26S proteasome non-ATPase regulatory subunit 2

Overview
Name26S proteasome non-ATPase regulatory subunit 2
Smed IDSMED30003353
Length (bp)2813
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 26S proteasome non-ATPase regulatory subunit 2 (SMED30003353) t-SNE clustered cells

Violin plots show distribution of expression levels for 26S proteasome non-ATPase regulatory subunit 2 (SMED30003353) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 26S proteasome non-ATPase regulatory subunit 2 (SMED30003353) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 26S proteasome non-ATPase regulatory subunit 2 (SMED30003353) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003353

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003353SMESG000010192.1 SMESG000001376.1 dd_Smed_v4_2481_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003353SMESG000010192.1 SMESG000001376.1 dd_Smed_v4_2481_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003353SMESG000010192.1 SMESG000001376.1 dd_Smed_v4_2481_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003353SMESG000010192.1 SMESG000001376.1 dd_Smed_v4_2481_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Human
Match: PSMD2 (proteasome 26S subunit, non-ATPase 2 [Source:HGNC Symbol;Acc:HGNC:9559])

HSP 1 Score: 874.389 bits (2258), Expect = 0.000e+0
Identity = 458/896 (51.12%), Postives = 620/896 (69.20%), Query Frame = 1
Query:   76 GDAKIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQF-------DYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            GD K ++ E+SEEDK L+ E+E LV  L   D      ALE ++R I S+TTSMTSVPKPLK+LR  Y K+K  Y  M+  +NK+  ADIISV+ + M+ + E     L++R +G  E+++ WGHEY+RHL  ++   W   D           D      E L    L LV +I+PY M HNAE EA DL +E+E +++L K    + Y ++CLY+T  V Y+ +P+N  LL  A  ++ +F    +A++ AL LND +    +    K   + KQ+AF+L R    +     V    E+L EI+SN  L+  FL LARELDIM+PKVP+DIYK HLE +R     + +DSAR NLASS+VNG VN  FG+DK++ ++  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++   +   SI GLG+AYAGS + + L+LL PV+ D S    E++ + AL+ G+IAV S + ++T+ ++QT+ME+S  ++   +A+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + D+CAYAGSG+VLKVQQLLHI SE  D K+  +  ++             D  AHQG+A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E+++ +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDV+   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEE++P++ + LEGFVIL+KNPN+D
Sbjct:   37 GD-KDKEQELSEEDKQLQDELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKRFAADIISVLAMTMSGERE----CLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELD-----------DAEKVQREPL----LTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYVPEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGRHGVFLELSEDVEE-YEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDD--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYAGSNREDVLTLLLPVMGD-SKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPI-LEGFVILRKNPNYD 907          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Human
Match: PSMD2 (proteasome 26S subunit, non-ATPase 2 [Source:HGNC Symbol;Acc:HGNC:9559])

HSP 1 Score: 793.882 bits (2049), Expect = 0.000e+0
Identity = 407/790 (51.52%), Postives = 553/790 (70.00%), Query Frame = 1
Query:  394 DTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQF-------DYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            + L++R +G  E+++ WGHEY+RHL  ++   W   D           D      E L    L LV +I+PY M HNAE EA DL +E+E +++L K    + Y ++CLY+T  V Y+ +P+N  LL  A  ++ +F    +A++ AL LND +    +    K   + KQ+AF+L R    +     V    E+L EI+SN  L+  FL LARELDIM+PKVP+DIYK HLE +R     + +DSAR NLASS+VNG VN  FG+DK++ ++  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++   +   SI GLG+AYAGS + + L+LL PV+ D S    E++ + AL+ G+IAV S + ++T+ ++QT+ME+S  ++   +A+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + D+CAYAGSG+VLKVQQLLHI SE  D K+  +  ++             D  AHQG+A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E+++ +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDV+   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEE++P++ + LEGFVIL+KNPN+D
Sbjct:    8 ECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELD-----------DAEKVQREPL----LTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYVPEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGRHGVFLELSEDVEE-YEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDD--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYAGSNREDVLTLLLPVMGD-SKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPI-LEGFVILRKNPNYD 777          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Human
Match: PSMD2 (proteasome 26S subunit, non-ATPase 2 [Source:HGNC Symbol;Acc:HGNC:9559])

HSP 1 Score: 768.074 bits (1982), Expect = 0.000e+0
Identity = 390/728 (53.57%), Postives = 526/728 (72.25%), Query Frame = 1
Query:  580 LALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQF-------DYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            L LV +I+PY M HNAE EA DL +E+E +++L K    + Y ++CLY+T  V Y+ +P+N  LL  A  ++ +F    +A++ AL LND +    +    K   + KQ+AF+L R    +     V    E+L EI+SN  L+  FL LARELDIM+PKVP+DIYK HLE +R     + +DSAR NLASS+VNG VN  FG+DK++ ++  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++   +   SI GLG+AYAGS + + L+LL PV+ D S    E++ + AL+ G+IAV S + ++T+ ++QT+ME+S  ++   +A+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + D+CAYAGSG+VLKVQQLLHI SE  D K+  +  ++             D  AHQG+A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E+++ +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDV+   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEE++P++ + LEGFVIL+KNPN+D
Sbjct:   26 LTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYVPEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGRHGVFLELSEDVEE-YEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDD--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYAGSNREDVLTLLLPVMGD-SKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPI-LEGFVILRKNPNYD 748          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Human
Match: PSMD2 (proteasome 26S subunit, non-ATPase 2 [Source:HGNC Symbol;Acc:HGNC:9559])

HSP 1 Score: 200.675 bits (509), Expect = 1.756e-58
Identity = 104/223 (46.64%), Postives = 146/223 (65.47%), Query Frame = 1
Query: 1660 TMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLH 2328
            T+ME+S  ++   +A+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + D+CAYAGSG+VLKVQQLLHI SE                  FD +  +             +    +MG       LR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E+++ +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL H
Sbjct:    2 TIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSE-----------------HFDSKEKEEDKDKKEKKDKDKKEAPADMG----AHQLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTH 203          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Human
Match: PSMD2 (proteasome 26S subunit, non-ATPase 2 [Source:HGNC Symbol;Acc:HGNC:9559])

HSP 1 Score: 110.153 bits (274), Expect = 1.517e-26
Identity = 61/128 (47.66%), Postives = 85/128 (66.41%), Query Frame = 1
Query:   76 GDAKIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYI 459
            GD K ++ E+SEEDK L+ E+E LV  L   D      ALE ++R I S+TTSMTSVPKPLK+LR  Y K+K  Y  M+  +NK+  ADIISV+ + M+ + E C   L++R +G  E+++ WGHEY+
Sbjct:   37 GD-KDKEQELSEEDKQLQDELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKRFAADIISVLAMTMSGERE-C---LKYRLVGSQEELASWGHEYV 159          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Celegans
Match: rpn-1 (26S proteasome non-ATPase regulatory subunit 2 [Source:UniProtKB/TrEMBL;Acc:Q9GZH5])

HSP 1 Score: 460.299 bits (1183), Expect = 1.331e-146
Identity = 258/624 (41.35%), Postives = 378/624 (60.58%), Query Frame = 1
Query:   82 AKIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPE--------CLSLLQPVILDTSTDKF-ELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKS 1926
            A+ +K+EMSEED+ L+ ++  LV  L   D      +LE+M+ +I ++TTSMTSVPKPLK++R  Y K+K  ++ +     K+LCADIISV+   MT  E    DT+ +R LG  E +  WGHEY+RHL  ++   W  +  S                ++ K   L L   I+ + MKHNAE EA DL IE+E ++LL  Y    ++ R+CLY+        DPDN  L+  A ++Y +F+   +A++CA+ +ND      +  KA    L KQ+A LL R Q  + YE   +S  + L E+ SN+HL EYF  LARELDIM+PK PE IYK HLE SRP   SA  DS R NLA++ VNG VNCGFG DK++ E E   +W YKNKE GM++   + G + +WD+D GL+  D++LY +DDYIKAG LLA G++++G+++ CDPA ALL ++V + + ++   SI+GLG+AYA S++           +  L+ V+ D       E+  LA LS GLI V + DAE    ++Q +M++S  ++  P  +F+ LG+AL  L  Q++ DV + SL +L +P  +M   + ++CAYAG+G+VLK+Q+LLH+ SE  +     KK+
Sbjct:   26 AEPKKEEMSEEDQKLEEDLNLLVQRLSEPDTTLYKPSLETMRTLIRASTTSMTSVPKPLKFMRPHYNKMKEIFTSIVAPDVKKLCADIISVLA--MTSDER--TDTINYRILGSHEPIGDWGHEYVRHLAMEMSEEWKKEGTS----------------DARKAELLKLTQDIVSHHMKHNAEVEACDLLIEIERIDLLISYVQEVDHQRVCLYLLSCAPLTPDPDNIILIRTALQLYLKFNRYLEAVRCAIMVNDIPQVHQIFAKASDPLLRKQMAILLGRHQIFLDYEGSADS--DALAELNSNAHLYEYFHSLARELDIMEPKTPEGIYKSHLEHSRPFGNSAQPDSTRMNLAAALVNGFVNCGFGVDKMMAETEEASRWFYKNKEYGMLTAAASQGLIWRWDIDTGLAQCDRFLYINDDYIKAGTLLAIGIISSGIQDACDPASALLLDHVQSDRSIMRVGSILGLGLAYANSKRETVTKNEERGVIFELKKVLSDQKPSAIPEVKGLAGLSLGLILVGTADAEAAMEMLQALMDKSETELTDPNMRFLALGIALIFLQTQDKSDVFVESLRSLPDPFGAMVSTLVEVCAYAGTGNVLKIQKLLHLCSEHYETPAAEKKT 627          

HSP 2 Score: 310.457 bits (794), Expect = 9.960e-91
Identity = 157/267 (58.80%), Postives = 197/267 (73.78%), Query Frame = 1
Query: 1960 AHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFM-NRHDYLLFYLTPAFQPRLLMTFDE------SLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNW 2739
            + Q +A LG+GLI+MG+ IG +M  R+ G L+R+GE  I+RAVPLAL+L+  S+PQ+ +L+TL KFSHDSD + A  AI +MGLVGAGTNNARL AMLR LAS+H K+   L  VR+AQGL HLGKGT+T++P H DR L+SP A+  LL++  S LD   T + NR  YLL+ L  A QPR+L T  E      SL  L V+VRVGQAVD V QAG+PKTITGFQTHTTPVLLA GERAEL+ +EY+ ++   LEG VILKKNP++
Sbjct:  707 SQQAVAVLGIGLIAMGDDIGSQMALRMFGHLIRYGEPVIRRAVPLALSLLSVSNPQLNILETLSKFSHDSDADTAHNAIFAMGLVGAGTNNARLVAMLRNLASYHYKDQVSLMLVRIAQGLTHLGKGTMTLNPWHSDRQLLSPSALASLLSICFSFLDANNTILNNRQHYLLYTLVLAMQPRMLTTLVEDEMKPGSLKQLNVSVRVGQAVDVVAQAGKPKTITGFQTHTTPVLLAHGERAELANDEYLSVTP-HLEGLVILKKNPDY 972          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Fly
Match: Rpn1 (gene:FBgn0028695 transcript:FBtr0074893)

HSP 1 Score: 817.379 bits (2110), Expect = 0.000e+0
Identity = 446/885 (50.40%), Postives = 599/885 (67.68%), Query Frame = 1
Query:  157 LESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLC---EDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDK----FELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQFD-----------------YQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNW 2739
            L+  D K     LESM ++I ++TTSMTSVPKPLK++R  Y  +K  Y  M + + +QLCADIISV+ + M   +    D L +RFL  C   + +  WGHEY+RHL+ +I A +      +D+T D             +V+ + LV +I+PY M+HNAE +A DL IE++ L LLS +   S Y R+CLY+     Y+ DPDN  +LE A ++  +F+   QAM+ AL LND D    + ++ K  A+ KQLAF+LARQQ  +  + LV  + ++L+EI+SN++L+++FL LARELDIM+PK PEDIYK HL+ SR    S  +DSA+ NLA+S+VNG VN GFG DK++ E+  G KW+YKNKE GM+S   +LG +L WDVDGGL+ IDKYLYS DD IK+G LLACG+VN G++NE DPA ALL +Y+ N    +   +I+GLG+AYAGS +   +  L+ V    S +K     E+  + ALS GLI+V S ++E+T IL+QT+M  +   +   + +F+ LGL L  LGRQ+  + V+ +LE L EP RSMA  M DICAYAG+G+VLK+QQLLHI S+  +      + E+   ++                     A Q +A LG+ LI+MGE IG EM +R  G LLR+ E  I+RAVPLAL L+ +S+P++ ++DTL KFSHDSD E+A  AI +MGLVGAGTNNARLA+MLRQLA +HSK+P  LF VR+AQ L HLGKGTL++SP+H DR LM+P+AV GL+  LVS LDVK   +NR  YLL+ L PA Q R+L+TFDE L+ L V VRVG A+D VGQAG+PKTITGFQTHTTPVLLA GERAEL+T+EY+ ++ + +EGFVILKKNPN+
Sbjct:   61 LQEPDAKLYQPTLESMAKLIRASTTSMTSVPKPLKFMRPHYETMKTVYKHMPNEQARQLCADIISVLSMTMGSGK----DCLAYRFL--CDRKQRIGDWGHEYVRHLSGEISAHY------HDTTGD------------FRVQLIELVKQIIPYNMEHNAEADACDLLIEIDHLHLLSDFVDESAYPRVCLYLQSCYPYVPDPDNTIILETALQLSRKFNQYTQAMRLALMLNDMDKIGEIFKEPKEPAMQKQLAFMLARQQICLELDELV-PDYDDLMEIMSNANLNKHFLNLARELDIMEPKTPEDIYKSHLDNSRSRFASIQVDSAKQNLAASFVNGFVNAGFGVDKLLSED--GNKWLYKNKEHGMLSATASLGLILLWDVDGGLTMIDKYLYSTDDNIKSGALLACGIVNCGIRNEVDPAHALLSDYIDNQNSCMRVGAILGLGIAYAGSNRSIVIDTLKTVFSFGSNNKSSASVEILGITALSLGLISVGSCNSEITEILLQTIMGLTKADLKDTYTRFLFLGLGLLYLGRQKSTEAVMMTLEVLEEPYRSMATTMVDICAYAGTGNVLKIQQLLHICSDHYETSSADDEKEKSKKDKGKDKEKEKEKEKEKEREKDLSATQSIAVLGIALIAMGEDIGAEMAYRSFGNLLRYCEPAIRRAVPLALGLISASNPKLNIIDTLSKFSHDSDAEVAHNAIFAMGLVGAGTNNARLASMLRQLAQYHSKDPSNLFMVRIAQSLTHLGKGTLSLSPYHSDRQLMNPMAVAGLMATLVSLLDVKNLILNRSHYLLYTLVPAMQARMLITFDEELNQLQVPVRVGIAIDVVGQAGKPKTITGFQTHTTPVLLAIGERAELATDEYLALTPV-MEGFVILKKNPNF 917          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Zebrafish
Match: PSMD2 (proteasome 26S subunit, non-ATPase 2 [Source:HGNC Symbol;Acc:HGNC:9559])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 283/515 (54.95%), Postives = 379/515 (73.59%), Query Frame = 1
Query: 1036 ELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDID------NQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQ 2562
            +LDIM+PKVP+DIYK HLE +R     + +DSAR NLASS+VNG VN  FG+DK++ E+  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++  ++   +I GLG+AYAGS + + LSLL PV+ D S    E++ + AL+ G+IAV S + ++T+ ++Q++ME+S +++    A+++ LGL L  LG+ E ++  LA+L+ + EP RS  + + D+CAYAGSG+VLKVQQLLHI SE  D K      ++            D  +HQG+A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E++  +I +MGLVG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDVK   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQ
Sbjct:    1 QLDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTED--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNIMRIGAIFGLGLAYAGSNREDVLSLLLPVMGD-SKSSMEVAGVTALACGMIAVGSCNGDVTSTILQSIMEKSEQELKDTCARWLPLGLGLNHLGKGEAIETTLAALQVVPEPFRSFGNTLVDVCAYAGSGNVLKVQQLLHICSEHFDNKDKDDDKDKKDKKDKDKKESADMGSHQGVAVLGIALIAMGEEIGSEMALRTFGHLLRYGESTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSHNSIFAMGLVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVKNLILGKSHYILYGLVAAMQPRMLVTFDEELRPLPVSVRVGQ 512          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Zebrafish
Match: psmd2 (proteasome 26S subunit, non-ATPase 2 [Source:NCBI gene;Acc:393518])

HSP 1 Score: 208.379 bits (529), Expect = 1.391e-59
Identity = 127/323 (39.32%), Postives = 189/323 (58.51%), Query Frame = 1
Query:   73 KGDAKIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLAREL 1041
            K   K E+ E+SEEDK L+ E+E LV  L   D      ALE ++R I S+TTSMTSVPKPLK+LR  YAK+K+ Y  M+  +NK  CAD++SV+ + M+++ E     L++R LG  E+++ WGHEY+RHL  ++   W                 + E  ++ +   L LV +I+PY M HNAE EA DL +E+E L++L  Y   + Y ++CLY+T  V Y+ +P+N  LL+ A  I+ +F+   +A++ AL LND +    +    K   + KQ+AF+L R    +     V  + E+L EI+SN  L+  FL LARE+
Sbjct:   25 KDKDKKEEQELSEEDKQLQEELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYAKLKDIYQNMTAGENKHFCADVVSVLAMTMSNERE----CLKYRLLGSQEELASWGHEYVRHLAGEVAKEW---------------QEIEEGDKAQQEVLLKLVKEIVPYNMAHNAEHEACDLLMEIERLDMLDSYIDENAYAKVCLYLTSCVSYVPEPENSALLKCALNIFRKFNRYPEALRLALMLNDVELVENIFTSCKDIVIQKQMAFMLGRHGMFLELNEDV-EDYEDLTEIMSNVQLNSNFLALAREV 327          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Zebrafish
Match: psmd1 (proteasome 26S subunit, non-ATPase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-810])

HSP 1 Score: 56.9954 bits (136), Expect = 1.039e-7
Identity = 93/441 (21.09%), Postives = 179/441 (40.59%), Query Frame = 1
Query: 1126 DSARNNL---ASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDD----YIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAM--LRQLASFHSKEPH----CLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLL 2409
            D+ RN++   A+   N  ++ G   D+ + E    ++W+ +       +   +LG + +      L  +  YL  D      Y + GGL A G+++A   +  D    LL +    S  ++     +GLG+A  G+ + +   LL+  +        E    A L+ GL+ + S+ A+     I+ M+  + E  +    + + +G+A+   GR E+ D ++ SL   ++P+   + +     AY GSG+   +++LLH+             +  D+++       +  A   +G I    P   E    V+  L       ++    +AL +  +       ++ L   ++D    +   A+++  L+           +   RQL S    + H      F   LAQG+L  G   +TIS   +      P  VG L+
Sbjct:  359 DAVRNSVCHTATVIANSFMHTGTTSDQFLRE---NLEWLARATNWAKFTATASLGVIHKGHEKEALQLMATYLPKDTSPGSAYQEGGGLYALGLIHAN--HGGDIIDYLLSQLKNASNDIVRHGGALGLGLAALGTARQDVYDLLKSNLYQDDAVTGEA---AGLALGLVMLGSKSAQA----IEDMVGYAQETQHEKILRGLAVGIAMVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIRRLLHV-------------AVSDVNDDV-----RRAAVESIGFIMFRTP---EQCPSVVSLLSESYNPHVRYGAAMALGICCAGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEVTCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGVLDAGGRNVTISLQSRTGHTHMPSVVGLLV 766          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Zebrafish
Match: psmd1 (proteasome 26S subunit, non-ATPase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-810])

HSP 1 Score: 56.9954 bits (136), Expect = 1.055e-7
Identity = 93/441 (21.09%), Postives = 179/441 (40.59%), Query Frame = 1
Query: 1126 DSARNNL---ASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDD----YIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAM--LRQLASFHSKEPH----CLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLL 2409
            D+ RN++   A+   N  ++ G   D+ + E    ++W+ +       +   +LG + +      L  +  YL  D      Y + GGL A G+++A   +  D    LL +    S  ++     +GLG+A  G+ + +   LL+  +        E    A L+ GL+ + S+ A+     I+ M+  + E  +    + + +G+A+   GR E+ D ++ SL   ++P+   + +     AY GSG+   +++LLH+             +  D+++       +  A   +G I    P   E    V+  L       ++    +AL +  +       ++ L   ++D    +   A+++  L+           +   RQL S    + H      F   LAQG+L  G   +TIS   +      P  VG L+
Sbjct:  354 DAVRNSVCHTATVIANSFMHTGTTSDQFLRE---NLEWLARATNWAKFTATASLGVIHKGHEKEALQLMATYLPKDTSPGSAYQEGGGLYALGLIHAN--HGGDIIDYLLSQLKNASNDIVRHGGALGLGLAALGTARQDVYDLLKSNLYQDDAVTGEA---AGLALGLVMLGSKSAQA----IEDMVGYAQETQHEKILRGLAVGIAMVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIRRLLHV-------------AVSDVNDDV-----RRAAVESIGFIMFRTP---EQCPSVVSLLSESYNPHVRYGAAMALGICCAGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEVTCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGVLDAGGRNVTISLQSRTGHTHMPSVVGLLV 761          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Zebrafish
Match: psmd1 (proteasome 26S subunit, non-ATPase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-810])

HSP 1 Score: 56.9954 bits (136), Expect = 1.274e-7
Identity = 93/441 (21.09%), Postives = 179/441 (40.59%), Query Frame = 1
Query: 1126 DSARNNL---ASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDD----YIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAM--LRQLASFHSKEPH----CLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLL 2409
            D+ RN++   A+   N  ++ G   D+ + E    ++W+ +       +   +LG + +      L  +  YL  D      Y + GGL A G+++A   +  D    LL +    S  ++     +GLG+A  G+ + +   LL+  +        E    A L+ GL+ + S+ A+     I+ M+  + E  +    + + +G+A+   GR E+ D ++ SL   ++P+   + +     AY GSG+   +++LLH+             +  D+++       +  A   +G I    P   E    V+  L       ++    +AL +  +       ++ L   ++D    +   A+++  L+           +   RQL S    + H      F   LAQG+L  G   +TIS   +      P  VG L+
Sbjct:  359 DAVRNSVCHTATVIANSFMHTGTTSDQFLRE---NLEWLARATNWAKFTATASLGVIHKGHEKEALQLMATYLPKDTSPGSAYQEGGGLYALGLIHAN--HGGDIIDYLLSQLKNASNDIVRHGGALGLGLAALGTARQDVYDLLKSNLYQDDAVTGEA---AGLALGLVMLGSKSAQA----IEDMVGYAQETQHEKILRGLAVGIAMVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIRRLLHV-------------AVSDVNDDV-----RRAAVESIGFIMFRTP---EQCPSVVSLLSESYNPHVRYGAAMALGICCAGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEVTCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGVLDAGGRNVTISLQSRTGHTHMPSVVGLLV 766          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Xenopus
Match: psmd2 (proteasome 26S subunit, non-ATPase 2 [Source:NCBI gene;Acc:548536])

HSP 1 Score: 885.56 bits (2287), Expect = 0.000e+0
Identity = 459/889 (51.63%), Postives = 622/889 (69.97%), Query Frame = 1
Query:   85 KIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEK---ADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            K E  E+SEEDK L+ E+E LV  L   D      ALE ++R I S+TTSMTSVPKPLK+LR  Y K+K  Y  M+  +NKQ  ADIISV+ + M+ + E     L++R LG  E+++ WGHEY+RHL  ++   W                 + E  +S K   L LV +I+PY M HNAE EA DL +E+E +++L KY   + Y ++CLY+T  V Y+ +P+N  LL  A  I+ +F+   +A++ AL LND +    +    K   + KQ++F+L R    +     V    E+L EI+SN  L+  FL LARELDIM+PKVP+DIYK HLE +R     + +DSAR NLASS+VNG VN  FG+DK++ ++  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++   +   +I GLG+AYAGS + + L+LL PV+ D S    E+  + AL+ G+IAV S + ++T+ ++QT+ME+S +++   FA+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + DICAYAGSG+VLKVQQLLHI SE     ++ +  K  ++  ++  D  +HQG+A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E+++ +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDV+   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEEY+P++ + LEGFVIL+KNPN+D
Sbjct:   34 KKEDQELSEEDKQLQDELEMLVERLGEKDSSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKQFAADIISVLAMTMSSERE----CLKYRLLGSQEELASWGHEYVRHLAGEVAKEW---------------QEVEEGDKSQKDTLLTLVKEIVPYNMAHNAEHEACDLLMEIEQMDMLEKYIDDNAYAKVCLYLTSCVSYVPEPENSALLRCALSIFRKFNRYPEALRLALVLNDMELVEDIFTSCKDVVVQKQMSFMLGRHGVYLALNEDVEE-YEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDD--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRIGAIFGLGLAYAGSNREDVLTLLLPVMGD-SKSSMEVVGVTALACGMIAVGSCNGDVTSTILQTIMEKSEQELKDTFARWLPLGLGLNHLGKGEAIEAILAALEVVPEPFRSFANTLVDICAYAGSGNVLKVQQLLHICSEHYDSKEKDEEKKDKKDKKESAADMGSHQGVAVLGIALIAMGEEIGSEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIVLGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEYLPVTPI-LEGFVILRKNPNYD 898          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Xenopus
Match: psmd2 (proteasome 26S subunit, non-ATPase 2 [Source:NCBI gene;Acc:548536])

HSP 1 Score: 830.476 bits (2144), Expect = 0.000e+0
Identity = 435/869 (50.06%), Postives = 590/869 (67.89%), Query Frame = 1
Query:  145 LVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEK---ADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            LV  L   D      ALE ++R I S+TTSMTSVPKPLK+LR  Y K+K  Y  M+  +NKQ  ADIISV+ + M+ + E     L++R LG  E+++ WGHEY+RHL  ++   W                 + E  +S K   L LV +I+PY M HNAE EA DL +E+E +++L KY   + Y ++CLY+T  V Y+ +P+N  LL  A  I+ +F+   +A++ AL LND +    +    K   + KQ++F+L R    +     V    E+L EI+SN  L+  FL LARELDIM+PKVP+DIYK HLE +R     + +DSAR NLASS+VNG VN  FG+DK++ ++  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++   +   +I GLG+AYAGS + + L+LL PV+ D S    E+  + AL+ G+IAV S + ++T+ ++QT+ME+S +++   FA+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + DICAYAGSG+VLKVQQLLHI SE     ++ +  K  ++  ++  D  +HQG+A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E+++ +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDV+   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA                     GFVIL+KNPN+D
Sbjct:    2 LVERLGEKDSSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKQFAADIISVLAMTMSSERE----CLKYRLLGSQEELASWGHEYVRHLAGEVAKEW---------------QEVEEGDKSQKDTLLTLVKEIVPYNMAHNAEHEACDLLMEIEQMDMLEKYIDDNAYAKVCLYLTSCVSYVPEPENSALLRCALSIFRKFNRYPEALRLALVLNDMELVEDIFTSCKDVVVQKQMSFMLGRHGVYLALNEDVEE-YEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDD--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRIGAIFGLGLAYAGSNREDVLTLLLPVMGD-SKSSMEVVGVTALACGMIAVGSCNGDVTSTILQTIMEKSEQELKDTFARWLPLGLGLNHLGKGEAIEAILAALEVVPEPFRSFANTLVDICAYAGSGNVLKVQQLLHICSEHYDSKEKDEEKKDKKDKKESAADMGSHQGVAVLGIALIAMGEEIGSEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIVLGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLA--------------------HGFVILRKNPNYD 827          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Xenopus
Match: psmd2 (proteasome 26S subunit, non-ATPase 2 [Source:NCBI gene;Acc:548536])

HSP 1 Score: 816.609 bits (2108), Expect = 0.000e+0
Identity = 420/816 (51.47%), Postives = 575/816 (70.47%), Query Frame = 1
Query:  304 KMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEK---ADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            K+S I  +Q  ADIISV+ + M+ + E     L++R LG  E+++ WGHEY+RHL  ++   W                 + E  +S K   L LV +I+PY M HNAE EA DL +E+E +++L KY   + Y ++CLY+T  V Y+ +P+N  LL  A  I+ +F+   +A++ AL LND +    +    K   + KQ++F+L R    +     V    E+L EI+SN  L+  FL LARELDIM+PKVP+DIYK HLE +R     + +DSAR NLASS+VNG VN  FG+DK++ ++  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++   +   +I GLG+AYAGS + + L+LL PV+ D S    E+  + AL+ G+IAV S + ++T+ ++QT+ME+S +++   FA+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + DICAYAGSG+VLKVQQLLHI SE     ++ +  K  ++  ++  D  +HQG+A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E+++ +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDV+   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEEY+P++ + LEGFVIL+KNPN+D
Sbjct:   57 KVSKIFFQQFAADIISVLAMTMSSERE----CLKYRLLGSQEELASWGHEYVRHLAGEVAKEW---------------QEVEEGDKSQKDTLLTLVKEIVPYNMAHNAEHEACDLLMEIEQMDMLEKYIDDNAYAKVCLYLTSCVSYVPEPENSALLRCALSIFRKFNRYPEALRLALVLNDMELVEDIFTSCKDVVVQKQMSFMLGRHGVYLALNEDVEE-YEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDD--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRIGAIFGLGLAYAGSNREDVLTLLLPVMGD-SKSSMEVVGVTALACGMIAVGSCNGDVTSTILQTIMEKSEQELKDTFARWLPLGLGLNHLGKGEAIEAILAALEVVPEPFRSFANTLVDICAYAGSGNVLKVQQLLHICSEHYDSKEKDEEKKDKKDKKESAADMGSHQGVAVLGIALIAMGEEIGSEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIVLGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEYLPVTPI-LEGFVILRKNPNYD 848          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Xenopus
Match: psmd2 (proteasome 26S subunit, non-ATPase 2 [Source:NCBI gene;Acc:548536])

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 302/530 (56.98%), Postives = 405/530 (76.42%), Query Frame = 1
Query: 1162 NGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEK---ADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            N      FG+DK++ ++  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++   +   +I GLG+AYAGS + + L+LL PV+ D S    E+  + AL+ G+IAV S + ++T+ ++QT+ME+S +++   FA+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + DICAYAGSG+VLKVQQLLHI SE     ++ +  K  ++  ++  D  +HQG+A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E+++ +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDV+   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEEY+P++ + LEGFVIL+KNPN+D
Sbjct:   94 NAYAKVSFGQDKLLTDD--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRIGAIFGLGLAYAGSNREDVLTLLLPVMGD-SKSSMEVVGVTALACGMIAVGSCNGDVTSTILQTIMEKSEQELKDTFARWLPLGLGLNHLGKGEAIEAILAALEVVPEPFRSFANTLVDICAYAGSGNVLKVQQLLHICSEHYDSKEKDEEKKDKKDKKESAADMGSHQGVAVLGIALIAMGEEIGSEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIVLGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEYLPVTPI-LEGFVILRKNPNYD 619          

HSP 2 Score: 68.5514 bits (166), Expect = 3.878e-11
Identity = 43/126 (34.13%), Postives = 66/126 (52.38%), Query Frame = 1
Query:  394 DTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKL 771
            + L++R LG  E+++ WGHEY+RHL  ++   W                 + E  +S K   L LV +I+PY M HNAE EA DL +E+E +++L KY   + Y ++     K    L+D  N+ L
Sbjct:    8 ECLKYRLLGSQEELASWGHEYVRHLAGEVAKEW---------------QEVEEGDKSQKDTLLTLVKEIVPYNMAHNAEHEACDLLMEIEQMDMLEKYIDDNAYAKVSFGQDK---LLTDDGNKWL 115          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Xenopus
Match: psmd2 (proteasome 26S subunit, non-ATPase 2 [Source:NCBI gene;Acc:548536])

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 298/523 (56.98%), Postives = 401/523 (76.67%), Query Frame = 1
Query: 1183 FGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEK---ADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            FG+DK++ ++  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++   +   +I GLG+AYAGS + + L+LL PV+ D S    E+  + AL+ G+IAV S + ++T+ ++QT+ME+S +++   FA+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + DICAYAGSG+VLKVQQLLHI SE     ++ +  K  ++  ++  D  +HQG+A LG+ LI+MGE IG EM        LR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E+++ +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDV+   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEEY+P++ + LEGFVIL+KNPN+D
Sbjct:   19 FGQDKLLTDD--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRIGAIFGLGLAYAGSNREDVLTLLLPVMGD-SKSSMEVVGVTALACGMIAVGSCNGDVTSTILQTIMEKSEQELKDTFARWLPLGLGLNHLGKGEAIEAILAALEVVPEPFRSFANTLVDICAYAGSGNVLKVQQLLHICSEHYDSKEKDEEKKDKKDKKESAADMGSHQGVAVLGIALIAMGEEIGSEM--------LRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIVLGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEYLPVTPI-LEGFVILRKNPNYD 529          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Mouse
Match: Psmd2 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 2 [Source:MGI Symbol;Acc:MGI:1096584])

HSP 1 Score: 873.618 bits (2256), Expect = 0.000e+0
Identity = 456/893 (51.06%), Postives = 617/893 (69.09%), Query Frame = 1
Query:   85 KIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQF-------DYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            K ++ E+SEEDK L+ E+E LV  L   D      ALE ++R I S+TTSMTSVPKPLK+LR  Y K+K  Y  M+  +NK   ADIISV+ + M+ + E     L++R +G  E+++ WGHEY+RHL  ++   W   D           D      E L    L LV +I+PY M HNAE EA DL +E+E +++L K    + Y ++CLY+T  V Y+ +P+N  LL  A  ++ +F    +A++ AL LND +    +    K   + KQ+AF+L R    +     V    E+L EI+SN  L+  FL LARELDIM+PKVP+DIYK HLE +R     + +DSAR NLASS+VNG VN  FG+DK++ ++  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++   +   SI GLG+AYAGS + + L+LL PV+ D S    E++ + AL+ G+IAV S + ++T+ ++QT+ME+S  ++   +A+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + D+CAYAGSG+VLKVQQLLHI SE  D K+  +  ++             D  AHQG+A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E+++ +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDV+   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEE++P++ + LEGFVIL+KNPN+D
Sbjct:   39 KDKEQELSEEDKQLQDELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKCFAADIISVLAMTMSGERE----CLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELD-----------DAEKAQREPL----LTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYVPEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGRHGVFLELSEDVEE-YEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDD--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYAGSNREDVLTLLLPVMGD-SKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPI-LEGFVILRKNPNYD 907          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Mouse
Match: Psmd2 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 2 [Source:MGI Symbol;Acc:MGI:1096584])

HSP 1 Score: 108.997 bits (271), Expect = 2.863e-27
Identity = 49/101 (48.51%), Postives = 76/101 (75.25%), Query Frame = 1
Query: 1588 LAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILS 1890
            + AL+ G+IAV S + ++T+ ++QT+ME+S  ++   +A+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + D+CAYAGSG+VLKVQQLLHI S
Sbjct:    5 VTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICS 105          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Mouse
Match: Psmd2 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 2 [Source:MGI Symbol;Acc:MGI:1096584])

HSP 1 Score: 85.5001 bits (210), Expect = 1.560e-19
Identity = 37/89 (41.57%), Postives = 64/89 (71.91%), Query Frame = 1
Query: 1588 LAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGS 1854
            + AL+ G+IAV S + ++T+ ++QT+ME+S  ++   +A+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + D+CAYAGS +
Sbjct:    5 VTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSAA 93          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Mouse
Match: Psmd1 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 1 [Source:MGI Symbol;Acc:MGI:1917497])

HSP 1 Score: 74.7146 bits (182), Expect = 4.227e-13
Identity = 95/441 (21.54%), Postives = 181/441 (41.04%), Query Frame = 1
Query: 1126 DSARNNL---ASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDD----YIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAM--LRQLASFHSKEPH----CLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLL 2409
            D+ RN++   A+   N  ++CG   D+ + +    ++W+ +       +   +LG + +      L  +  YL  D      Y + GGL A G+++A   +  D    LL +    S  ++     +GLG+A  G+ + +   LL+  +        E    A L+ GL+ + S++A+     I+ M+  + E  +    + + +G+AL   GR E+ D ++ SL   ++P+   + +     AY GSG+   +++LLH+             +  D+++     A + L     G I    P   E    V+  L       ++    +AL +  +       ++ L   ++D    +   A+++  L+           +   RQL S    + H      F   LAQG+L  G   +TIS   +      P  VG L+
Sbjct:  358 DAVRNSVCHTATVIANSFMHCGTTSDQFLRD---NLEWLARATNWAKFTATASLGVIHKGHEKEALQLMATYLPKDTSPGSAYQEGGGLYALGLIHA--NHGGDIIDYLLNQLKNASNDIVRHGGSLGLGLAAMGTARQDVYDLLKTNLYQDDAVTGEA---AGLALGLVMLGSKNAQA----IEDMVGYAQETQHEKILRGLAVGIALVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIRRLLHV-------------AVSDVNDDVRRAAVESL-----GFILFRTP---EQCPSVVSLLSESYNPHVRYGAAMALGICCAGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGILDAGGHNVTISLQSRTGHTHMPSVVGVLV 765          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. UniProt/SwissProt
Match: sp|P56701|PSMD2_BOVIN (26S proteasome non-ATPase regulatory subunit 2 OS=Bos taurus OX=9913 GN=PSMD2 PE=1 SV=2)

HSP 1 Score: 875.159 bits (2260), Expect = 0.000e+0
Identity = 458/896 (51.12%), Postives = 620/896 (69.20%), Query Frame = 1
Query:   76 GDAKIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQF-------DYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            GD K ++ E+SEEDK L+ E+E LV  L   D      ALE ++R I S+TTSMTSVPKPLK+LR  Y K+K  Y  M+  +NK+  ADIISV+ + M+ + E     L++R +G  E+++ WGHEY+RHL  ++   W   D           D      E L    L LV +I+PY M HNAE EA DL +E+E +++L K    + Y ++CLY+T  V Y+ +P+N  LL  A  ++ +F    +A++ AL LND +    +    K   + KQ+AF+L R    +     V    E+L EI+SN  L+  FL LARELDIM+PKVP+DIYK HLE +R     + +DSAR NLASS+VNG VN  FG+DK++ ++  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++   +   SI GLG+AYAGS + + L+LL PV+ D S    E++ + AL+ G+IAV S + ++T+ ++QT+ME+S  ++   +A+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + D+CAYAGSG+VLKVQQLLHI SE  D K+  +  ++             D  AHQG+A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E+++ +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDV+   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEE++P++ + LEGFVIL+KNPN+D
Sbjct:   37 GD-KDKEQELSEEDKQLQDELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKRFAADIISVLAMTMSGERE----CLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELD-----------DAEKTQREPL----LTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYVPEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGRHGVFLELSEDVEE-YEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDD--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYAGSNREDVLTLLLPVMGD-SKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPI-LEGFVILRKNPNYD 907          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. UniProt/SwissProt
Match: sp|Q5R9I6|PSMD2_PONAB (26S proteasome non-ATPase regulatory subunit 2 OS=Pongo abelii OX=9601 GN=PSMD2 PE=2 SV=1)

HSP 1 Score: 874.774 bits (2259), Expect = 0.000e+0
Identity = 458/896 (51.12%), Postives = 620/896 (69.20%), Query Frame = 1
Query:   76 GDAKIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQF-------DYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            GD K ++ E+SEEDK L+ E+E LV  L   D      ALE ++R I S+TTSMTSVPKPLK+LR  Y K+K  Y  M+  +NK+  ADIISV+ + M+ + E     L++R +G  E+++ WGHEY+RHL  ++   W   D           D      E L    L LV +I+PY M HNAE EA DL +E+E +++L K    + Y ++CLY+T  V Y+ +P+N  LL  A  ++ +F    +A++ AL LND +    +    K   + KQ+AF+L R    +     V    E+L EI+SN  L+  FL LARELDIM+PKVP+DIYK HLE +R     + +DSAR NLASS+VNG VN  FG+DK++ ++  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++   +   SI GLG+AYAGS + + L+LL PV+ D S    E++ + AL+ G+IAV S + ++T+ ++QT+ME+S  ++   +A+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + D+CAYAGSG+VLKVQQLLHI SE  D K+  +  ++             D  AHQG+A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E+++ +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDV+   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEE++P++ + LEGFVIL+KNPN+D
Sbjct:   37 GD-KDKEQELSEEDKQLQDELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKRFAADIISVLAMTMSGERE----CLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELD-----------DAEKVQREPL----LTLVKEIIPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYVPEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGRHGVFLELSEDVEE-YEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDD--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYAGSNREDVLTLLLPVMGD-SKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPI-LEGFVILRKNPNYD 907          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. UniProt/SwissProt
Match: sp|Q13200|PSMD2_HUMAN (26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3)

HSP 1 Score: 874.389 bits (2258), Expect = 0.000e+0
Identity = 458/896 (51.12%), Postives = 620/896 (69.20%), Query Frame = 1
Query:   76 GDAKIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQF-------DYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            GD K ++ E+SEEDK L+ E+E LV  L   D      ALE ++R I S+TTSMTSVPKPLK+LR  Y K+K  Y  M+  +NK+  ADIISV+ + M+ + E     L++R +G  E+++ WGHEY+RHL  ++   W   D           D      E L    L LV +I+PY M HNAE EA DL +E+E +++L K    + Y ++CLY+T  V Y+ +P+N  LL  A  ++ +F    +A++ AL LND +    +    K   + KQ+AF+L R    +     V    E+L EI+SN  L+  FL LARELDIM+PKVP+DIYK HLE +R     + +DSAR NLASS+VNG VN  FG+DK++ ++  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++   +   SI GLG+AYAGS + + L+LL PV+ D S    E++ + AL+ G+IAV S + ++T+ ++QT+ME+S  ++   +A+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + D+CAYAGSG+VLKVQQLLHI SE  D K+  +  ++             D  AHQG+A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E+++ +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDV+   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEE++P++ + LEGFVIL+KNPN+D
Sbjct:   37 GD-KDKEQELSEEDKQLQDELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKRFAADIISVLAMTMSGERE----CLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELD-----------DAEKVQREPL----LTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYVPEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGRHGVFLELSEDVEE-YEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDD--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYAGSNREDVLTLLLPVMGD-SKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPI-LEGFVILRKNPNYD 907          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. UniProt/SwissProt
Match: sp|Q8VDM4|PSMD2_MOUSE (26S proteasome non-ATPase regulatory subunit 2 OS=Mus musculus OX=10090 GN=Psmd2 PE=1 SV=1)

HSP 1 Score: 873.618 bits (2256), Expect = 0.000e+0
Identity = 456/893 (51.06%), Postives = 617/893 (69.09%), Query Frame = 1
Query:   85 KIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQF-------DYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            K ++ E+SEEDK L+ E+E LV  L   D      ALE ++R I S+TTSMTSVPKPLK+LR  Y K+K  Y  M+  +NK   ADIISV+ + M+ + E     L++R +G  E+++ WGHEY+RHL  ++   W   D           D      E L    L LV +I+PY M HNAE EA DL +E+E +++L K    + Y ++CLY+T  V Y+ +P+N  LL  A  ++ +F    +A++ AL LND +    +    K   + KQ+AF+L R    +     V    E+L EI+SN  L+  FL LARELDIM+PKVP+DIYK HLE +R     + +DSAR NLASS+VNG VN  FG+DK++ ++  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++   +   SI GLG+AYAGS + + L+LL PV+ D S    E++ + AL+ G+IAV S + ++T+ ++QT+ME+S  ++   +A+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + D+CAYAGSG+VLKVQQLLHI SE  D K+  +  ++             D  AHQG+A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E+++ +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDV+   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEE++P++ + LEGFVIL+KNPN+D
Sbjct:   39 KDKEQELSEEDKQLQDELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKCFAADIISVLAMTMSGERE----CLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELD-----------DAEKAQREPL----LTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYVPEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGRHGVFLELSEDVEE-YEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDD--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYAGSNREDVLTLLLPVMGD-SKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPI-LEGFVILRKNPNYD 907          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. UniProt/SwissProt
Match: sp|Q4FZT9|PSMD2_RAT (26S proteasome non-ATPase regulatory subunit 2 OS=Rattus norvegicus OX=10116 GN=Psmd2 PE=1 SV=1)

HSP 1 Score: 872.078 bits (2252), Expect = 0.000e+0
Identity = 455/893 (50.95%), Postives = 617/893 (69.09%), Query Frame = 1
Query:   85 KIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQF-------DYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            K ++ E+SEEDK L+ E+E LV  L   D      ALE ++R I S+TTSMTSVPKPLK+LR  Y K+K  Y  M+  +NK   ADIISV+ + M+ + E     L++R +G  E+++ WGHEY+RHL  ++   W   D           D      E L    L LV +I+PY M HNAE EA DL +E+E +++L K    + Y ++CLY+T  V Y+ +P+N  LL  A  ++ +F    +A++ AL LND +    +    K   + KQ+AF+L R    +     V    E+L EI+SN  L+  FL LARELDIM+PKVP+DIYK HLE +R     + +DSAR NLASS+VNG VN  FG+DK++ ++  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++   +   SI GLG+AYAGS + + L+LL PV+ D S    E++ + AL+ G+IAV S + ++T+ ++QT+ME+S  ++   +A+++ LGL L  LG+ E ++ +LA+LE + EP RS A+ + D+CAYAGSG+VLKVQQLLHI SE  D K+  +  ++             D  AHQG+A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E+++ +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDV+   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEE++P++ + LEGFVIL+KNPN++
Sbjct:   39 KDKEQELSEEDKQLQDELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKCFAADIISVLAMTMSGERE----CLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELD-----------DAEKAQREPL----LTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYSKVCLYLTSCVNYVPEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGRHGVFLELSEDVEE-YEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDD--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYAGSNREDVLTLLLPVMGD-SKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPI-LEGFVILRKNPNYN 907          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. TrEMBL
Match: A0A1S3IFI7 (26S proteasome non-ATPase regulatory subunit 2 OS=Lingula unguis OX=7574 GN=LOC106163869 PE=3 SV=1)

HSP 1 Score: 920.228 bits (2377), Expect = 0.000e+0
Identity = 479/901 (53.16%), Postives = 638/901 (70.81%), Query Frame = 1
Query:  115 DKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEK-------------------------ADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            D+ L+ E+  LV  L+  + K    ALESM+ +I ++TTSMTSVPKPLK+LR  Y  +K  Y K+ D K K  CADIISV+G+ M +      D L+FR LG  E+V  WGHEY+RHL+ ++   W           D  E    +  E LK     L  +I+PY M HNAE EA DL +E+E L+LL  Y   + + R+CLY+   V Y+ DP+N  LL+    I+ +F+   +A++CA+ LND++    +    K   + KQLA++L RQQ  +   +    + ++LVEI+SN+HL+  FL LARELDIM+PKVPEDIYK HLEP+R T+G +N+DSAR NLA+S+VNG VN  FG+DK++ME+  G KW+YKNKE GM+S   TLG +L WDVDGGL+ IDKYLYS +DY+K+G LLACG+VN+GV+NECDPALALL +YV +S  ++   SIVGLG+AY+GS + + +SLL PV+ D+ ++  E+  +AALS G+IAV S + ++T+ ++QT+ME+S  ++  P+A+F+VLGLALT LG+QE  D VLA+LE + EP++S+A +M DICA+AG+G+VLKVQ LLHI SE                           +E+K   K EE  DN  D  AHQG+A LG+ LI+MGE IG EM  R  G LLR+GE  I+RAVPLALAL+ +S+P++++LDTL KFSHDSD E+++ AIL+MG+VGAGTNNARLAAMLRQLA +H K+P+ LF VR+AQGL H+GKGTLT  P+H DR L+SPVAV GL+ +LV+CLDVK   + +  Y+LF L PA QPR+L+TFDE L PL V VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEEY+ ++ + +EGFVILKKNP+++
Sbjct:   32 DRQLQDELNMLVERLQEPNQKLYKPALESMRTLIRASTTSMTSVPKPLKFLRPHYDTLKQVYEKIKDTKTKAFCADIISVLGMTMGEGR----DCLKFRMLGSHEEVGAWGHEYVRHLSGEVAQEWQ----------DTPEKETKKREELLK-----LAKQIVPYSMHHNAEAEACDLLMEIERLDLLEDYVDENAFPRVCLYLNSCVPYVPDPENTILLKTTLTIFRKFNRYPEALRCAMELNDTNLVKEIFLSCKDSMIQKQLAYMLGRQQIFL-ELDDEMDDYDDLVEIMSNAHLNNNFLALARELDIMEPKVPEDIYKSHLEPNR-TIGPSNVDSARQNLAASFVNGFVNAAFGQDKLLMED--GSKWIYKNKEHGMLSATATLGLILLWDVDGGLTQIDKYLYSSEDYVKSGALLACGIVNSGVRNECDPALALLSDYVLHSNNIMRIGSIVGLGLAYSGSNREDVISLLLPVMGDSKSN-MEVVGMAALSCGMIAVGSCNGDVTSTILQTLMEKSELELKDPYARFLVLGLALTYLGKQESADAVLAALEVMAEPIKSLATIMVDICAFAGTGNVLKVQHLLHICSEHYEEKDEKDKDKKDDKKKKEDKKEEKKEEEKTEDKKEEKKDNLVDLAAHQGVAVLGIALIAMGEDIGAEMTLRTFGSLLRYGEPAIRRAVPLALALVSASNPKLQILDTLSKFSHDSDPEVSYNAILAMGIVGAGTNNARLAAMLRQLAVYHGKDPNNLFMVRIAQGLTHMGKGTLTTCPYHSDRTLLSPVAVAGLMAVLVACLDVKTIILGKSHYVLFNLVPAIQPRMLVTFDEELRPLPVPVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAYGERAELATEEYLSLTPV-MEGFVILKKNPDYE 907          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. TrEMBL
Match: A0A210QZJ7 (26S proteasome non-ATPase regulatory subunit 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18916 PE=3 SV=1)

HSP 1 Score: 915.22 bits (2364), Expect = 0.000e+0
Identity = 474/885 (53.56%), Postives = 617/885 (69.72%), Query Frame = 1
Query:  100 EMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQF--------------------------DYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEE 2676
            EMSEEDK L+ E+  LV+ L+  D K    ALES++  I ++TTSMTSVPKPLK+LR  Y  +K  Y K+++ + K+ CADI+SV+G+ M+D  E    +L++R LG  E++  WGHEY+RHL  Q+   W + D +N S             ESL    L +  +++PY M HNAE EA DL +E+E L++L  Y   + Y R+CLY+T  V Y+ DP+N  LL  A  IY +F    QA++CAL+LND      +    K   + KQLA++L RQQ  +   + V    +E+ EI+SN+HL+  FL LARELDIM+PKVPEDIYK HLE SR T+G +N+DSAR NLASS+VNG VN  FG+DK++ME+  G KW+YKNKE GM+S   +LG +L WDVDGGL+ IDKYLYS +D+IKAG LLACG+VN+GV+NECDPALALL +YV ++  ++   +IVGLG+AYAGS + + L+L+ PV+ D S    E+  +AAL+ G+I+V S + ++T+ +IQTMMER+   +   ++KF+ LGLALT LG+Q+ V+  L +LE + EPL+SMA ++ D+CAYAG+G+VLK+Q LLH+ SE  DE K       D DN                            D  + QG+A LGVGLI+MGE IG EM +R  G LLR+GE  IKRAVPLAL L+  S+P++ +LDTL KFSHD+D E+A  AILSMGLVGAGTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+SP+H DR LMSPVAV GL+ +LVSCLDVK   + +  Y+L++L  A QPR+L TFDE L PL V VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEE
Sbjct:   29 EMSEEDKQLQEELNMLVDRLKESDQKLYKPALESLRSQIRASTTSMTSVPKPLKFLRPHYESLKEVYEKITENETKRFCADIVSVMGMTMSDGRE----SLKYRLLGSKEEIGSWGHEYVRHLAGQVALEWQDTDEANSSM-----------RESL----LTMTKEVVPYHMDHNAEAEACDLLMEIEQLDILHNYVDENAYPRVCLYLTSCVPYVPDPENFTLLRTAVDIYRKFKQFPQALRCALQLNDMKLIEEIFLTCKDIMMQKQLAYMLGRQQIYLELGDDVEE-YDEMTEIMSNAHLNNNFLALARELDIMEPKVPEDIYKSHLEQSRNTIGPSNVDSARQNLASSFVNGFVNAAFGQDKLLMED--GNKWLYKNKEHGMLSATASLGLILLWDVDGGLTQIDKYLYSSEDFIKAGALLACGIVNSGVRNECDPALALLSDYVMHTTAIMRIGAIVGLGLAYAGSNREDVLTLILPVLGD-SKAAMEVVGMAALACGMISVGSCNGDVTSTIIQTMMERNEADLKDTYSKFLALGLALTYLGKQDAVEATLVALEVIAEPLKSMACMLVDVCAYAGTGNVLKIQHLLHVCSEH-DETK-------DQDNNEKKDDKKKKDAKDKDKEKEKEKETTSADLSSQQGIAVLGVGLIAMGEEIGSEMSYRAFGHLLRYGEPAIKRAVPLALGLISVSNPKLNILDTLSKFSHDNDTEVAHNAILSMGLVGAGTNNARLAAMLRQLAVYHAKDPNNLFMVRLAQGLTHLGKGTLTLSPYHSDRSLMSPVAVAGLMAVLVSCLDVKNLILGKSHYILYHLVAAMQPRMLTTFDEELRPLPVPVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAYGERAELATEE 882          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. TrEMBL
Match: K1PEY4 (26S proteasome non-ATPase regulatory subunit 2 OS=Crassostrea gigas OX=29159 GN=CGI_10002226 PE=3 SV=1)

HSP 1 Score: 913.294 bits (2359), Expect = 0.000e+0
Identity = 464/887 (52.31%), Postives = 621/887 (70.01%), Query Frame = 1
Query:  115 DKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSE-----------EDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            DK L+ E+  LV  L+  D +    ALES++  I ++TTSMTSVPKPLK+LR  Y  +K  + K+ D + K+ CADIISV+G+ M+D      D+L+FR LG  E++  WGHEY+RHL  Q+   W   + SN               + ++   L +   I+PY M HNAE EA DL +E+E L+LL  Y   + Y R+CLY+T  V Y+ DP+N  LL+ A ++Y +F+   QA++ A++LND      +    K   + KQLA++L RQQ  +   + V    +EL EI+SN++L+  F+ LARELDIM+PK+PEDIYK HLE +R TLG +N+DSAR NLASS+VNG VN GFG+DK++  +E G KW++KNK+ GM+S   +LG VL WDVD GL+ IDKYLYS +D+IKAG LLACG+VN+GV+NECDPALALL +YV+++  ++   +IVGLG+AYAGS + + L+L+ PV L  S    E+  +AAL+ G+I+V S + E+T+ ++QTMMER    +   ++KF+ LGLALT LG+Q+ VD  L +L  + EPL+SMA +M D+CAYAG+G+VLKVQ LLH+ SE  D K      +           E+  N  D    QG+A LG+ LISMGE +G EM +R  G LLR+GE  IKRAVPLAL L+  S+P++++LDTL KFSHDSD E+A  AIL+MG+ GAGTNNARLAAMLRQLA +H K+P+ LF VRLAQGL HLGKGTLT+ P+H D+ LMSPVAV GL+ ++ +CLDVK   + +  Y+L++L  A QPR+L TFDE L PL V VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEEY+P+S + +EGFVIL+KNP+++
Sbjct:   30 DKQLQDELNMLVERLKESDQRLYKPALESLRSQIRASTTSMTSVPKPLKFLRPHYDSLKEVHEKIKDDETKRFCADIISVLGMTMSDGR----DSLKFRLLGSKEEIGSWGHEYVRHLAGQVAQEWQETEESN---------------KDMRENLLKMTKAIVPYHMDHNAEAEACDLLMEIEKLDLLKNYVDENAYPRVCLYLTSCVPYVPDPENTTLLKTAVELYRKFNQYPQALRFAMQLNDIALIEEIFLSCKDILMQKQLAYMLGRQQIFLELSDDVEE-YDELTEIMSNANLNNNFMALARELDIMEPKIPEDIYKSHLEQTRSTLGPSNVDSARQNLASSFVNGFVNAGFGQDKIL--KEDGNKWLHKNKDHGMLSATASLGLVLLWDVDSGLTQIDKYLYSSEDFIKAGALLACGIVNSGVRNECDPALALLSDYVSHNTSMMRIGAIVGLGLAYAGSNREDVLALILPV-LGESKANMEVVGMAALACGMISVGSCNGEVTSTILQTMMERPEADLKETYSKFLALGLALTYLGKQDAVDATLETLNVISEPLKSMARMMVDVCAYAGTGNVLKVQHLLHVCSEHDDSKDQDNNEKKDDKKKDKDKKEETPNA-DLSMQQGIAVLGIALISMGEEVGAEMSYRTFGHLLRYGEAAIKRAVPLALGLISVSNPKLQILDTLSKFSHDSDPEVAHNAILAMGIAGAGTNNARLAAMLRQLAVYHQKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDKALMSPVAVAGLMAVVTACLDVKTLILGKSHYILYHLVSAMQPRMLTTFDEELRPLPVHVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAYGERAELATEEYIPLSPI-MEGFVILRKNPDYE 891          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. TrEMBL
Match: A0A0B7BKI9 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF189588 PE=4 SV=1)

HSP 1 Score: 909.442 bits (2349), Expect = 0.000e+0
Identity = 474/907 (52.26%), Postives = 641/907 (70.67%), Query Frame = 1
Query:   73 KGDAKIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQF------------------DYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNW 2739
            KG++K E+D +SEED+ LK E+  LV  L   + K    ALES++ +I ++TTSMTSVPKPLK+LR  Y  +K  +  + +   ++ CADI+SV+G+ M++      D+L++R LG  E++  WGHEY+RHL  Q+   W           D S+DN       ++ + +AL  +I+PY M HNAE EA DL +E+E L+LL  Y   S Y R+CLY+T  V Y+ DP+N  LL  A  +Y +F    QA++ A+ LND      +  +   +   KQLA++L RQQ ++     ++ + ++L EIISN  L+++FL LARELDIMDPK+PEDIYK HLEP+R T+G +NLDSAR NLA+S+VNGLVN  FG DK+I  E+ G KW+YKNKE GM+S   +LG +L WDVDGGL+ IDK+LYS +DYIKAG LLACG+VN+GV+NECDPALALL ++V ++   +   +I+GLG+AYAGS + + L+L+ PV+ D   +  E+  +AAL+ G+IAVS+ + E+T+ ++QTMMERS  ++   +++++ LGLAL  LG+Q+ VD  L +LE + EPLRSMA ++ D+ AYAG+G+VLK+Q LLHI SE  + K      +++  N+                   D    QG+A LG+GLI+MGE +G EM FR  G LLR+GE+ I+RAVPLALAL+  S+P++ +LDTL KFSHDSD E+A  AILSMG+VGAGTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+SP+H DR LMSPVAV GLL +LVSCLDVK   + +  Y+L+ L  A QPR+L+TFDE L PL  TVRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEE++P++ + +EGFVIL+KNP++
Sbjct:   25 KGESKAEQD-LSEEDRQLKDELNMLVERLTEPNQKIYPAALESLRTLIRASTTSMTSVPKPLKFLRVHYDALKGVHETIKEPSTQRFCADIVSVLGMTMSEGR----DSLKYRLLGSEEEIGSWGHEYVRHLAGQVALEWQ----------DVSDDN-----REMQDKLVALATQIVPYHMSHNAEAEACDLLMEIEKLDLLKDYVDESAYARVCLYLTSCVPYVPDPENTVLLTCAVNLYRKFKQYPQALRFAMALNDMSLIEEIFLECPDQLTKKQLAYMLGRQQISLELAGSLD-DKDDLREIISNGQLNQHFLTLARELDIMDPKIPEDIYKTHLEPNRSTIGPSNLDSARQNLAASFVNGLVNAAFGTDKLITPED-GHKWLYKNKEHGMLSATASLGIILLWDVDGGLTQIDKFLYSSEDYIKAGALLACGIVNSGVRNECDPALALLHDHVGHANSYMRIGAILGLGLAYAGSNREDVLTLILPVLGDAKAN-MEVVGVAALACGMIAVSTCNGEVTSTILQTMMERSEAELKETYSRYLALGLALALLGKQDSVDATLMALEVVAEPLRSMATMLVDVAAYAGTGNVLKIQHLLHICSEHDESKDAENNEKKEDKNKKKEKDKDDKKKEEEKPTGPDLSTQQGVAVLGIGLIAMGEEVGCEMSFRAFGHLLRYGELPIRRAVPLALALISVSNPKLNILDTLSKFSHDSDPEVAHNAILSMGIVGAGTNNARLAAMLRQLAVYHAKDPNNLFMVRLAQGLTHLGKGTLTLSPYHSDRMLMSPVAVAGLLAVLVSCLDVKNIIIGKSHYMLYTLVSAMQPRMLVTFDEQLRPLPTTVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAYGERAELATEEFLPLTPI-MEGFVILRKNPDY 907          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. TrEMBL
Match: K1QDM2 (26S proteasome non-ATPase regulatory subunit 2 OS=Crassostrea gigas OX=29159 GN=CGI_10023649 PE=3 SV=1)

HSP 1 Score: 905.59 bits (2339), Expect = 0.000e+0
Identity = 456/862 (52.90%), Postives = 609/862 (70.65%), Query Frame = 1
Query:  190 ALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSE-----------EDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            ALES++  I ++TTSMTSVPKPLK+LR  Y  +K  + K+ D + K+ CADIISV+G+ M+D      D+L+FR LG  E++  WGHEY+RHL  Q+   W   + SN               + ++   L +   I+PY M HNAE EA DL +E+E L+LL  Y   + Y R+CLY+T  V Y+ DP+N  LL+ A ++Y +F+   QA++ A++LND      +    K   + KQLA++L RQQ  +   + V    +EL EI+SN++L+  F+ LARELDIM+PK+PEDIYK HLE +R TLG +N+DSAR NLASS+VNG VN GFG+DK++  +E G KW++KNK+ GM+S   +LG VL WDVD GL+ IDKYLYS +D+IKAG LLACG+VN+GV+NECDPALALL +YV+++  ++   +IVGLG+AYAGS + + L+L+ PV L  S    E+  +AAL+ G+I+V S + E+T+ ++QTMMER    +   ++KF+ LGLALT LG+Q+ VD  L +L  + EPL+SMA +M D+CAYAG+G+VLKVQ LLH+ SE  D K      +           E+  N  D    QG+A LG+ LISMGE +G EM +R  G LLR+GE  IKRAVPLAL L+  S+P++++LDTL KFSHDSD E+A  AIL+MG+ GAGTNNARLAAMLRQLA +H K+P+ LF VRLAQGL HLGKGTLT+ P+H D+ LMSPVAV GL+ ++ +CLDVK   + +  Y+L++L  A QPR+L TFDE L PL V VRVGQAVD VGQAG+PKTITGFQTHTTPVLLA GERAEL+TEEY+P+S + +EGFVIL+KNP+++
Sbjct:   36 ALESLRSQIRASTTSMTSVPKPLKFLRPHYDSLKEVHEKIKDDETKRFCADIISVLGMTMSDGR----DSLKFRLLGSKEEIGSWGHEYVRHLAGQVAQEWQETEESN---------------KDMRENLLKMTKAIVPYHMDHNAEAEACDLLMEIEKLDLLKNYVDENAYPRVCLYLTSCVPYVPDPENTTLLKTAVELYRKFNQYPQALRFAMQLNDIALIEEIFLSCKDILMQKQLAYMLGRQQIFLELSDDVEE-YDELTEIMSNANLNNNFMALARELDIMEPKIPEDIYKSHLEQTRSTLGPSNVDSARQNLASSFVNGFVNAGFGQDKIL--KEDGNKWLHKNKDHGMLSATASLGLVLLWDVDSGLTQIDKYLYSSEDFIKAGALLACGIVNSGVRNECDPALALLSDYVSHNTSMMRIGAIVGLGLAYAGSNREDVLALILPV-LGESKANMEVVGMAALACGMISVGSCNGEVTSTILQTMMERPEADLKETYSKFLALGLALTYLGKQDAVDATLETLNVISEPLKSMARMMVDVCAYAGTGNVLKVQHLLHVCSEHDDSKDQDNNEKKDDKKKDKDKKEETPNA-DLSMQQGIAVLGIALISMGEEVGAEMSYRTFGHLLRYGEAAIKRAVPLALGLISVSNPKLQILDTLSKFSHDSDPEVAHNAILAMGIAGAGTNNARLAAMLRQLAVYHQKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDKALMSPVAVAGLMAVVTACLDVKTLILGKSHYILYHLVSAMQPRMLTTFDEELRPLPVHVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAYGERAELATEEYLPLSPI-MEGFVILRKNPDYE 872          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Cavefish
Match: psmd2 (proteasome 26S subunit, non-ATPase 2 [Source:NCBI gene;Acc:393518])

HSP 1 Score: 807.749 bits (2085), Expect = 0.000e+0
Identity = 423/847 (49.94%), Postives = 577/847 (68.12%), Query Frame = 1
Query:  145 LVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDID--------NQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAE 2661
            +V  L   D      ALE ++R I S+TTSMTSVPKPLK+LR  Y K+K  Y  M+  +NK  CAD++SV+ + M+ + E     L++R LG  E+++ WGHEY+RHL  ++   W                 + E  +  +   L LV +I+PY M HNAE EA DL +E+E L++L  Y   + Y ++CLY+T  V Y+ +P+N  LL+ A KI+ +F+   +A++ AL LND +    +    K   + K++AF+L R    +     V  + E+L EI+SN  L+  FL LARELDIM+PKVP+DIYK HLE +R     + +DSAR NLASS+VNG VN  FG+DK++ E+  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++  V+   +I GLG+AYAGS + + LSLL PV+ D S    E++ + AL+ G+IAV S + ++T+ ++QT+ME++ +++   +A+++ LGL L  LG+ E ++  LA+L+ + EP RS ++ + DICAYAGSG+VLKVQQLLH  SE  D  K   + ++  D        +  D  +HQG A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E++  +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDVK   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PK ITGFQTHTTPVLL  G R E
Sbjct:    1 MVERLGEKDTSLYHPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYEGMAPGENKHFCADVVSVLAMTMSGERE----CLKYRLLGSQEELASWGHEYVRHLAGEVAKEW---------------QEIEEGDKVQQETLLKLVKEIVPYNMAHNAEHEACDLLMEIEHLDMLEMYIDENAYAKVCLYLTSCVSYVPEPENSALLKCALKIFRKFNRYPEALRLALMLNDVELVENIFTSCKDIVVQKEMAFMLGRHGMFLELNEDV-EDYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTED--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNVMRIGAIFGLGLAYAGSNREDVLSLLLPVMGD-SKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKNEQELKDTYARWLPLGLGLNHLGKGEAIETTLAALQVVPEPFRSFSNTLVDICAYAGSGNVLKVQQLLHTCSEHYDNTKDKDEDKDKKDKKDKDKKESAADMGSHQGAAVLGIALIAMGEEIGSEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSHNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVKNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKAITGFQTHTTPVLL--GSRRE 822          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Cavefish
Match: psmd2 (proteasome 26S subunit, non-ATPase 2 [Source:NCBI gene;Acc:393518])

HSP 1 Score: 768.844 bits (1984), Expect = 0.000e+0
Identity = 401/813 (49.32%), Postives = 554/813 (68.14%), Query Frame = 1
Query:  328 QLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDID--------NQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
              CAD++SV+ + M+ + E     L++R LG  E+++ WGHEY+RHL  ++   W                 + E  +  +   L LV +I+PY M HNAE EA DL +E+E L++L  Y   + Y ++CLY+T  V Y+ +P+N  LL+ A KI+ +F+   +A++ AL LND +    +    K   + K++AF+L R    +     V  + E+L EI+SN  L+  FL LARELDIM+PKVP+DIYK HLE +R     + +DSAR NLASS+VNG VN  FG+DK++ E+  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++  V+   +I GLG+AYAGS + + LSLL PV+ D S    E++ + AL+ G+IAV S + ++T+ ++QT+ME++ +++   +A+++ LGL L  LG+ E ++  LA+L+ + EP RS ++ + DICAYAGSG+VLKVQQLLH  SE  D  K   + ++  D        +  D  +HQG A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E++  +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDVK   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PK IT              ERAEL+TEEY+P++ + LEGFVIL+KNPN+D
Sbjct:    7 HFCADVVSVLAMTMSGERE----CLKYRLLGSQEELASWGHEYVRHLAGEVAKEW---------------QEIEEGDKVQQETLLKLVKEIVPYNMAHNAEHEACDLLMEIEHLDMLEMYIDENAYAKVCLYLTSCVSYVPEPENSALLKCALKIFRKFNRYPEALRLALMLNDVELVENIFTSCKDIVVQKEMAFMLGRHGMFLELNEDV-EDYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTED--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNVMRIGAIFGLGLAYAGSNREDVLSLLLPVMGD-SKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKNEQELKDTYARWLPLGLGLNHLGKGEAIETTLAALQVVPEPFRSFSNTLVDICAYAGSGNVLKVQQLLHTCSEHYDNTKDKDEDKDKKDKKDKDKKESAADMGSHQGAAVLGIALIAMGEEIGSEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSHNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVKNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKAIT--------------ERAELATEEYLPVTPI-LEGFVILRKNPNYD 781          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Cavefish
Match: psmd1 (proteasome 26S subunit, non-ATPase 1 [Source:NCBI gene;Acc:103040371])

HSP 1 Score: 55.4546 bits (132), Expect = 3.234e-7
Identity = 61/260 (23.46%), Postives = 119/260 (45.77%), Query Frame = 1
Query: 1126 DSARNNL---ASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDD----YIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHI 1884
            D+ RN++   A+   N  ++ G   D+ + E    ++W+ +       +   +LG + +      L  +  YL  D      Y + GGL A G+++A   +  D    LL +    S  ++     +GLG+A  G+ + +   LL+  +        E    A L+ GL+ + S+ A+     I+ M+  + E  +    + + +G+AL   GR E+ D ++ SL   ++P+   + +     AY GSG+   +++LLH+
Sbjct:  359 DAVRNSVCHTATVIANSFMHTGTTSDQFLRE---NLEWLARATNWAKFTATASLGVIHRGHEKEALQLMATYLPKDTSPGSAYQEGGGLYALGLIHAN--HGGDIIDYLLSQLKNASNDIVRHGGALGLGLAALGTARQDVYDLLKSNLYQDDAVTGEA---AGLALGLVMLGSKSAQA----IEDMVGYAQETQHEKILRGLAVGIALVMYGRMEEADALIESLCRDKDPILRRSGMYTVGMAYCGSGNNKAIRRLLHV 606          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Sea Lamprey
Match: psmd2 (proteasome 26S subunit, non-ATPase 2 [Source:NCBI gene;Acc:393518])

HSP 1 Score: 169.859 bits (429), Expect = 4.920e-47
Identity = 103/287 (35.89%), Postives = 159/287 (55.40%), Query Frame = 1
Query:   73 KGDAKIEKDEMSEEDKILKLEIENLVNSLESIDIKE-QFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQ 930
            KG       ++S+EDK L+ E+  LV  L   +    Q  ALE ++R I S+TTSMTSVPKPLK+LR  YA +   +      + ++ CADI+SV+ + ++ +     D L +R  G  E ++ WGHEY+RHL  ++   W  +D + +      E      +   +   L LV +I+PY M HNAE EA DL +E+E L+LLS +   S + ++CLY+T  V Y+ +P++  LL  A     QF    +A++ AL+LND+D    +    +   + KQ+AF+L R 
Sbjct:   36 KGSVPSHHQDLSDEDKQLQEELSLLVERLSETEAPALQRAALEELRRQIRSSTTSMTSVPKPLKFLRPHYAALCAAWEATPPGEERRFCADIVSVLAMTVSAER----DCLRYRLRGSQEPLASWGHEYVRHLAGEVAKAW--QDATEEDGGGGGESEGVAAAGGGRAALLKLVEEIVPYDMAHNAEPEACDLLMEIERLDLLSAHVDESTFTKVCLYLTSCVSYVPEPESGALLRCALATLRQFGRHPEALRLALQLNDADLIADVFSSCRDVTVQKQMAFVLDRH 316          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Sea Lamprey
Match: psmd2 (proteasome 26S subunit, non-ATPase 2 [Source:NCBI gene;Acc:393518])

HSP 1 Score: 168.318 bits (425), Expect = 1.178e-46
Identity = 104/287 (36.24%), Postives = 160/287 (55.75%), Query Frame = 1
Query:   73 KGDAKIEKDEMSEEDKILKLEIENLVNSLESIDIKE-QFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQ 930
            K  A  E  ++S+EDK L+ E+  LV  L   +    Q  ALE ++R I S+TTSMTSVPKPLK+LR  YA +   +      + ++ CADI+SV+ + ++ +     D L +R  G  E ++ WGHEY+RHL  ++   W  +D + +      E      +   +   L LV +I+PY M HNAE EA DL +E+E L+LLS +   S + ++CLY+T  V Y+ +P++  LL  A     QF    +A++ AL+LND+D    +    +   + KQ+AF+L R 
Sbjct:   21 KEKAPDENQDLSDEDKQLQEELSLLVERLSETEAPALQRAALEELRRQIRSSTTSMTSVPKPLKFLRPHYAALCAAWEATPPGEERRFCADIVSVLAMTVSAER----DCLRYRLRGSQEPLASWGHEYVRHLAGEVAKAW--QDATEEDGGGGGESEGVAAAGGGRAALLKLVEEIVPYDMAHNAEPEACDLLMEIERLDLLSAHVDESTFTKVCLYLTSCVSYVPEPESGALLRCALATLRQFGRHPEALRLALQLNDADLIADVFSSCRDVTVQKQMAFVLDRH 301          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Sea Lamprey
Match: psmd1 (proteasome 26S subunit, non-ATPase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-810])

HSP 1 Score: 73.1738 bits (178), Expect = 1.691e-13
Identity = 59/260 (22.69%), Postives = 116/260 (44.62%), Query Frame = 1
Query: 1126 DSARNNL---ASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDD----YIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHI 1884
            D+ RN++   A+   N  ++CG   D+ +  +   ++W+ +       +   +LG + +      L  +  YL  D      Y + GGL A G+++A    E    L  L +    +  ++     +GLG+A  G+ + +    L+    +   D       A L+ GL+ + S+ A      I+ M+  + E  +    + + +G+A    GR E+ D ++ SL   ++P+   + +     AY GSGS   +++LLH+
Sbjct:  361 DAVRNSVCHTATVIANSFMHCGTTSDQFLRIDRDNLEWLARATNWAKFTATASLGVIHKGHEKEALQLMATYLPKDSSPGSAYQEGGGLYALGLIHANHGGEITEYL--LNQLKNANSDIVRHGGCLGLGLAAMGTARQDVYEQLK---FNLYQDDAVTGEAAGLAMGLVMLGSRSA----TAIEDMVAYAQETQHEKILRGLAVGIATVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGSNKAIRRLLHV 611          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Yeast
Match: RPN1 (Non-ATPase base subunit of the 19S RP of the 26S proteasome; may participate in the recognition of several ligands of the proteasome; contains a leucine-rich repeat (LRR) domain, a site for protein-protein interactions; RP is the acronym for regulatory particle [Source:SGD;Acc:S000001069])

HSP 1 Score: 387.882 bits (995), Expect = 7.392e-120
Identity = 230/602 (38.21%), Postives = 358/602 (59.47%), Query Frame = 1
Query:  115 DKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTN---KDLSNDSTVDCSEDNLSEHSESL---KVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKN-ECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTD-KFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEK 1896
            D  LK ++E LV  L+  D      +L ++K  I ++T+SMT+VPKPLK+LR  Y  + + Y K +D   K   AD++S++   MT  E    D+L +R L    D   WGHEYIRHL  +I   + +   KD  ++++ D S+ + S  +      K   L L   I+PYF+KHN E +A+DL +E+E ++ L ++   + + R+C YM   V  L  P++   L+ A  IY   +++  A+  A+RL + D   ++ +      + KQLA++LA Q+ +  YE + +        II N  LSE+FL LA+EL++  PKVPEDIYK HL+ S+    SA LDSA+ NLASS+VNG +N G+  DK+I++ ++   WVYK K  GM S V ++G + QW++D GL  +DKYLY D+  +KAG LL  G+  +GV + E +PAL LL +YVTN    +S A+I+GLG+A+AGS+  E L LL P+    STD   E + +A+L+   + V + + ++TT ++   +ER++ ++   + +F+ L L +  +G+ EQVD VL ++ A+  P+ S   ++   CAY G+G VL +Q LLH L+ K
Sbjct:   42 DAKLKTDLELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLKFLRPTYPDLCSIYDKWTDPNLKSSLADVLSILA--MTYSENGKHDSLRYRLLSDVSDFEGWGHEYIRHLALEIGEVYNDQVEKDAEDETSSDGSKSDGSAATSGFEFSKEDTLRLCLDIVPYFLKHNGEEDAVDLLLEIESIDKLPQFVDENTFQRVCQYMVACVPLLPPPEDVAFLKTAYSIYLSQNELTDAIALAVRLGEEDMIRSVFDATSDPVMHKQLAYILAAQKTSFEYEGVQD--------IIGNGKLSEHFLYLAKELNLTGPKVPEDIYKSHLDNSKSVFSSAGLDSAQQNLASSFVNGFLNLGYCNDKLIVDNDN---WVYKTKGDGMTSAVASIGSIYQWNLD-GLQQLDKYLYVDEPEVKAGALLGIGISASGVHDGEVEPALLLLQDYVTNPDTKISSAAILGLGIAFAGSKNDEVLGLLLPIA--ASTDLPIETAAMASLALAHVFVGTCNGDITTSIMDNFLERTAIELKTDWVRFLALALGILYMGQGEQVDDVLETISAIEHPMTSAIEVLVGSCAYTGTGDVLLIQDLLHRLTPK 627          

HSP 2 Score: 268.085 bits (684), Expect = 2.719e-76
Identity = 132/257 (51.36%), Postives = 180/257 (70.04%), Query Frame = 1
Query: 1975 AALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWDE 2745
            A LG+ LI++GE IG+EM  R  G L+ +G   I+R VPLA+ ++  SDPQM+V DTL +FSHD+D E++  +I +MGL GAGTNNARLA +LRQLAS++S+E   LF  RLAQGLLHLGKGT+T+   + D  +++ V +  +LT  V    V  +FM +H  L + L    +P+ ++  ++   P+ V VRVGQAV+TVGQAGRPK ITG+ T +TPVLL  GERAEL T+EY+  +   +EG VILKKNP++ E
Sbjct:  739 AVLGIALIALGEDIGKEMSLRHFGHLMHYGNEHIRRMVPLAMGIVSVSDPQMKVFDTLTRFSHDADLEVSMNSIFAMGLCGAGTNNARLAQLLRQLASYYSREQDALFITRLAQGLLHLGKGTMTMDVFN-DAHVLNKVTLASILTTAVGL--VSPSFMLKHHQLFYMLNAGIRPKFILALNDEGEPIKVNVRVGQAVETVGQAGRPKKITGWITQSTPVLLNHGERAELETDEYISYTS-HIEGVVILKKNPDYRE 991          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Yeast
Match: RPN2 (Subunit of the 26S proteasome; substrate of the N-acetyltransferase Nat1p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001337])

HSP 1 Score: 66.2402 bits (160), Expect = 1.847e-11
Identity = 104/438 (23.74%), Postives = 176/438 (40.18%), Query Frame = 1
Query: 1147 ASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYL---YSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSK-------QVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSS---DPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTN-NARLAAMLRQLASF---HSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLL 2409
            A S  NG ++ G   +  I   ++ + W+ K +     +   +LG + + ++  G   +  YL    +   +IK G L   G++ AG   +    L  +   V NS         VL   + +G+G+A  GS   E    L+ V+ + S    E    AAL  GL  + +   E     I  M   S E  +    + + +GLAL   GRQE  D ++  + A  E L           AYAG+G+   V++LLH+             S +D+           + ALG  L+     +      R++  L +     ++     AL +  +       + VLD L K   D  ++ A  A LSM L+      N ++A + +   S      +E    F   +AQG+++ G   +TI   + D   +   +V GL+
Sbjct:  331 AVSVANGFMHAGTTDNSFI---KANLPWLGKAQNWAKFTATASLGVIHKGNLLEGKKVMAPYLPGSRASSRFIKGGSLYGLGLIYAGFGRDTTDYLKNI--IVENSGTSGDEDVDVLLHGASLGIGLAAMGSANIEVYEALKEVLYNDSATSGEA---AALGMGLCMLGTGKPEA----IHDMFTYSQETQHGNITRGLAVGLALINYGRQELADDLITKMLASDESLLRYGGAFTIALAYAGTGNNSAVKRLLHV---------AVSDSNDDV-------RRAAVIALGFVLLRDYTTVP-----RIVQLLSKSHNAHVRCGTAFALGIACAGKGLQSAIDVLDPLTKDPVDFVRQAAMIA-LSMILIQQTEKLNPQVADINKNFLSVITNKHQEGLAKFGACVAQGIMNAGGRNVTIQLENADTGTLDTKSVVGLV 734          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Nematostella
Match: EDO32700 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUA4])

HSP 1 Score: 61.6178 bits (148), Expect = 1.190e-9
Identity = 63/262 (24.05%), Postives = 116/262 (44.27%), Query Frame = 1
Query: 1126 DSARNNL---ASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSD----DDYIKAGGLLACGV--VNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHI 1884
            DSARN++   A+   N  ++CG   D  +    + ++W+ +       +   +LG + +      L  +  YL  D      Y + GGL A G+  VN G  N  +  L  L E  T+   ++     +GLG+A  G+ K +    L+    +   D       A L+ GL+ + S+ A      I+ M+  + E  +    + + LG++L    R E+ D ++ SL   ++     + +     AY G+G+   +++LLH+
Sbjct:  368 DSARNSVCHTATVIANSYMHCGTTSDTFL---RNNLEWLARATNWAKFTATASLGVIHKGHEQDALKLMSSYLPKDGTGGSAYQEGGGLYALGLIHVNHG-GNITEYLLQQLKEATTD---MVRHGGCLGLGLASMGTAKQDVYEQLK---FNLYQDDAITGEAAGLAMGLVMLGSKSA----AAIEDMVGYAQETQHEKILRGLALGISLVMYARMEEADALIESLSHDKDSNLRRSAMYTVAMAYCGTGNNKAIKRLLHV 615          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Nematostella
Match: EDO25767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVJ2])

HSP 1 Score: 50.8322 bits (120), Expect = 2.185e-8
Identity = 24/46 (52.17%), Postives = 33/46 (71.74%), Query Frame = 1
Query:  190 ALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNK 327
            ALE+++  I ++T+SMTSVPKPLK+LR  YA +K  Y    D +NK
Sbjct:   14 ALEALRSQIRASTSSMTSVPKPLKFLRPHYASMKEVYQGWPDGENK 59          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Medaka
Match: psmd2 (proteasome 26S subunit, non-ATPase 2 [Source:NCBI gene;Acc:101157873])

HSP 1 Score: 870.922 bits (2249), Expect = 0.000e+0
Identity = 452/885 (51.07%), Postives = 618/885 (69.83%), Query Frame = 1
Query:  115 DKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKAD---------EKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWD 2742
            DK L+ ++E +V  L   +      ALE ++R+I S+TTSMTSVPKPLK+LR  YAK+K  Y  M+  +NK  CAD++SV+ + M+ + E     L++R LG  E+++ WGHEY+RHL  ++   W              E+N     E+L    L LV +I+PY M HNAE EA DL +E+E L++L  Y   + Y ++CLY+T  V Y+ +P+N  LL +A  I+ +F+   +A++ AL LND +    +    K   + KQ+AF+L R    +     V  + E+L EI+SN  L+  FL LARELDIM+PKVP+DIYK HLE +R     + +DSAR NLASS+VNG VN  FG+DK++ ++  G KW+YKNK+ GM+S   +LG +L WDVDGGL+ IDKYLYS +DYIK+G LLACG+VN+GV+NECDPALALL +YV ++  V+   +I GLG+AYAGS + + LSLL PV+ D S    E+  + AL+ G+IAV S + ++T+ ++QT+ME++ +++   +A+++ LGL L  LG+ E ++  LA+L+ + EP RS A+ + DICAYAGSG+VLKVQQLLHI SE  +         + K  KK ++  +N  D  +HQG+A LG+ LI+MGE IG EM  R  G LLR+GE  ++RAVPLALAL+  S+P++ +LDTL KFSHD+D E++  +I +MG+VG+GTNNARLAAMLRQLA +H+K+P+ LF VRLAQGL HLGKGTLT+ P+H DR LMS VAV GLLT+LVS LDVK   + +  Y+L+ L  A QPR+L+TFDE L PL V+VRVGQAVD VGQAG+PK ITGFQTHTTPVLLA GERAEL+TEEY+P++ + LEGFVIL+KNPN++
Sbjct:   45 DKQLQEDLEMMVERLSEKNTALYRPALEELRRLIRSSTTSMTSVPKPLKFLRPHYAKLKEIYDSMASGENKHFCADVVSVLAMTMSGERE----CLKYRLLGSQEELASWGHEYVRHLAGEVAKEWQE-----------VEENDKTQQETL----LKLVKEIVPYNMAHNAEHEACDLLMEIERLDMLEDYIDENAYGKVCLYLTSCVSYVPEPENSALLRSALNIFRRFNRFPEALRLALMLNDVELVENIFTSCKDIVIQKQMAFMLGRHGMFLELNEDV-EDYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDD--GNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNVMRIGAIFGLGLAYAGSNREDVLSLLLPVMGD-SKSSMEVVGVTALACGMIAVGSCNGDVTSTIVQTIMEKNEQELKDTYARWLPLGLGLNHLGKGEAIETTLAALQVVPEPFRSFANTLVDICAYAGSGNVLKVQQLLHICSEHYEAKEKEKEDDKDKKDKKDKDKKENAADMGSHQGVAVLGIALIAMGEEIGSEMALRTFGHLLRYGEPILRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSHNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVKNIILGKSHYILYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKAITGFQTHTTPVLLAHGERAELATEEYIPVTPI-LEGFVILRKNPNYE 905          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Medaka
Match: psmd1 (proteasome 26S subunit, non-ATPase 1 [Source:NCBI gene;Acc:101161966])

HSP 1 Score: 52.373 bits (124), Expect = 2.347e-6
Identity = 92/441 (20.86%), Postives = 178/441 (40.36%), Query Frame = 1
Query: 1126 DSARNNL---ASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDD----YIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAM--LRQLASFHSKEPH----CLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLL 2409
            D+ RN++   A+   N  ++ G   D+ + E    ++W+ +       +   +LG + +      L  +  YL  D      Y + GGL A G+++A   +  D    LL +    S  ++     +GLG+A  G+ + +   LL+  +        E    A L+ GL+ + S+ A+     I+ M+  + E  +    + + +G+A+    R E+ D ++ SL   ++P+   + +     AY GSG+   +++LLH+             +  D+++     A +      +G I    P   E    V+  L       ++    +AL +  +       ++ L   ++D    +   A+++  L+           +   RQL S    + H      F   LAQG+L  G   +TIS   +      P  VG L+
Sbjct:  359 DAVRNSVCHTATVIANSFMHSGTTSDQFLRE---NLEWLARATNWAKFTATASLGVIHKGHEKEALQLMATYLPKDTSPGSAYQEGGGLYALGLIHAN--HGGDIIDYLLSQLKNASNDIVRHGGALGLGLAALGTARQDVYDLLKSNLYQDDAVTGEA---AGLALGLVMLGSKSAQA----IEDMVGYAQETQHEKILRGLAVGIAMVMYARMEEADALIESLCRDKDPILRRSGMYTVGMAYCGSGNNKAIRRLLHV-------------AVSDVNDDVRRAAVE-----SIGFILFRTP---EQCPSVVSLLSESYNPHVRCGAAMALGICCAGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEVTCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGILDAGGRNVTISLQSRTGHTHMPSVVGLLV 766          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Planmine SMEST
Match: SMESG000010192.1 (SMESG000010192.1)

HSP 1 Score: 1803.11 bits (4669), Expect = 0.000e+0
Identity = 894/896 (99.78%), Postives = 895/896 (99.89%), Query Frame = 1
Query:   61 MSVLKGDAKIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWDES 2748
            MSVLKGDAK EKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLK+RCLALVHKIMPYFMKHNAETEAIDLCIELELLELLSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYALALLEKAKGEALPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWDES
Sbjct:    1 MSVLKGDAKTEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKLRCLALVHKIMPYFMKHNAETEAIDLCIELELLELLSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYALALLEKAKGEALPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWDES 896          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Planmine SMEST
Match: SMESG000001376.1 (SMESG000001376.1)

HSP 1 Score: 1629.77 bits (4219), Expect = 0.000e+0
Identity = 811/813 (99.75%), Postives = 813/813 (100.00%), Query Frame = 1
Query:   61 MSVLKGDAKIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQP 2499
            MSV+KGDAKIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIELELLELLSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYALALLEKAKGEALPKQLAFLLARQQYNVPYENLVNS+MEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQP
Sbjct:    1 MSVIKGDAKIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIELELLELLSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYALALLEKAKGEALPKQLAFLLARQQYNVPYENLVNSDMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQP 813          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Planmine SMEST
Match: SMESG000073139.1 (SMESG000073139.1)

HSP 1 Score: 1602.42 bits (4148), Expect = 0.000e+0
Identity = 790/904 (87.39%), Postives = 844/904 (93.36%), Query Frame = 1
Query:   61 MSVLKGDAKIEKDEMS--------EEDKILKLEIENLVNSLESIDIKEQFTALESMKRIIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIGIVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLSNDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIXXXXXXXXSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDDIGQAMKCALRLNDSDYXXXXXXXXXXXXXPKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWDES 2748
            M+V+KG+ K+E+ EM+        EEDKILKLE+EN VNSLES DI EQ TALES+K++IISATTSMTSVPKPLKYLRD Y KV+NEY KM +  NK+LCADIISVIG+VMTDKEEY  DTL+FRFLGLCEDVSIWGHEYIRH+TNQIV+ WTNKDLSND++ DCSE+NLSEHSE+LKVRCLALVH I+PYFMKHNAETEAIDLCIELELLELLSKYAS SNY+RICLYMTKTVMYLSDPDNRKLLEAAAKIYE+F D+GQAMKCALRLNDS YALALL  AKGEALPKQLAFLLARQQYNVPYENLVN+N  ELVE+ISNSHLSEYFL LARELDIM+PKVPEDIYKLHLEP+RPTLGS NL SA+NNL+ SYVNGLVNCGFGKDKVIME+ESGM WVYKNKE GMMST+GTLGWVLQWDVDGGLSCIDKYLYSD+DYIKAGGLLACGVVN GVKNECDPALALLGEYVTNSK VLSRASIVGLG+AYAGSRK ECLSLLQP+ILDTS +KFELSCLAALSSGLIAVSS DAELTTILIQTMMERS+EQM  PFAKF+VLGLAL CLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLK+QQLL+ILS+K DEKKPT+   E+++NQFDYQAHQGLAALGVGLISMG PI QEMG RVLGRLLRFG+V IKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEP CLFAVRLAQGLLHLGKG++TISPHHQDRFLMSPVAVGGLLT LVSCLDVK TFMNR+DY LFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDT+GQAG+PKTITGFQTHTTPVLLA GERAEL TEEYMPISQLPLEGFVILK+NPNW+ES
Sbjct:    1 MTVIKGNDKVERREMNNFENKIVDEEDKILKLELENFVNSLESSDITEQLTALESIKKVIISATTSMTSVPKPLKYLRDHYVKVRNEYPKMWNSINKKLCADIISVIGMVMTDKEEYSGDTLDFRFLGLCEDVSIWGHEYIRHITNQIVSIWTNKDLSNDNSADCSEENLSEHSENLKVRCLALVHNIIPYFMKHNAETEAIDLCIELELLELLSKYASISNYNRICLYMTKTVMYLSDPDNRKLLEAAAKIYEKFGDLGQAMKCALRLNDSGYALALLGMAKGEALPKQLAFLLARQQYNVPYENLVNTNRTELVEMISNSHLSEYFLALARELDIMEPKVPEDIYKLHLEPNRPTLGSVNLYSAQNNLSYSYVNGLVNCGFGKDKVIMEDESGMNWVYKNKEEGMMSTIGTLGWVLQWDVDGGLSCIDKYLYSDNDYIKAGGLLACGVVNTGVKNECDPALALLGEYVTNSKPVLSRASIVGLGIAYAGSRKLECLSLLQPIILDTSAEKFELSCLAALSSGLIAVSSLDAELTTILIQTMMERSTEQMKQPFAKFLVLGLALNCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKIQQLLYILSKKTDEKKPTENG-ENVNNQFDYQAHQGLAALGVGLISMGNPINQEMGLRVLGRLLRFGDVDIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPDCLFAVRLAQGLLHLGKGSMTISPHHQDRFLMSPVAVGGLLTFLVSCLDVKTTFMNRNDYFLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTIGQAGQPKTITGFQTHTTPVLLATGERAELGTEEYMPISQLPLEGFVILKRNPNWEES 903          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Planmine SMEST
Match: SMESG000073149.1 (SMESG000073149.1)

HSP 1 Score: 1117.84 bits (2890), Expect = 0.000e+0
Identity = 543/617 (88.01%), Postives = 570/617 (92.38%), Query Frame = 1
Query:  898 PKQLAFLLARQQYNVPYENLVNSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTLGSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLHILSEKADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRLAQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRHDYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITGFQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWDES 2748
            PKQLAFLLARQQYNVPYENLVN+   ELVE+ISNSHLSEYFL LARELDIM+PKVPEDIYKL LE +RPTLGS NL SA+NNL+ SYVNGLVNCGFGKDKVIME+ESG+KWVYKNKE GMMST+GTLGWVLQWDVDGGLSCIDKYLYSD+DYIKAGGLLACGVVN GVK+ECDPALALLGEYVTNSK VLSRASIVGLG+AYAGSRKPECLSLLQP+ILDTS +KFELSCLAALSSGLIAVSS DAELT ILIQTMMERS+EQM  PFAKF+VLGLAL CLGRQEQVDVVLASLEAL EPLRSMAHLMCDICAY GSGSVLK+QQLL+ILSEK DEKKPTK                GLAALGVGLISMG PI QEMG RVL RLLRFG+V IK+AVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEP CLFAVRLAQGLLHLGKG++TISPHHQDRFLMSPVAVGGLLTLLVSCLDVK TFMNRHDY LFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDT+GQAG+PKTITGFQTHTTPVLLA GERAEL TEEYMP+SQLPLEGFVILK+NPNW+ES
Sbjct:    8 PKQLAFLLARQQYNVPYENLVNAKRAELVELISNSHLSEYFLALARELDIMEPKVPEDIYKLQLESNRPTLGSVNLYSAQNNLSYSYVNGLVNCGFGKDKVIMEDESGIKWVYKNKEEGMMSTIGTLGWVLQWDVDGGLSCIDKYLYSDNDYIKAGGLLACGVVNTGVKSECDPALALLGEYVTNSKPVLSRASIVGLGIAYAGSRKPECLSLLQPLILDTSAEKFELSCLAALSSGLIAVSSLDAELTKILIQTMMERSTEQMKQPFAKFLVLGLALNCLGRQEQVDVVLASLEALIEPLRSMAHLMCDICAYVGSGSVLKIQQLLYILSEKTDEKKPTKN---------------GLAALGVGLISMGNPINQEMGLRVLNRLLRFGDVDIKQAVPLALALMWSSDPQMRVLDTLGKFSHDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPDCLFAVRLAQGLLHLGKGSMTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKTTFMNRHDYFLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTIGQAGQPKTITGFQTHTTPVLLATGERAELGTEEYMPVSQLPLEGFVILKRNPNWEES 609          
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Planmine SMEST
Match: SMESG000004988.1 (SMESG000004988.1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.515e-10
Identity = 88/417 (21.10%), Postives = 177/417 (42.45%), Query Frame = 1
Query: 1123 LDSARNNL-------ASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMMSTVGTLGWVLQWDVDGGLSCIDKYLYSDDD-------YIKAGGLLACGVVNAGVK-NECDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDTSTDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKFMVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVLKVQQLLH-ILSEKADEKKPTK---------KSEEDIDNQF-----DYQAHQGL-AALGVGLISMGEPIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMR------VLDTLGKFSHDSDQEL--AFTAILSMGLVGAGTNNARLAAMLR 2256
            LD  +N++       A+   NGL++ G   D+ + E    + W+ +       +   TLG + +      L  +  YL  ++        Y + GGL A G+++A    NE    L  L +    + + +     +GLG+A  G+ + +    ++  +        E    A +  GL+ + S  +E+    I  M+  + +  +    + + LG+ALT  G+QE  D ++  L + + P+   A +     AY G+G    +++LLH  +S+ AD+ +            K+ E + +        Y  H    AA+ VG+   G  + + +   V+  LL      +++   +A++++     ++         + + K   D  ++L   F AI++MG++ AG  N  ++   R
Sbjct:  360 LDKIKNDVRHSVTHNATVITNGLMHFGTTSDQFLRE---NLDWLGRAVNWAKFTATSTLGVIHKGHEKEALKLMSAYLPKENSTTASGSMYTEGGGLYALGLMHANHGGNEMTEYL--LKKLRDATAEPVRHGGCLGLGLAAMGTERADVYEQIKSNLYQDDAITGEA---AGIGMGLVMLGSGSSEV----INDMLGYAKDTAHEKITRGLALGIALTMYGKQEDADSIIEQLISEKYPILRWAGMATIAMAYCGTGDNSAIRKLLHAAVSDTADDVRRWAVTALGFVLFKNPEQVPSLVSLLSESYNPHVRYGAAMAVGIGCAGTALKEAIA--VVDPLLEDPVAFVRQGALVAMSMLLMQQTKVTYPKSVDFREKIFKIIADRHEDLMTKFGAIIAMGIMDAGGRNVTISLQTR 762          
The following BLAST results are available for this feature:
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PSMD20.000e+051.12proteasome 26S subunit, non-ATPase 2 [Source:HGNC ... [more]
PSMD20.000e+051.52proteasome 26S subunit, non-ATPase 2 [Source:HGNC ... [more]
PSMD20.000e+053.57proteasome 26S subunit, non-ATPase 2 [Source:HGNC ... [more]
PSMD21.756e-5846.64proteasome 26S subunit, non-ATPase 2 [Source:HGNC ... [more]
PSMD21.517e-2647.66proteasome 26S subunit, non-ATPase 2 [Source:HGNC ... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpn-11.331e-14641.3526S proteasome non-ATPase regulatory subunit 2 [S... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rpn10.000e+050.40gene:FBgn0028695 transcript:FBtr0074893[more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PSMD20.000e+054.95proteasome 26S subunit, non-ATPase 2 [Source:HGNC ... [more]
psmd21.391e-5939.32proteasome 26S subunit, non-ATPase 2 [Source:NCBI ... [more]
psmd11.039e-721.09proteasome 26S subunit, non-ATPase 1 [Source:ZFIN;... [more]
psmd11.055e-721.09proteasome 26S subunit, non-ATPase 1 [Source:ZFIN;... [more]
psmd11.274e-721.09proteasome 26S subunit, non-ATPase 1 [Source:ZFIN;... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd20.000e+051.63proteasome 26S subunit, non-ATPase 2 [Source:NCBI ... [more]
psmd20.000e+050.06proteasome 26S subunit, non-ATPase 2 [Source:NCBI ... [more]
psmd20.000e+051.47proteasome 26S subunit, non-ATPase 2 [Source:NCBI ... [more]
psmd23.878e-1156.98proteasome 26S subunit, non-ATPase 2 [Source:NCBI ... [more]
psmd20.000e+056.98proteasome 26S subunit, non-ATPase 2 [Source:NCBI ... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Psmd20.000e+051.06proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd22.863e-2748.51proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd21.560e-1941.57proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd14.227e-1321.54proteasome (prosome, macropain) 26S subunit, non-A... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P56701|PSMD2_BOVIN0.000e+051.1226S proteasome non-ATPase regulatory subunit 2 OS=... [more]
sp|Q5R9I6|PSMD2_PONAB0.000e+051.1226S proteasome non-ATPase regulatory subunit 2 OS=... [more]
sp|Q13200|PSMD2_HUMAN0.000e+051.1226S proteasome non-ATPase regulatory subunit 2 OS=... [more]
sp|Q8VDM4|PSMD2_MOUSE0.000e+051.0626S proteasome non-ATPase regulatory subunit 2 OS=... [more]
sp|Q4FZT9|PSMD2_RAT0.000e+050.9526S proteasome non-ATPase regulatory subunit 2 OS=... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IFI70.000e+053.1626S proteasome non-ATPase regulatory subunit 2 OS=... [more]
A0A210QZJ70.000e+053.5626S proteasome non-ATPase regulatory subunit 2 OS=... [more]
K1PEY40.000e+052.3126S proteasome non-ATPase regulatory subunit 2 OS=... [more]
A0A0B7BKI90.000e+052.26Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
K1QDM20.000e+052.9026S proteasome non-ATPase regulatory subunit 2 OS=... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
psmd20.000e+049.94proteasome 26S subunit, non-ATPase 2 [Source:NCBI ... [more]
psmd20.000e+049.32proteasome 26S subunit, non-ATPase 2 [Source:NCBI ... [more]
psmd13.234e-723.46proteasome 26S subunit, non-ATPase 1 [Source:NCBI ... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
psmd24.920e-4735.89proteasome 26S subunit, non-ATPase 2 [Source:NCBI ... [more]
psmd21.178e-4636.24proteasome 26S subunit, non-ATPase 2 [Source:NCBI ... [more]
psmd11.691e-1322.69proteasome 26S subunit, non-ATPase 1 [Source:ZFIN;... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPN17.392e-12038.21Non-ATPase base subunit of the 19S RP of the 26S p... [more]
RPN21.847e-1123.74Subunit of the 26S proteasome; substrate of the N-... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO327001.190e-924.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO257672.185e-852.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
psmd20.000e+051.07proteasome 26S subunit, non-ATPase 2 [Source:NCBI ... [more]
psmd12.347e-620.86proteasome 26S subunit, non-ATPase 1 [Source:NCBI ... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010192.10.000e+099.78SMESG000010192.1[more]
SMESG000001376.10.000e+099.75SMESG000001376.1[more]
SMESG000073139.10.000e+087.39SMESG000073139.1[more]
SMESG000073149.10.000e+088.01SMESG000073149.1[more]
SMESG000004988.12.515e-1021.10SMESG000004988.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003353 ID=SMED30003353|Name=26S proteasome non-ATPase regulatory subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2813bp
AACAGGTGTTGCATATTTTAAATATATCTTAATCATTTTAACATTTTAAT
AACTAAAGGAATGTCTGTTTTAAAAGGTGATGCCAAGATTGAAAAAGATG
AAATGTCGGAAGAAGATAAAATTCTCAAACTAGAAATTGAAAATTTAGTT
AATTCTTTAGAATCAATTGATATTAAAGAACAATTTACAGCACTGGAAAG
TATGAAAAGAATTATTATTTCAGCAACTACATCAATGACTAGTGTGCCCA
AACCATTGAAATATTTACGAGATCAATATGCAAAAGTTAAAAATGAATAT
TCCAAAATGTCGGATATTAAAAATAAACAGCTTTGTGCTGATATAATTTC
TGTCATTGGTATTGTTATGACTGATAAAGAAGAATATTGCGCTGATACTC
TTGAATTTCGGTTTCTTGGACTTTGTGAAGACGTGTCCATATGGGGCCAC
GAATATATTAGACACTTGACCAATCAAATCGTAGCAACCTGGACAAATAA
AGATTTATCTAATGATAGCACAGTTGATTGTAGTGAAGATAATCTTTCTG
AACACAGTGAAAGCCTTAAAGTTCGTTGTTTGGCTTTGGTTCACAAAATA
ATGCCATATTTCATGAAGCATAATGCTGAAACTGAAGCAATTGATTTATG
TATTGAATTAGAATTATTGGAATTGCTCAGTAAATATGCTTCAAGTTCAA
ATTATGATAGAATATGTTTATACATGACTAAAACGGTAATGTATTTGTCA
GATCCTGATAATAGAAAATTGCTTGAAGCTGCAGCAAAGATTTATGAACA
ATTTGATGATATAGGACAAGCAATGAAATGTGCTTTAAGATTAAACGATT
CAGACTATGCACTTGCGTTATTGGAAAAAGCGAAAGGTGAAGCTCTACCC
AAACAATTAGCATTTCTTTTAGCACGTCAACAATATAATGTACCCTATGA
AAATTTGGTGAATTCTAATATGGAGGAATTGGTTGAAATTATCAGCAATT
CGCATTTAAGTGAATACTTTTTAGTTTTGGCCAGAGAATTGGATATAATG
GATCCAAAGGTACCAGAAGACATATATAAGTTACACCTTGAACCTAGCAG
ACCTACATTAGGATCTGCAAATTTAGATAGTGCACGAAACAATTTAGCGT
CATCTTATGTAAATGGGTTAGTGAATTGTGGATTCGGAAAGGATAAAGTT
ATTATGGAGGAAGAAAGCGGAATGAAGTGGGTTTATAAAAATAAAGAAGG
TGGAATGATGAGTACTGTCGGAACATTGGGTTGGGTTTTGCAATGGGATG
TTGATGGTGGTTTAAGCTGCATCGATAAATATTTGTATTCGGATGATGAC
TACATAAAAGCTGGTGGTCTGTTAGCATGTGGTGTGGTAAATGCTGGAGT
TAAAAATGAATGTGACCCGGCGTTGGCTTTGCTGGGAGAATATGTCACAA
ACAGTAAACAAGTTCTGTCAAGAGCATCAATCGTTGGACTTGGAGTAGCT
TATGCGGGCAGCCGTAAACCCGAATGCCTTTCATTATTGCAGCCCGTAAT
TTTGGATACAAGTACTGATAAATTTGAATTATCTTGCCTGGCTGCATTAT
CATCTGGATTGATCGCTGTCAGTAGTCAAGACGCCGAACTCACAACGATA
TTAATACAAACCATGATGGAGCGCTCATCGGAACAAATGAATCATCCTTT
TGCTAAATTTATGGTGTTGGGATTGGCTTTAACTTGTCTTGGAAGACAGG
AACAAGTCGATGTCGTACTAGCATCACTCGAAGCATTAAGAGAACCGTTA
CGATCAATGGCACACTTGATGTGTGACATTTGTGCATATGCTGGCTCAGG
ATCAGTGTTGAAAGTCCAACAATTGCTTCATATTTTGTCAGAAAAAGCTG
ATGAGAAAAAGCCTACTAAAAAAAGTGAAGAAGATATCGATAATCAATTC
GATTACCAGGCCCATCAAGGATTGGCTGCCCTCGGTGTTGGGCTTATCAG
TATGGGCGAGCCAATTGGCCAGGAAATGGGATTCCGAGTTCTCGGTCGAT
TGTTGCGATTCGGAGAAGTTGGTATCAAACGCGCTGTTCCATTAGCTCTT
GCTTTAATGTGGTCCAGCGATCCCCAGATGCGAGTTCTCGACACTCTTGG
CAAATTTAGTCACGACTCTGATCAAGAACTAGCTTTTACAGCTATCTTAT
CGATGGGATTGGTTGGTGCTGGTACTAACAATGCCCGCCTGGCAGCTATG
CTGAGACAATTAGCATCGTTTCATTCCAAGGAACCGCATTGTCTGTTTGC
TGTTCGATTAGCTCAAGGTCTGTTGCATCTCGGTAAAGGAACACTGACAA
TAAGTCCTCATCACCAGGATCGATTTCTAATGAGTCCAGTCGCGGTTGGG
GGACTCCTGACACTTCTGGTGTCGTGTTTAGATGTGAAGAGAACATTTAT
GAATCGACACGATTATTTGCTGTTTTATTTGACACCTGCATTTCAGCCCA
GATTATTGATGACCTTTGATGAGTCACTTCATCCACTTACAGTTACCGTG
AGGGTTGGTCAAGCTGTCGACACTGTTGGGCAAGCTGGGCGGCCTAAAAC
TATAACCGGATTTCAAACCCATACAACTCCGGTTTTGCTGGCTGCTGGAG
AGCGTGCTGAATTGAGTACAGAGGAATATATGCCAATTAGTCAGCTCCCG
CTTGAAGGATTTGTAATTTTAAAGAAGAATCCCAATTGGGACGAATCTTA
AAACTGTTTAAATGTAATTATTAATTTGTTAAAAAAATTGTTTTGTCTTT
GAAAAAAAAGATC
back to top

protein sequence of SMED30003353-orf-1

>SMED30003353-orf-1 ID=SMED30003353-orf-1|Name=SMED30003353-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=897bp
MSVLKGDAKIEKDEMSEEDKILKLEIENLVNSLESIDIKEQFTALESMKR
IIISATTSMTSVPKPLKYLRDQYAKVKNEYSKMSDIKNKQLCADIISVIG
IVMTDKEEYCADTLEFRFLGLCEDVSIWGHEYIRHLTNQIVATWTNKDLS
NDSTVDCSEDNLSEHSESLKVRCLALVHKIMPYFMKHNAETEAIDLCIEL
ELLELLSKYASSSNYDRICLYMTKTVMYLSDPDNRKLLEAAAKIYEQFDD
IGQAMKCALRLNDSDYALALLEKAKGEALPKQLAFLLARQQYNVPYENLV
NSNMEELVEIISNSHLSEYFLVLARELDIMDPKVPEDIYKLHLEPSRPTL
GSANLDSARNNLASSYVNGLVNCGFGKDKVIMEEESGMKWVYKNKEGGMM
STVGTLGWVLQWDVDGGLSCIDKYLYSDDDYIKAGGLLACGVVNAGVKNE
CDPALALLGEYVTNSKQVLSRASIVGLGVAYAGSRKPECLSLLQPVILDT
STDKFELSCLAALSSGLIAVSSQDAELTTILIQTMMERSSEQMNHPFAKF
MVLGLALTCLGRQEQVDVVLASLEALREPLRSMAHLMCDICAYAGSGSVL
KVQQLLHILSEKADEKKPTKKSEEDIDNQFDYQAHQGLAALGVGLISMGE
PIGQEMGFRVLGRLLRFGEVGIKRAVPLALALMWSSDPQMRVLDTLGKFS
HDSDQELAFTAILSMGLVGAGTNNARLAAMLRQLASFHSKEPHCLFAVRL
AQGLLHLGKGTLTISPHHQDRFLMSPVAVGGLLTLLVSCLDVKRTFMNRH
DYLLFYLTPAFQPRLLMTFDESLHPLTVTVRVGQAVDTVGQAGRPKTITG
FQTHTTPVLLAAGERAELSTEEYMPISQLPLEGFVILKKNPNWDES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0008540proteasome regulatory particle, base subcomplex
GO:0022624proteasome accessory complex
GO:0000502proteasome complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR041433RPN1_C
IPR040892RPN1_RPN2_N
IPR002015Proteasome/cyclosome_rpt
IPR01664326S_Psome_Rpn1
IPR016024ARM-type_fold
Vocabulary: biological process
TermDefinition
GO:0042176regulation of protein catabolic process
GO:0050790regulation of catalytic activity
Vocabulary: molecular function
TermDefinition
GO:0030234enzyme regulator activity
GO:0005488binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 351..792
e-value: 3.5E-100
score: 337.6
IPR002015Proteasome/cyclosome repeatPFAMPF01851PC_repcoord: 711..739
e-value: 8.3E-5
score: 22.8
IPR04143326S proteasome non-ATPase regulatory subunit RPN1, C-terminalPFAMPF18051RPN1_Ccoord: 839..893
e-value: 2.5E-30
score: 104.3
IPR01664326S proteasome regulatory complex, non-ATPase subcomplex, Rpn1 subunitPIRSFPIRSF01596526S_protsm_Rpn1coord: 3..896
e-value: 0.0
score: 1116.4
IPR01664326S proteasome regulatory complex, non-ATPase subcomplex, Rpn1 subunitPANTHERPTHR10943:SF126S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 2coord: 10..895
IPR040892RPN1/RPN2, N-terminalPFAMPF17781RPN1_RPN2_Ncoord: 26..344
e-value: 2.2E-96
score: 322.9
NoneNo IPR availablePANTHERPTHR1094326S PROTEASOME NON-ATPASE REGULATORY SUBUNITcoord: 10..895
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 18..759