX------------FKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVT-KNNVSFVA-----MTDFCKEMKLTPLLIRVKTPEEAEAL 1137
            L  LN    + I KH+  NP+C LTP   DY K L  I+ ++   +  +S+  SN  ++     +PS            F F  +KTE   + +  + +     P +   T +   FG    S+     S+    GFS    +SSLFG       P SS   T       E +         E             KE D+ Y  +CKLFY+ D+E+K +G+G L +KP    K QL++RAD +L  ILLNVLI   MP + T KNNV  V      + +    M +T +LIRVKT E+A+ L
Sbjct:  160 LAALNCSVRDWIVKHVNTNPLCDLTPIFKDYEKYLANIEQQH-GNSGRNSESESN--KVAAETQSPSLFGSTKLQQESTFLFHGNKTEDTPDKKMEVASEKKTDPSSLGATSASFNFGKKVDSSVLGSLSSVPLTGFSFSPGNSSLFGKDTTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVT-MLIRVKTSEDADEL 458          
BLAST of nucleoporin 50 kDa vs. Ensembl Human
Match: NUP50 (nucleoporin 50 [Source:HGNC Symbol;Acc:HGNC:8065])

HSP 1 Score: 93.9745 bits (232), Expect = 2.269e-20
Identity = 97/303 (32.01%), Postives = 138/303 (45.54%), Query Frame = 1
Query:  343 LKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYPLTTMPDSKISSNWTEIGTTVSTPSTI--------PVFSFLKDKTEAVDNFQFGLKNADVPKPFTFSTTESLPLFGLPAASTAEVKNST---IGFS---NSSSLFGI------PSSSTMNTVAXXXXXXXXXXXXXXXX------------XXFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVT-KNNVSFVA-----MTDFCKEMKLTPLLIRVKTPEEAEAL 1137
            L  LN    + I KH+  NP+C LTP   DY K L  I+ ++  +   +S+  SN  ++     +PS            F F  +KTE   + +  + +     P +   T +   FG    S+     S+    GFS    +SSLFG       P SS   T       E +                     E KE D+ Y  +CKLFY+ D+E+K +G+G L +KP    K QL++RAD +L  ILLNVLI   MP + T KNNV  V      + +    M +T +LIRVKT E+A+ L
Sbjct:  132 LAALNCSVRDWIVKHVNTNPLCDLTPIFKDYEKYLANIEQQHGNSGR-NSESESN--KVAAETQSPSLFGSTKLQQESTFLFHGNKTEDTPDKKMEVASEKKTDPSSLGATSASFNFGKKVDSSVLGSLSSVPLTGFSFSPGNSSLFGKDTTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVT-MLIRVKTSEDADEL 430          
BLAST of nucleoporin 50 kDa vs. Ensembl Human
Match: NUP50 (nucleoporin 50 [Source:HGNC Symbol;Acc:HGNC:8065])

HSP 1 Score: 93.9745 bits (232), Expect = 2.269e-20
Identity = 97/303 (32.01%), Postives = 138/303 (45.54%), Query Frame = 1
Query:  343 LKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYPLTTMPDSKISSNWTEIGTTVSTPSTI--------PVFSFLKDKTEAVDNFQFGLKNADVPKPFTFSTTESLPLFGLPAASTAEVKNST---IGFS---NSSSLFGI------PSSSTMNTVAXXXXXXXXXXXXXXXX------------XXFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVT-KNNVSFVA-----MTDFCKEMKLTPLLIRVKTPEEAEAL 1137
            L  LN    + I KH+  NP+C LTP   DY K L  I+ ++  +   +S+  SN  ++     +PS            F F  +KTE   + +  + +     P +   T +   FG    S+     S+    GFS    +SSLFG       P SS   T       E +                     E KE D+ Y  +CKLFY+ D+E+K +G+G L +KP    K QL++RAD +L  ILLNVLI   MP + T KNNV  V      + +    M +T +LIRVKT E+A+ L
Sbjct:  132 LAALNCSVRDWIVKHVNTNPLCDLTPIFKDYEKYLANIEQQHGNSGR-NSESESN--KVAAETQSPSLFGSTKLQQESTFLFHGNKTEDTPDKKMEVASEKKTDPSSLGATSASFNFGKKVDSSVLGSLSSVPLTGFSFSPGNSSLFGKDTTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVT-MLIRVKTSEDADEL 430          
BLAST of nucleoporin 50 kDa vs. Ensembl Human
Match: NUP50 (nucleoporin 50 [Source:HGNC Symbol;Acc:HGNC:8065])

HSP 1 Score: 55.0694 bits (131), Expect = 1.899e-8
Identity = 23/46 (50.00%), Postives = 33/46 (71.74%), Query Frame = 1
Query:  835 KENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRAD 972
            KE D+ Y  +CKLFY+ D+E+K +G+G L +KP    K QL++RAD
Sbjct:  132 KEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRAD 177          
BLAST of nucleoporin 50 kDa vs. Ensembl Fly
Match: Nup50 (gene:FBgn0033264 transcript:FBtr0088783)

HSP 1 Score: 88.5817 bits (218), Expect = 9.083e-19
Identity = 45/109 (41.28%), Postives = 74/109 (67.89%), Query Frame = 1
Query:  838 ENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKG-KFQLVLRADNSLATILLNVLINDKMPLS-VTKNNVSFVAMTDFCKEMKLTPLLIRVKTPEEAEALLEAMKRQ 1158
            E+D++Y  RCK+F + D ++ +RGVG L++KP++   K QL++RAD +L  IL+N++++  +P   + KNNV  V +    ++ K T LL+RVKT +EA+ LLE +K  
Sbjct:  455 EDDAIYSKRCKVFIKKDKDFGDRGVGTLYLKPVKDSEKIQLLVRADTNLGNILVNLILSKGIPCQRMGKNNVLMVCVPT-PEDSKATSLLLRVKTGDEADDLLEKIKEH 562          

HSP 2 Score: 51.2174 bits (121), Expect = 1.169e-6
Identity = 36/89 (40.45%), Postives = 46/89 (51.69%), Query Frame = 1
Query:   70 KRNATSDLNHSNWDXXXXXXXRGEFVTANKNIISQRKVIQARRKPTSNST--------------NNVFKSFSGFSN-TINPPSNNMLSF 291
            KR ATS+LNH NWD EEE EERG F TA +  +  R + +ARRK    S+               +VF  FSGF     +P + +  SF
Sbjct:    4 KRQATSNLNHENWDLEEEPEERGTFRTATEEELKTRVIKKARRKIAGGSSAAEEDGAEEKTAEPKSVFSGFSGFGKPAASPAAGSPFSF 92          
BLAST of nucleoporin 50 kDa vs. Ensembl Zebrafish
Match: nup50 (nucleoporin 50 [Source:ZFIN;Acc:ZDB-GENE-030131-1689])

HSP 1 Score: 88.1965 bits (217), Expect = 9.899e-19
Identity = 48/114 (42.11%), Postives = 70/114 (61.40%), Query Frame = 1
Query:  832 FKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVT-KNNVSFVAMTDFCKEMK----LTPLLIRVKTPEEAEALLEAMKRQ 1158
             KE D+ Y  +CKLFY+ D E+K +GVG L +K   + K QL++RAD +L  ILLN+++   MP S T KNNV  V + +   + K      P+LIRVKT E+A+ L   ++ +
Sbjct:  307 IKEKDAFYSKKCKLFYKKDGEFKEKGVGTLHLKMTTESKLQLLVRADTNLGNILLNIMVPSSMPCSRTGKNNVMVVCVPNPPVDDKNPSVPVPVLIRVKTAEDADQLHRVLQEK 420          
BLAST of nucleoporin 50 kDa vs. Ensembl Zebrafish
Match: nup50 (nucleoporin 50 [Source:ZFIN;Acc:ZDB-GENE-030131-1689])

HSP 1 Score: 88.1965 bits (217), Expect = 9.899e-19
Identity = 48/114 (42.11%), Postives = 70/114 (61.40%), Query Frame = 1
Query:  832 FKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVT-KNNVSFVAMTDFCKEMK----LTPLLIRVKTPEEAEALLEAMKRQ 1158
             KE D+ Y  +CKLFY+ D E+K +GVG L +K   + K QL++RAD +L  ILLN+++   MP S T KNNV  V + +   + K      P+LIRVKT E+A+ L   ++ +
Sbjct:  307 IKEKDAFYSKKCKLFYKKDGEFKEKGVGTLHLKMTTESKLQLLVRADTNLGNILLNIMVPSSMPCSRTGKNNVMVVCVPNPPVDDKNPSVPVPVLIRVKTAEDADQLHRVLQEK 420          
BLAST of nucleoporin 50 kDa vs. Ensembl Zebrafish
Match: nup50 (nucleoporin 50 [Source:ZFIN;Acc:ZDB-GENE-030131-1689])

HSP 1 Score: 88.1965 bits (217), Expect = 9.899e-19
Identity = 48/114 (42.11%), Postives = 70/114 (61.40%), Query Frame = 1
Query:  832 FKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVT-KNNVSFVAMTDFCKEMK----LTPLLIRVKTPEEAEALLEAMKRQ 1158
             KE D+ Y  +CKLFY+ D E+K +GVG L +K   + K QL++RAD +L  ILLN+++   MP S T KNNV  V + +   + K      P+LIRVKT E+A+ L   ++ +
Sbjct:  307 IKEKDAFYSKKCKLFYKKDGEFKEKGVGTLHLKMTTESKLQLLVRADTNLGNILLNIMVPSSMPCSRTGKNNVMVVCVPNPPVDDKNPSVPVPVLIRVKTAEDADQLHRVLQEK 420          
BLAST of nucleoporin 50 kDa vs. Ensembl Xenopus
Match: snx16 (sorting nexin 16 [Source:Xenbase;Acc:XB-GENE-1015835])

HSP 1 Score: 112.079 bits (279), Expect = 7.901e-27
Identity = 97/297 (32.66%), Postives = 143/297 (48.15%), Query Frame = 1
Query:  328 KHINSLKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYPLTTMPDSKISSNWTEIGTTVSTPSTIPVFSFLKDKTEAVDNFQFGLKNADVPKPFTFSTTESLPLFGLPAASTAE-VKNSTIGF------------SNSSSLFGIPSSSTMNTVAXXXXXXXXXXXX---------XXXXXXFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVT-KNNVSFVAMTDFCKEMK----LTPLLIRVKTPEEAEAL 1137
            KH+ SL   N    + I KH+  NP+C L+P   DY K+L+ I+ KY          SS+        +   TIP    +K   + +  F FG K+   P     +  +S P    P  +  + V +ST+              + +SSLFG  + ST ++                        A ++E KE+D+ Y  +CKLFY+ D+E+K +GVG L +KP+E  K QL++RAD +L  ILLN+L+   MP S T KNNV  V + +   + K       LLIRVKT E+A+ L
Sbjct:  122 KHLTSL---NCSVRDWIVKHVNTNPLCDLSPIFRDYEKHLSAIEQKY--------GASSDSGSESDGAAQTKTIPTLHSIK--ADPIATFSFGSKD-KAPGVPVKTPPDSKPQAAAPTFNFGQKVDSSTLSLIGSGGAPSFSFSTGASSLFGKSTGSTASSSQESEPSSNTEGKGDGEEEEEPPKAVIQEVKEDDAFYSKKCKLFYKKDNEFKEKGVGTLHLKPVENKKTQLLVRADTNLGNILLNILVQPSMPCSRTGKNNVMVVCVPNPPIDEKNPTVPATLLIRVKTAEDADEL 404          
BLAST of nucleoporin 50 kDa vs. Ensembl Xenopus
Match: snx16 (sorting nexin 16 [Source:Xenbase;Acc:XB-GENE-1015835])

HSP 1 Score: 111.694 bits (278), Expect = 1.052e-26
Identity = 103/297 (34.68%), Postives = 149/297 (50.17%), Query Frame = 1
Query:  328 KHINSLKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYPLTTMPDSKISSNWTEIGTTVSTPSTIPVFSFLKDKTEAVDNFQFGLKNADVPKPFTFSTTESLPLFGLPAASTAE-VKNSTIGF------------SNSSSLFGIPSSSTMNT---------VAXXXXXXXXXXXXXXXXXXFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVT-KNNVSFVAMTDFCKEMK----LTPLLIRVKTPEEAEAL 1137
            KH+ SL   N    + I KH+  NP+C L+P   DY K+L+ I+ KY          SS+        +   TIP    +K   + +  F FG K+     P   +  +S P    P  +  + V +ST+              + +SSLFG  + ST ++              D EEE  PP A ++E KE+D+ Y  +CKLFY+ D+E+K +GVG L +KP+E  K QL++RAD +L  ILLN+L+   MP S T KNNV  V + +   + K       LLIRVKT E+A+ L
Sbjct:  123 KHLTSL---NCSVRDWIVKHVNTNPLCDLSPIFRDYEKHLSAIEQKY--------GASSDSGSESDGAAQTKTIPTLHSIK--ADPIATFSFGSKDKAPGVPVK-TPPDSKPQAAAPTFNFGQKVDSSTLSLIGSGGAPSFSFSTGASSLFGKSTGSTASSSQESEPSSNTEGKGDGEEEEEPPKAVIQEVKEDDAFYSKKCKLFYKKDNEFKEKGVGTLHLKPVENKKTQLLVRADTNLGNILLNILVQPSMPCSRTGKNNVMVVCVPNPPIDEKNPTVPATLLIRVKTAEDADEL 405          
BLAST of nucleoporin 50 kDa vs. Ensembl Mouse
Match: Nup50 (nucleoporin 50 [Source:MGI Symbol;Acc:MGI:1351502])

HSP 1 Score: 86.2705 bits (212), Expect = 7.095e-18
Identity = 51/106 (48.11%), Postives = 67/106 (63.21%), Query Frame = 1
Query:  835 KENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVT-KNNVSFVAMTDFCKEMKLTPL----LIRVKTPEEAEAL 1137
            KE D+ Y  +CKLFY+ D+E+K +GVG L +KP    K QL++RAD +L  ILLNVLI   MP + T KNNV  V + +   + K   L    LIRVKT E+A+ L
Sbjct:  351 KEEDAFYSKKCKLFYKKDNEFKEKGVGTLHLKPTATQKTQLLVRADTNLGNILLNVLIAPNMPCTRTGKNNVLIVCVPNPPLDEKQPTLPATMLIRVKTSEDADEL 456          
BLAST of nucleoporin 50 kDa vs. Ensembl Mouse
Match: Nup50 (nucleoporin 50 [Source:MGI Symbol;Acc:MGI:1351502])

HSP 1 Score: 86.2705 bits (212), Expect = 7.095e-18
Identity = 51/106 (48.11%), Postives = 67/106 (63.21%), Query Frame = 1
Query:  835 KENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVT-KNNVSFVAMTDFCKEMKLTPL----LIRVKTPEEAEAL 1137
            KE D+ Y  +CKLFY+ D+E+K +GVG L +KP    K QL++RAD +L  ILLNVLI   MP + T KNNV  V + +   + K   L    LIRVKT E+A+ L
Sbjct:  351 KEEDAFYSKKCKLFYKKDNEFKEKGVGTLHLKPTATQKTQLLVRADTNLGNILLNVLIAPNMPCTRTGKNNVLIVCVPNPPLDEKQPTLPATMLIRVKTSEDADEL 456          
BLAST of nucleoporin 50 kDa vs. Ensembl Mouse
Match: 1700123L14Rik (RIKEN cDNA 1700123L14 gene [Source:MGI Symbol;Acc:MGI:1925732])

HSP 1 Score: 72.7886 bits (177), Expect = 1.415e-13
Identity = 86/291 (29.55%), Postives = 135/291 (46.39%), Query Frame = 1
Query:  343 LKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYPLTTMPDSKISSNWTEIGTTVSTPSTIPVFSFLK------DKTE-------------AVDNFQFGLKNADVPKPFTFSTTESLPLFGLPAAS-TAEVKNSTIGFSNSSSLFGIPSSSTMNTVAXXXXXXXXXXXXXXXXXXFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLS-VTKNNVSFVAMTD-----FCKEMKLTPLLIRVKTPEEAEAL 1137
            L  LN    + I KH+  NP C LTP    Y K L  I+ +   +    S+   N   +   V+ P  + V + L+      +KTE                +  FG KN + P    + +  S P+  + +A+ ++ V          +S   + S +  N+    +  EEE      E    +E  + Y  +CKLFY+ D+E+K +GVG L++K     K +L++R D  L +ILLN+LI   MP S + KNNV  V + D         +K+T +LIRVKT ++A+ L
Sbjct:  148 LTGLNCSVRDWIVKHVNANPFCDLTPVFKQYEKYLAAIEKQLHSSCGCLSESEPNRGFV--AVTQPPFLAVATELQPELVTSEKTEFMCEKKANSAQGATSTSCNFG-KNTETP---AWGSLNSGPMHRVSSATRSSNVSGKGTTRKKPASAKALESPAQGNSDECKLLVEEEEEEEEEEEEGEEEESAFYCKKCKLFYKKDNEFKEKGVGTLYLKSTANQKTKLLVR-DTKLGSILLNILIPPDMPCSRMGKNNVLIVCVPDPPLDKKNATIKVT-MLIRVKTSKDADEL 430          
BLAST of nucleoporin 50 kDa vs. UniProt/SwissProt
Match: sp|O08587|NUP50_RAT (Nuclear pore complex protein Nup50 OS=Rattus norvegicus OX=10116 GN=Nup50 PE=2 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 4.428e-20
Identity = 103/308 (33.44%), Postives = 138/308 (44.81%), Query Frame = 1
Query:  343 LKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYPLTTMPDSKISSNWTEIGTTVSTPSTI---------PVFSFLKDKTEAVD--------------------NFQFGLK---------NADVPKPFTFSTTESLPLFGLPAASTAEVKNSTIGFSNSSSLFGIPSSSTMNTVAXXXXXXXXXXXXXXXXXXFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVT-KNNVSFVAMTDFCKEMKLTPL----LIRVKTPEEAEAL 1137
            L  LN    + I KH+  NP+C LTP   DY + L  I+ +        S  S   T+  T    P ++           FSF  +K E                       +F FG K         ++     F+FS   S  LFG  AA + +  +S      S S  G  SS   +      +EEE   PP   V E KE D+ Y  +CKLFY+ D+E+K +GVG L +KP    K QL++RAD +L  ILLNVLI   MP + T KNNV  V + +   + K   L    LIRVKT E+A+ L
Sbjct:  160 LAGLNCSVRDWIVKHVNTNPLCDLTPIFKDYERYLATIEKQL---ENGGSSSSERQTDRATAAMEPPSLFGSTKLQQDSPFSFHGNKAEDTSEKLEFTAEKKSDAAQGATSASFNFGKKIESSVLGSLSSGSLTGFSFSPGNS-SLFGKDAAQS-KAASSPFSAKASESQAGGSSSECRD-----GEEEESDEPPKVVVTEVKEEDAFYSKKCKLFYKKDNEFKEKGVGTLHLKPTATQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPLDEKQPTLPVTMLIRVKTSEDADEL 457          
BLAST of nucleoporin 50 kDa vs. UniProt/SwissProt
Match: sp|Q9UKX7|NUP50_HUMAN (Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 8.886e-20
Identity = 97/303 (32.01%), Postives = 138/303 (45.54%), Query Frame = 1
Query:  343 LKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYPLTTMPDSKISSNWTEIGTTVSTPSTI--------PVFSFLKDKTEAVDNFQFGLKNADVPKPFTFSTTESLPLFGLPAASTAEVKNST---IGFS---NSSSLFGI------PSSSTMNTVAXXXXXXXXXXXXXXXXXX------------FKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVT-KNNVSFVA-----MTDFCKEMKLTPLLIRVKTPEEAEAL 1137
            L  LN    + I KH+  NP+C LTP   DY K L  I+ ++   +  +S+  SN  ++     +PS            F F  +KTE   + +  + +     P +   T +   FG    S+     S+    GFS    +SSLFG       P SS   T       E +         E             KE D+ Y  +CKLFY+ D+E+K +G+G L +KP    K QL++RAD +L  ILLNVLI   MP + T KNNV  V      + +    M +T +LIRVKT E+A+ L
Sbjct:  160 LAALNCSVRDWIVKHVNTNPLCDLTPIFKDYEKYLANIEQQH-GNSGRNSESESN--KVAAETQSPSLFGSTKLQQESTFLFHGNKTEDTPDKKMEVASEKKTDPSSLGATSASFNFGKKVDSSVLGSLSSVPLTGFSFSPGNSSLFGKDTTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVT-MLIRVKTSEDADEL 458          
BLAST of nucleoporin 50 kDa vs. UniProt/SwissProt
Match: sp|Q7K0D8|NUP50_DROME (Nuclear pore complex protein Nup50 OS=Drosophila melanogaster OX=7227 GN=Nup50 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 9.105e-18
Identity = 45/109 (41.28%), Postives = 74/109 (67.89%), Query Frame = 1
Query:  838 ENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKG-KFQLVLRADNSLATILLNVLINDKMPLS-VTKNNVSFVAMTDFCKEMKLTPLLIRVKTPEEAEALLEAMKRQ 1158
            E+D++Y  RCK+F + D ++ +RGVG L++KP++   K QL++RAD +L  IL+N++++  +P   + KNNV  V +    ++ K T LL+RVKT +EA+ LLE +K  
Sbjct:  455 EDDAIYSKRCKVFIKKDKDFGDRGVGTLYLKPVKDSEKIQLLVRADTNLGNILVNLILSKGIPCQRMGKNNVLMVCVPT-PEDSKATSLLLRVKTGDEADDLLEKIKEH 562          
BLAST of nucleoporin 50 kDa vs. UniProt/SwissProt
Match: sp|Q9JIH2|NUP50_MOUSE (Nuclear pore complex protein Nup50 OS=Mus musculus OX=10090 GN=Nup50 PE=1 SV=3)

HSP 1 Score: 86.2705 bits (212), Expect = 4.963e-17
Identity = 51/106 (48.11%), Postives = 67/106 (63.21%), Query Frame = 1
Query:  835 KENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVT-KNNVSFVAMTDFCKEMKLTPL----LIRVKTPEEAEAL 1137
            KE D+ Y  +CKLFY+ D+E+K +GVG L +KP    K QL++RAD +L  ILLNVLI   MP + T KNNV  V + +   + K   L    LIRVKT E+A+ L
Sbjct:  351 KEEDAFYSKKCKLFYKKDNEFKEKGVGTLHLKPTATQKTQLLVRADTNLGNILLNVLIAPNMPCTRTGKNNVLIVCVPNPPLDEKQPTLPATMLIRVKTSEDADEL 456          
BLAST of nucleoporin 50 kDa vs. TrEMBL
Match: A0A0F7GXZ8 (Nucleoporin 50 kDa (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 4.570e-123
Identity = 201/201 (100.00%), Postives = 201/201 (100.00%), Query Frame = 1
Query:  556 FSFLKDKTEAVDNFQFGLKNADVPKPFTFSTTESLPLFGLPAASTAEVKNSTIGFSNSSSLFGIPSSSTMNTVAXXXXXXXXXXXXXXXXXXFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVTKNNVSFVAMTDFCKEMKLTPLLIRVKTPEEAEALLEAMKRQ 1158
            FSFLKDKTEAVDNFQFGLKNADVPKPFTFSTTESLPLFGLPAASTAEVKNSTIGFSNSSSLFGIPSSSTMNTVAPIVDEEEEYVPPVAEVREFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVTKNNVSFVAMTDFCKEMKLTPLLIRVKTPEEAEALLEAMKRQ
Sbjct:   14 FSFLKDKTEAVDNFQFGLKNADVPKPFTFSTTESLPLFGLPAASTAEVKNSTIGFSNSSSLFGIPSSSTMNTVAPIVDEEEEYVPPVAEVREFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVTKNNVSFVAMTDFCKEMKLTPLLIRVKTPEEAEALLEAMKRQ 214          
BLAST of nucleoporin 50 kDa vs. TrEMBL
Match: A0A4Z2D6J7 (Nuclear pore complex protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_004072 PE=4 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 7.177e-56
Identity = 143/400 (35.75%), Postives = 212/400 (53.00%), Query Frame = 1
Query:   70 KRNATSDLNHSNWDXXXXXXXRGEFVTANKNIISQRKVIQARRKPTSNSTNNVFKSFSGFSNTIN--PPSNNMLSFTIDSSILDKNKEK-----HINSLKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYP------LTTMPDSKISSNWTEIGTTVSTPSTIPVFSFLKDKTEAVDNFQFGLKNADVPKPFTFST------TESLPLF--GLPAASTA-EVKNSTIGFSNSSSLFGIPSSSTMNTVAXXXXXXXXXXXX--XXXXXXFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVTKNNVSFVAM----------TDFCKEM------KLTPLLIRVKTPEEAEALLEAM 1149
            KR A  +LN  NWD +     +G+F  A+K+++SQRK++ AR    S  T+ +FKSF+ FSN  N  P S   L+F    S+   N  K     ++  L+ LNQ  L+ I KHI E+P C+L+P   DYNK+L+ I  K+P        T+P+ K  S      T+  T +++           +V N  F   N+ + KP T S+      T+  P+F  GLP  +T+ +   S   FS  S+    P+S +  +++   + +++        EV++FKE+ SVY  RCKLFY++D+EW+ RG+GNLFIKP    KFQL++RAD +L  ILLN+LI   +P+   KNN++ V +          +    E       K  PLLIRVK+ E A  LL  M
Sbjct:    3 KRRADIELNRDNWDDDLVSTAKGDFDKADKDVLSQRKILTARTNRNSTGTSGLFKSFTAFSNCSNGNPAS---LNFGFTPSVTKANGHKQDDSEYLEHLQTLNQNLLDWITKHIKEDPYCILSPIFSDYNKHLSEINSKFPEHSLVGSATVPEKKEPSGCLATNTSKVTETSV----------TSVSNSVFIFGNS-LSKPITVSSNASNDSTDKKPIFSFGLPPITTSSKFPQSIFHFSGVSNF--QPNSDSKQSISNQQENDDDEEYVPPKPEVKDFKEDGSVYSTRCKLFYKVDTEWRERGLGNLFIKPTTNDKFQLLIRADTNLGNILLNILITKDVPIKQQKNNLTLVCIPSPPLPSQGKSSLTNEEGDNGQPKPVPLLIRVKSEEGATQLLSQM 386          
BLAST of nucleoporin 50 kDa vs. TrEMBL
Match: A0A5K4F9W5 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.435e-48
Identity = 139/408 (34.07%), Postives = 203/408 (49.75%), Query Frame = 1
Query:   70 KRNATSDLNHSNWDXXXXXXXRGEFVTANKNIISQRKVIQARRKPTSNSTNNVFKSFSGFSNTI--NPPSNNMLSFTIDSSILDKNKEK-----HINSLKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYPLTTMPD-----------SKISSNWTEIGTTV--STPSTIPVFSFLKDKTEAVDN------------FQFGLKNADVPKPFTFSTTESLP-LFGLPAASTAEVKNSTIGFSNSSSLFGIPSSSTMNTVAXXXXXXXXXXXXXXXXXXFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVTKNNVSFVAM---------------TDFCKEMKLTPLLIRVKTPEEAEALLEAM 1149
            KR A  +LN  NWD +     +G+F  A+K I+SQRK++ AR   T   T+ +FKSF+ FS+    NP S N   F  + S + +N  K     ++  L+ LNQ  L+ I KH+ E+P C+L+P   DY+K+L+ I  K+P  +  D           S++ +  +E   T   S P++I VF     K+  + +            F FGL       P T ++ +  P LF  P+ S+   K + +           P  +T N      DEE     P  +   FKE  SV+  RCKLFY++D+EWK RG+GNLFIKP    K QL++RAD +L  ILLN+L+  +MP+   KNN++ V +                +   + K  P+LIRVKT E A  LL  M
Sbjct:    3 KRRADIELNQDNWDDDLRTTTKGDFDKADKEILSQRKILTARTNRTPTGTSGLFKSFTAFSDCSRGNPVSFN---FGPNPSSVKENGHKDEETEYLEHLQNLNQSLLDWITKHVKEDPFCILSPIFSDYDKHLSGINSKFPKQSSVDAVPLLEKKEASSRLIAKTSEAIETPANSAPNSIFVFGNSISKSTPISSGSSTDCTDKKPIFSFGLP------PITTTSNKFSPSLFQFPSVSSFSQKPANLD----------PKQNTNNQQGDDDDEEYIPPKPEVKD--FKEEGSVFTTRCKLFYKVDNEWKERGLGNLFIKPTTNDKLQLLIRADTNLGNILLNILVTKEMPIKQQKNNLTLVCVPSPPLPSHVKSSVNNEEDNGQPKPVPMLIRVKTEEGATTLLNQM 389          
BLAST of nucleoporin 50 kDa vs. TrEMBL
Match: A0A430QE32 (Nuclear pore complex protein Nup50 (Fragment) OS=Schistosoma bovis OX=6184 GN=DC041_0009532 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 4.811e-46
Identity = 141/413 (34.14%), Postives = 205/413 (49.64%), Query Frame = 1
Query:   91 LNHSNWDXXXXXXXRGEFVTANKNIISQRKVIQARRKPTSNSTNNVFKSFSGFSN--TINPPSNNMLSFTIDSSILDKNKEK-----HINSLKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYP------LTTMPDSKISSNW-----TEIGTTVSTPSTIPVFSFLKDKTEAVDNFQFGLKNADVPKPFTFSTTESL------PL--FGLPAASTAEVKNSTIGFSNSSSLFGIPSSSTMNTVAXXXXXXXXXXXXXX------------XXXXFKEND-------SVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVTKNNVSFV----------AMTDFCKEM-----KLTPLLIRVKTPEEAEALLEAM 1149
            LN  NWD +     +G F  A+K+IISQRK++ AR   TS+ T+ +FKSF+ FS+  + NP S     F +  S + +N  K     ++  L+ LNQ  L+ I KHI E+P C+L+P   DY+K+L+ I  K+P        ++P+ K +S+      +E+  T    +  PVF F                   +PKP   S+  S       P+  FGLP  +T     ++  F+   SLF  PS S+ +     +D ++                   EV++FKE+        S++  RCKLFY+ DSEWK RG+GNLFIKP    KFQL++RAD +L  ILLN+L+   +P+   KNN++ V          A +    E      K  P+LIRVKT E A  LL  M
Sbjct:    1 LNQDNWDDDLRATTKGNFDKADKDIISQRKILTARTNRTSSGTSGLFKSFTAFSDCSSGNPVS---FDFGLKHSSVKENGHKDEETEYLEHLQTLNQSLLDWITKHIKEDPFCILSPVFSDYDKHLSGINSKFPKQSLVGAVSLPEKKEASSHLIAKTSEVIETPVKSAPNPVFFF----------------GNSIPKPTPISSGSSTDSTDKKPIFSFGLPPITT-----TSTNFTQ--SLFQFPSVSSFSQKPVNLDPKQNTSNQQGDDDDEEYIPPKPEVKDFKEDGNPYIRIFSLHIHRCKLFYKADSEWKERGLGNLFIKPTTNDKFQLLIRADTNLGNILLNILVTKDVPIKQQKNNLTLVCIPSPPLPSQAKSSLTNEEDNGQPKPVPMLIRVKTEEGATELLSQM 387          
BLAST of nucleoporin 50 kDa vs. TrEMBL
Match: A0A4Z2D6I2 (Nuclear pore complex protein isoform 4 OS=Schistosoma japonicum OX=6182 GN=EWB00_004072 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.885e-45
Identity = 118/329 (35.87%), Postives = 179/329 (54.41%), Query Frame = 1
Query:   70 KRNATSDLNHSNWDXXXXXXXRGEFVTANKNIISQRKVIQARRKPTSNSTNNVFKSFSGFSNTIN--PPSNNMLSFTIDSSILDKNKEK-----HINSLKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYP------LTTMPDSKISSNWTEIGTTVSTPSTIPVFSFLKDKTEAVDNFQFGLKNADVPKPFTFST------TESLPLF--GLPAASTA-EVKNSTIGFSNSSSLFGIPSSSTMNTVAXXXXXXXXXXXX--XXXXXXFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLA 984
            KR A  +LN  NWD +     +G+F  A+K+++SQRK++ AR    S  T+ +FKSF+ FSN  N  P S   L+F    S+   N  K     ++  L+ LNQ  L+ I KHI E+P C+L+P   DYNK+L+ I  K+P        T+P+ K  S      T+  T +++           +V N  F   N+ + KP T S+      T+  P+F  GLP  +T+ +   S   FS  S+    P+S +  +++   + +++        EV++FKE+ SVY  RCKLFY++D+EW+ RG+GNLFIKP    KFQL++RAD +L 
Sbjct:    3 KRRADIELNRDNWDDDLVSTAKGDFDKADKDVLSQRKILTARTNRNSTGTSGLFKSFTAFSNCSNGNPAS---LNFGFTPSVTKANGHKQDDSEYLEHLQTLNQNLLDWITKHIKEDPYCILSPIFSDYNKHLSEINSKFPEHSLVGSATVPEKKEPSGCLATNTSKVTETSV----------TSVSNSVFIFGNS-LSKPITVSSNASNDSTDKKPIFSFGLPPITTSSKFPQSIFHFSGVSNF--QPNSDSKQSISNQQENDDDEEYVPPKPEVKDFKEDGSVYSTRCKLFYKVDTEWRERGLGNLFIKPTTNDKFQLLIRADTNLG 315          
BLAST of nucleoporin 50 kDa vs. Ensembl Sea Lamprey
Match: nup50 (nucleoporin 50 [Source:ZFIN;Acc:ZDB-GENE-030131-1689])

HSP 1 Score: 114.775 bits (286), Expect = 1.790e-28
Identity = 95/306 (31.05%), Postives = 143/306 (46.73%), Query Frame = 1
Query:  322 KEKHINSLKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYPLTTMPDSKISSNWTEIGTTVSTPSTIPV-FSFLK-------------DKTEAVDNFQFGLKNADVP----KPFTFSTTESLPLFGL------PAASTAEVKNSTIGFSNSSSLFGIPSSSTMNTVAXXXXXXXXXXXX--XXXXXXFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVTKNNVSFVAM----TDFCKEMKLTPLLIRVKTPEEAEALLEAM 1149
            K  + + L+ LN    + I KH+  NP+C LTP   DY ++L  I  KY   +  DS  ++  +       +P   P+ F  L+              +  +  +F    K+A  P      F+F  T +   FG       PA  T    N+  G S +   F   +SS    +A   +E++          V E KE+D+ Y  +CKLFY+   E+K +GVG L +KP+E  K QL++RAD SL  ILLNVL+   M  + T  NV  + +     D   +  + P+LIRVKT E+A+ L  A+
Sbjct:  155 KGTYNHQLRSLNYSVRDWIVKHVNGNPLCDLTPVFRDYERHLADIDQKYSGESGSDSDGAAKLSR---NAESPKAAPLSFQGLQAANATAGSTTASNSRQSSAASFAISGKSA-APLAGSATFSFVKTSAKAPFGTASATGNPALPTFTFTNAGFGSSPAVPGFSFSASSVQKPLAQESEEQDGEDEEPPKPVVNEVKESDAFYSTKCKLFYKKGEEFKEKGVGMLHLKPMENKKTQLLIRADTSLGNILLNVLLQPSMVCTRTGKNVLLMCVPNPPVDEGSKDAVVPMLIRVKTGEDADELHRAI 456          
BLAST of nucleoporin 50 kDa vs. Ensembl Nematostella
Match: EDO34132 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ74])

HSP 1 Score: 115.931 bits (289), Expect = 9.161e-29
Identity = 127/445 (28.54%), Postives = 190/445 (42.70%), Query Frame = 1
Query:   70 KRNATSDLNHSNWDXXXXXXXR-GEFVTANKNIISQRKVIQARRKPT-------------------------SNSTNNVF---KSFSGFSNTINPPSNNMLSFTIDSSI---------------------------------------LDKNKEKH----INSLKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYPLTTMPDSKISSNWTEIGTTVSTPSTIPVFSFLKDKTEAVDNFQFGLKNADVPKPFTFSTTE---SLPLFGLPAASTAEVKNSTIGFSNSSSLFGIPSSSTMNTVAXXXXXXXXXXXXXXXXXXFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVT-KNNVSFVAMTD---FCK-----EMKLTPLLIRVKTPEEAEALLEAMK 1152
            KR A  +LN  NWD+E+E  E  G F TA+   +S+RK+I+ARR+ T                         S S+ +VF   K+  G S+ +NP       F  +S+                                         + N+++H    + S+K LNQ   + +QKH+T NP   LTP  DDY K++  I+   P         S     +   V TP T P       +T+A  +   GL  A      + S  E   ++PLFG     T  VKN    F+  ++L   P  S  ++      +++E   P        E  S + ++CKLF++ D+ W   G+G L  K + + K QL++RAD +   ILLN+ +   MP+S + KNNV  V + +   + K       K    LIRVKT E A+ L E MK
Sbjct:    3 KRVADRELNRDNWDEEDENAEEAGTFNTASAEDMSKRKIIKARRRITGDKKQDSTKESRSIFQGFTGFKGFSSTSSADVFGGSKTLPGISSNLNPKPTGFSGFGCNSTAGFSGFSGLSATNIPTTSPPQIAQVSTPTFNGHSNTKTPQKESNEKEHSDAYLESIKALNQGVSDWVQKHVTSNPYIDLTPVFDDYRKHMKEIERNEPRENE-----SPGVAPLAMAV-TPVTKPAEVITSTETKATADVTSGLFGAGT----SLSNAETKTTVPLFG--TGETKVVKNEEKPFAGLATL-SAPQDSVASSSKQTDSKDDEEETPKPVSVVTAEKGSHFSIKCKLFFKRDTSWSELGIGMLNFKTVSE-KTQLLIRADTATGNILLNIFLAPGMPISRSGKNNVMLVTVPNPPLYSKPSEGDNSKPATYLIRVKTAENADELYEKMK 433          
BLAST of nucleoporin 50 kDa vs. Ensembl Medaka
Match: nup50 (nucleoporin 50 [Source:NCBI gene;Acc:101165219])

HSP 1 Score: 92.8189 bits (229), Expect = 3.120e-20
Identity = 49/113 (43.36%), Postives = 74/113 (65.49%), Query Frame = 1
Query:  835 KENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLS-VTKNNVSFVAMT----DFCKEMKLTPLLIRVKTPEEAEALLEAMKRQ 1158
            KE+D+ Y  +CKLFY+ +SE+K +GVG L +K   +GK Q+++RAD +L  ILLNV+++  MP + V KNNV  V++     D        PLLIRVKT E+A+ L + ++ +
Sbjct:  338 KEDDAFYSKKCKLFYKKESEFKEKGVGTLHLKRTGEGKTQMIIRADTNLGNILLNVMVHVSMPCTRVGKNNVMVVSVPNPPIDEKNPGAPVPLLIRVKTAEDADELHKTLEEK 450          
BLAST of nucleoporin 50 kDa vs. Planmine SMEST
Match: SMESG000066593.1 (SMESG000066593.1)

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 362/364 (99.45%), Postives = 364/364 (100.00%), Query Frame = 1
Query:   67 MKRNATSDLNHSNWDXXXXXXXRGEFVTANKNIISQRKVIQARRKPTSNSTNNVFKSFSGFSNTINPPSNNMLSFTIDSSILDKNKEKHINSLKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYPLTTMPDSKISSNWTEIGTTVSTPSTIPVFSFLKDKTEAVDNFQFGLKNADVPKPFTFSTTESLPLFGLPAASTAEVKNSTIGFSNSSSLFGIPSSSTMNTVAXXXXXXXXXXXXXXXXXXFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVTKNNVSFVAMTDFCKEMKLTPLLIRVKTPEEAEALLEAMKRQ 1158
            MKRNATSDLNHSNWDKEEEKEERGEFVTANKNIISQRKVIQARRKPTSNSTNNVFKSFSGFSNTINPPSNNMLSFTIDSSILDKNKEKHINSLKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYPLTTMPDSKISSNWTEIGTTVSTPSTIPVFSFLKDKTEAVDNFQFGLKNADVPKPFTFSTTESLPLFGLPAASTAEVKNSTIGFSNSSSLFGIPSSSTMNTVAPIVDEE+EYVPPVAEVREFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVTKNN+SFVAMTDFCKEMKLTPLLIRVKTPEEAEALLEAMKRQ
Sbjct:    1 MKRNATSDLNHSNWDKEEEKEERGEFVTANKNIISQRKVIQARRKPTSNSTNNVFKSFSGFSNTINPPSNNMLSFTIDSSILDKNKEKHINSLKLLNQQFLECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYPLTTMPDSKISSNWTEIGTTVSTPSTIPVFSFLKDKTEAVDNFQFGLKNADVPKPFTFSTTESLPLFGLPAASTAEVKNSTIGFSNSSSLFGIPSSSTMNTVAPIVDEEDEYVPPVAEVREFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLRADNSLATILLNVLINDKMPLSVTKNNISFVAMTDFCKEMKLTPLLIRVKTPEEAEALLEAMKRQ 364          
The following BLAST results are available for this feature:
BLAST of nucleoporin 50 kDa vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
NUP501.850e-2032.01nucleoporin 50 [Source:HGNC Symbol;Acc:HGNC:8065][more]
NUP502.269e-2032.01nucleoporin 50 [Source:HGNC Symbol;Acc:HGNC:8065][more]
NUP502.269e-2032.01nucleoporin 50 [Source:HGNC Symbol;Acc:HGNC:8065][more]
NUP501.899e-850.00nucleoporin 50 [Source:HGNC Symbol;Acc:HGNC:8065][more]
back to top
BLAST of nucleoporin 50 kDa vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nucleoporin 50 kDa vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Nup509.083e-1941.28gene:FBgn0033264 transcript:FBtr0088783[more]
back to top
BLAST of nucleoporin 50 kDa vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nup509.899e-1942.11nucleoporin 50 [Source:ZFIN;Acc:ZDB-GENE-030131-16... [more]
nup509.899e-1942.11nucleoporin 50 [Source:ZFIN;Acc:ZDB-GENE-030131-16... [more]
nup509.899e-1942.11nucleoporin 50 [Source:ZFIN;Acc:ZDB-GENE-030131-16... [more]
back to top
BLAST of nucleoporin 50 kDa vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
snx167.901e-2732.66sorting nexin 16 [Source:Xenbase;Acc:XB-GENE-10158... [more]
snx161.052e-2634.68sorting nexin 16 [Source:Xenbase;Acc:XB-GENE-10158... [more]
back to top
BLAST of nucleoporin 50 kDa vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Nup507.095e-1848.11nucleoporin 50 [Source:MGI Symbol;Acc:MGI:1351502][more]
Nup507.095e-1848.11nucleoporin 50 [Source:MGI Symbol;Acc:MGI:1351502][more]
1700123L14Rik1.415e-1329.55RIKEN cDNA 1700123L14 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of nucleoporin 50 kDa vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|O08587|NUP50_RAT4.428e-2033.44Nuclear pore complex protein Nup50 OS=Rattus norve... [more]
sp|Q9UKX7|NUP50_HUMAN8.886e-2032.01Nuclear pore complex protein Nup50 OS=Homo sapiens... [more]
sp|Q7K0D8|NUP50_DROME9.105e-1841.28Nuclear pore complex protein Nup50 OS=Drosophila m... [more]
sp|Q9JIH2|NUP50_MOUSE4.963e-1748.11Nuclear pore complex protein Nup50 OS=Mus musculus... [more]
back to top
BLAST of nucleoporin 50 kDa vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GXZ84.570e-123100.00Nucleoporin 50 kDa (Fragment) OS=Schmidtea mediter... [more]
A0A4Z2D6J77.177e-5635.75Nuclear pore complex protein isoform 2 OS=Schistos... [more]
A0A5K4F9W51.435e-4834.07Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A430QE324.811e-4634.14Nuclear pore complex protein Nup50 (Fragment) OS=S... [more]
A0A4Z2D6I24.885e-4535.87Nuclear pore complex protein isoform 4 OS=Schistos... [more]
back to top
BLAST of nucleoporin 50 kDa vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nucleoporin 50 kDa vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nup501.790e-2831.05nucleoporin 50 [Source:ZFIN;Acc:ZDB-GENE-030131-16... [more]
back to top
BLAST of nucleoporin 50 kDa vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nucleoporin 50 kDa vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO341329.161e-2928.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of nucleoporin 50 kDa vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nup503.120e-2043.36nucleoporin 50 [Source:NCBI gene;Acc:101165219][more]
back to top
BLAST of nucleoporin 50 kDa vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000066593.10.000e+099.45SMESG000066593.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30003359
GenBankAKG62120.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003359 ID=SMED30003359|Name=nucleoporin 50 kDa|organism=Schmidtea mediterranea sexual|type=transcript|length=1198bp
CTTTAAACTATTTAAAGGTTTGTTTCAATAATTACAATAATTTTCATTTT
ATTTTATTATAAAAAAATGAAACGTAACGCTACGTCAGATTTAAATCATA
GCAATTGGGATAAAGAAGAAGAAAAAGAAGAAAGAGGGGAATTTGTCACT
GCCAATAAAAACATTATATCTCAACGTAAAGTTATTCAAGCCAGAAGAAA
ACCAACTTCAAATTCTACAAATAATGTGTTTAAATCATTCAGTGGCTTTT
CAAATACAATAAATCCACCATCTAACAATATGCTCAGTTTTACCATAGAC
TCTAGTATCCTGGATAAAAATAAAGAAAAACATATAAATTCACTTAAATT
ATTGAATCAACAATTTCTGGAATGCATCCAAAAGCATATTACTGAAAATC
CAGTATGTGTTCTTACACCTACTTTAGATGATTACAATAAAAACCTTAAT
ATTATAAAAGATAAATATCCTTTAACAACCATGCCAGATTCTAAAATTTC
ATCTAATTGGACTGAAATAGGAACAACTGTATCGACACCGAGTACAATAC
CAGTTTTTTCTTTTTTGAAAGATAAAACTGAAGCGGTAGATAACTTCCAA
TTTGGATTGAAAAATGCTGATGTTCCTAAACCATTCACTTTTTCAACTAC
TGAATCATTACCACTTTTTGGGTTGCCCGCTGCCTCAACTGCAGAAGTTA
AAAATTCTACGATTGGATTCTCCAATAGTTCAAGTCTTTTTGGTATTCCA
AGTAGTAGCACAATGAACACAGTTGCTCCTATTGTAGATGAAGAAGAAGA
ATATGTACCGCCGGTCGCTGAAGTTCGTGAATTTAAAGAAAATGATTCTG
TTTACGAAGTCCGCTGTAAACTATTTTATCAACTGGATAGCGAATGGAAA
AATCGTGGCGTAGGAAATTTGTTCATAAAACCTATTGAAAAGGGAAAGTT
CCAACTTGTCCTTCGGGCTGATAATAGTCTAGCTACAATACTTTTGAATG
TACTTATTAATGATAAGATGCCTCTTAGTGTAACAAAAAATAATGTTTCT
TTTGTTGCCATGACAGATTTCTGCAAAGAAATGAAGTTAACTCCGTTGCT
CATTCGTGTTAAAACTCCAGAGGAAGCTGAAGCTTTATTGGAAGCAATGA
AAAGACAGTTATAGATTTTGAATATTAATAAATTGATTTGTTTGTAAT
back to top

protein sequence of SMED30003359-orf-1

>SMED30003359-orf-1 ID=SMED30003359-orf-1|Name=SMED30003359-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=366bp
MKRNATSDLNHSNWDKEEEKEERGEFVTANKNIISQRKVIQARRKPTSNS
TNNVFKSFSGFSNTINPPSNNMLSFTIDSSILDKNKEKHINSLKLLNQQF
LECIQKHITENPVCVLTPTLDDYNKNLNIIKDKYPLTTMPDSKISSNWTE
IGTTVSTPSTIPVFSFLKDKTEAVDNFQFGLKNADVPKPFTFSTTESLPL
FGLPAASTAEVKNSTIGFSNSSSLFGIPSSSTMNTVAPIVDEEEEYVPPV
AEVREFKENDSVYEVRCKLFYQLDSEWKNRGVGNLFIKPIEKGKFQLVLR
ADNSLATILLNVLINDKMPLSVTKNNVSFVAMTDFCKEMKLTPLLIRVKT
PEEAEALLEAMKRQL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR000156Ran_bind_dom
IPR011993PH-like_dom_sf
IPR015007NUP2/50/61
Vocabulary: biological process
TermDefinition
GO:0046907intracellular transport
Vocabulary: cellular component
TermDefinition
GO:0005643nuclear pore
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000156Ran binding domainSMARTSM00160ranbd_3coord: 244..360
e-value: 3.0E-6
score: 11.8
IPR000156Ran binding domainPFAMPF00638Ran_BP1coord: 257..361
e-value: 3.5E-11
score: 43.4
IPR000156Ran binding domainPROSITEPS50196RANBD1coord: 235..365
score: 10.178
IPR015007Nuclear pore complex, NUP2/50/61PFAMPF08911NUP50coord: 2..63
e-value: 7.0E-15
score: 55.5
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 170..365
e-value: 1.4E-29
score: 105.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..25
NoneNo IPR availablePANTHERPTHR23138:SF141NUCLEAR PORE COMPLEX PROTEIN NUP50coord: 1..362
NoneNo IPR availablePANTHERPTHR23138RAN BINDING PROTEINcoord: 1..362
NoneNo IPR availableCDDcd13170RanBD_NUP50coord: 257..363
e-value: 2.27615E-31
score: 112.696
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 242..363