slc12a-4

Overview
Nameslc12a-4 (AKN21478.1)
Smed IDSMED30003346
Length (bp)3681
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc12a-4 (SMED30003346) t-SNE clustered cells

Violin plots show distribution of expression levels for slc12a-4 (SMED30003346) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc12a-4 (SMED30003346) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc12a-4 (SMED30003346) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003346

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30003346SMESG000019076.1 SmedASXL_017003SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30003346SMESG000019076.1 dd_Smed_v4_4389_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30003346SMESG000019076.1 dd_Smed_v4_4389_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003346SMESG000019076.1 dd_Smed_v4_4389_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003346SMESG000019076.1 dd_Smed_v4_4389_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003346SMESG000019076.1 dd_Smed_v4_4389_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003346SMESG000019076.1 dd_Smed_v4_4389_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30003346SMESG000019076.1 dd_Smed_v4_4389_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003346SMESG000019076.1 SMESG000052056.1 SMESG000025956.1 Contig42190uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003346SMESG000019076.1 SMESG000052056.1 SMESG000025956.1 Contig42190newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30003346SMESG000019076.1 dd_Smed_v6_4389_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30003346SMESG000019076.1 SMED30003346smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
collecting ductSMED30003346SMESG000019076.1 SMESG000052056.1 SMESG000025956.1 Smed-slc12a-4smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
distal tubuleSMED30003346SMESG000019076.1 SMESG000052056.1 SMESG000025956.1 Smed-slc12a-4smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc12a-4 vs. Ensembl Human
Match: SLC12A5 (solute carrier family 12 member 5 [Source:HGNC Symbol;Acc:HGNC:13818])

HSP 1 Score: 933.324 bits (2411), Expect = 0.000e+0
Identity = 501/1167 (42.93%), Postives = 709/1167 (60.75%), Query Frame = 3
Query:  132 EKAAHYVVESKVENSENITKEATPLTDEEIEMSDDEEPAGD---SKFDLYEEEFHTRPPMANIFNKLAQYTG-------GIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIEL--DENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEP-------HLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            E   H V + +    E++  +  P        S D E   +       L+EEE  T P ++++ + LA YT          E  + E  K K   + ++GT +GVY PCLQNIFGV+ FLRL W++G++G    F +VF+CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ FY GTT A AMYI+G IE++L Y+ P  ++F   +   +   M NN RVYG  +L  M + VF+G+K+V+KF+ + L CV+ SIL +Y G+   A    +  +C+LG+R L+R    D  A   +   + +   L+ L+C   ++ LN    +YF  NNVTE   IPG    L+K+  + +Y T KG +    G           +D       SD+   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP G+I A ATTS VY+S+V+ F A +E  VLRDKFG +V   L+V  LAWP+ WVI+IGSF ST GAGLQSLTGAPRLLQAI++D ++PFL+VF      GEP  A  LT  I  +G+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRF+YYHWT S LG+ LC+ALMF+ SWYYALVA+ +AG IYKYIEYRGA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ +D+    + HP+L+   SQLKAG+GLTIVG+V+EG   +    +  A+E++ R +  +++KG  ++V++SN+ + +  L Q+ GLG L+HN V+V +P  W   + H  W+ F+  +R   A  LA+LV K +  FP    +               G++D+W IVHDGG+L+LL  LL   + W KC++R+F VA   DN+I +KK++  F+Y LRI A+VEVVE+ ++DISAY +++T+ +  R +IL+ M+L   + +RE Q+I D+            +I   +P          N  +  N P    EET  D +  P+E  + ++   +    S++               ++       T D + A  +  P        SP +  G+K  FS     +N      RRMH+AVRLNE+I  +S +A L+L+N+PGP +N + D NYM+++E LT+ L RV+ VRG G+EVIT ++
Sbjct:   22 ESRRHSVADPRHLPGEDVKGDGNPKESSPFINSTDTEKGKEYDGKNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSREHEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAEDASGEAAAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKSAFDPPNFPICLLGNRTLSRHG-FDVCAKLAWEGNETVTTRLWGLFC--SSRFLNATCDEYFTRNNVTEIQGIPGAASGLIKENLWSSYLT-KGVIVERSGMTSVGLADGTPIDMDHPYVFSDMTSYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACIEGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDGIVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQD-QNVVHPQLLSLTSQLKAGKGLTIVGSVLEGTFLENHPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHLIQSGGLGGLQHNTVLVGWPRNWRQKEDHQTWRNFIELVRETTAGHLALLVTKNVSMFPGNPERFSE------------GSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTTFLYHLRITAEVEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDESR---------GSIRRKNP---------ANTRLRLNVP----EETAGDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEK--VHLTWTKDKSVAEKNKGP--------SPVSSEGIKDFFSMKPEWENLNQSNVRRMHTAVRLNEVIVKKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEHLDRVMLVRGGGREVITIYS 1139          
BLAST of slc12a-4 vs. Ensembl Human
Match: SLC12A5 (solute carrier family 12 member 5 [Source:HGNC Symbol;Acc:HGNC:13818])

HSP 1 Score: 929.472 bits (2401), Expect = 0.000e+0
Identity = 499/1148 (43.47%), Postives = 705/1148 (61.41%), Query Frame = 3
Query:  189 KEATPLTDEEIEMSDDEEPAGD---SKFDLYEEEFHTRPPMANIFNKLAQYTG-------GIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIEL--DENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEP-------HLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            KE++P  +     S D E   +       L+EEE  T P ++++ + LA YT          E  + E  K K   + ++GT +GVY PCLQNIFGV+ FLRL W++G++G    F +VF+CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ FY GTT A AMYI+G IE++L Y+ P  ++F   +   +   M NN RVYG  +L  M + VF+G+K+V+KF+ + L CV+ SIL +Y G+   A    +  +C+LG+R L+R    D  A   +   + +   L+ L+C   ++ LN    +YF  NNVTE   IPG    L+K+  + +Y T KG +    G           +D       SD+   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP G+I A ATTS VY+S+V+ F A +E  VLRDKFG +V   L+V  LAWP+ WVI+IGSF ST GAGLQSLTGAPRLLQAI++D ++PFL+VF      GEP  A  LT  I  +G+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRF+YYHWT S LG+ LC+ALMF+ SWYYALVA+ +AG IYKYIEYRGA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ +D+    + HP+L+   SQLKAG+GLTIVG+V+EG   +    +  A+E++ R +  +++KG  ++V++SN+ + +  L Q+ GLG L+HN V+V +P  W   + H  W+ F+  +R   A  LA+LV K +  FP    +               G++D+W IVHDGG+L+LL  LL   + W KC++R+F VA   DN+I +KK++  F+Y LRI A+VEVVE+ ++DISAY +++T+ +  R +IL+ M+L   + +RE Q+I D+            +I   +P          N  +  N P    EET  D +  P+E  + ++   +    S++               ++       T D + A  +  P        SP +  G+K  FS     +N      RRMH+AVRLNE+I  +S +A L+L+N+PGP +N + D NYM+++E LT+ L RV+ VRG G+EVIT ++
Sbjct:   23 KESSPFIN-----STDTEKGKEYDGKNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSREHEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAEDASGEAAAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKSAFDPPNFPICLLGNRTLSRHG-FDVCAKLAWEGNETVTTRLWGLFC--SSRFLNATCDEYFTRNNVTEIQGIPGAASGLIKENLWSSYLT-KGVIVERSGMTSVGLADGTPIDMDHPYVFSDMTSYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACIEGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDGIVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQD-QNVVHPQLLSLTSQLKAGKGLTIVGSVLEGTFLENHPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHLIQSGGLGGLQHNTVLVGWPRNWRQKEDHQTWRNFIELVRETTAGHLALLVTKNVSMFPGNPERFSE------------GSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTTFLYHLRITAEVEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDESR---------GSIRRKNP---------ANTRLRLNVP----EETAGDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEK--VHLTWTKDKSVAEKNKGP--------SPVSSEGIKDFFSMKPEWENLNQSNVRRMHTAVRLNEVIVKKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEHLDRVMLVRGGGREVITIYS 1116          
BLAST of slc12a-4 vs. Ensembl Human
Match: SLC12A6 (solute carrier family 12 member 6 [Source:HGNC Symbol;Acc:HGNC:10914])

HSP 1 Score: 927.546 bits (2396), Expect = 0.000e+0
Identity = 522/1196 (43.65%), Postives = 721/1196 (60.28%), Query Frame = 3
Query:   87 SEVINSENDLSSVA----AEKAAH--YVVESKVENSENITKEATPLTDE------EIEMSDDEEPAGDSKFD----LYEEEFHTRPPMANIFNKLAQYT----GGIEPTSGET---KKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIE-LDENI-MFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVAN-PSRSLRVCMLGDRLLNRSVV----LDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKG---QSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKES-MNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            SE+  +   L++VA    +++ +H   V+E   +NS  IT E + L D+         +++     GD  FD    L+EEE  TRP ++++ N++A YT    G  E    E     K K   + ++GT +GVY PCLQNIFGV+ FLRL W++G +G    F IV +CCC TMLT +SMSAIATNG VPAGGSYFMISR+LGPEFGG VG+ FY GTT AAAMYI+GAIE+ L YIVP+A++F   + L E+  M NN RVYG   L +M+  VFIG+++V+KF+++ LACV+ SIL +Y G   ++       VCMLG+R L+   +      KE NN    +K     L+  +C N ++  N    +YF  NNVT    IPG    ++ +  + NY   KG +  +P  +     G       + DI  SFT+L+GIFFPSVTGIMAGSNRSGDL + Q SIP+G+I A  TTSFVYLS V+ F A +E  VLRDKFG +V   L+V  L+WP+ WVI+IGSF ST GAGLQSLTGAPRLLQAIA+DN+IPFL VF  +   GEP  A  LT  I+ LG+LIAS+D +AP+++MFFLMCY FVNLA AL   L+ P+WRPRF+YYHW  S +G+ +C+ALMF+SSWYYA+VA+ +AG IYKYIEY+GA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ LDE    + HP+L+ F SQLKAG+GLTIVG+VI G   +   +++ A++T+   +  +++KG  ++VVA+ + E I  L Q+ GLG ++HN V++ +P  W   +    WK F+ T+RV  A+ LA+LV K I  FP        +NV         G +D+W IVHDGG+L+LL  LL + + W KC +R+F VA  +DN+I +KK++  F+Y LRI A+VEVVE+  +DISAY ++RT+ +  R ++L  M L   +  RE Q + D++                      S L   ++   E++ TE  +E V     H    K+  M S   K KS    Q L+                            +M P++ N                        R+  T  +++      E+I ++S  A L+L+N+PGP +N   D NYM+++E LT+GL RVL VRG G EVIT ++
Sbjct:    2 SEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNS--ITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPTKTPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAIEIFLVYIVPRAAIFHSDDALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLFLACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTLSSRHIDVCSKTKEINNMTVPSK-----LWGFFC-NSSQFFNATCDEYFVHNNVTSIQGIPGLASGIITENLWSNYLP-KGEIIEKPSAKSSDVLGSLNHEYVLVDITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKANGEPTWALLLTAAIAELGILIASLDLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDEDL-HVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLENYGEALAAEQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKHNTVVMGWPNGWRQSEDARAWKTFIGTVRVTTAAHLALLVAKNISFFP--------SNVEQFSE----GNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMHDSDISAYTYERTLMMEQRSQMLRHMRLSKTERDREAQLVKDRN----------------------SMLRLTSIGSDEDEETETYQEKV-----HMTWTKDKYMASRGQKAKSMEGFQDLL----------------------------NMRPDQSNV-----------------------RRMHTAVKLN------EVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1091          
BLAST of slc12a-4 vs. Ensembl Human
Match: SLC12A6 (solute carrier family 12 member 6 [Source:HGNC Symbol;Acc:HGNC:10914])

HSP 1 Score: 927.546 bits (2396), Expect = 0.000e+0
Identity = 522/1196 (43.65%), Postives = 721/1196 (60.28%), Query Frame = 3
Query:   87 SEVINSENDLSSVA----AEKAAH--YVVESKVENSENITKEATPLTDE------EIEMSDDEEPAGDSKFD----LYEEEFHTRPPMANIFNKLAQYT----GGIEPTSGET---KKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIE-LDENI-MFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVAN-PSRSLRVCMLGDRLLNRSVV----LDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKG---QSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKES-MNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            SE+  +   L++VA    +++ +H   V+E   +NS  IT E + L D+         +++     GD  FD    L+EEE  TRP ++++ N++A YT    G  E    E     K K   + ++GT +GVY PCLQNIFGV+ FLRL W++G +G    F IV +CCC TMLT +SMSAIATNG VPAGGSYFMISR+LGPEFGG VG+ FY GTT AAAMYI+GAIE+ L YIVP+A++F   + L E+  M NN RVYG   L +M+  VFIG+++V+KF+++ LACV+ SIL +Y G   ++       VCMLG+R L+   +      KE NN    +K     L+  +C N ++  N    +YF  NNVT    IPG    ++ +  + NY   KG +  +P  +     G       + DI  SFT+L+GIFFPSVTGIMAGSNRSGDL + Q SIP+G+I A  TTSFVYLS V+ F A +E  VLRDKFG +V   L+V  L+WP+ WVI+IGSF ST GAGLQSLTGAPRLLQAIA+DN+IPFL VF  +   GEP  A  LT  I+ LG+LIAS+D +AP+++MFFLMCY FVNLA AL   L+ P+WRPRF+YYHW  S +G+ +C+ALMF+SSWYYA+VA+ +AG IYKYIEY+GA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ LDE    + HP+L+ F SQLKAG+GLTIVG+VI G   +   +++ A++T+   +  +++KG  ++VVA+ + E I  L Q+ GLG ++HN V++ +P  W   +    WK F+ T+RV  A+ LA+LV K I  FP        +NV         G +D+W IVHDGG+L+LL  LL + + W KC +R+F VA  +DN+I +KK++  F+Y LRI A+VEVVE+  +DISAY ++RT+ +  R ++L  M L   +  RE Q + D++                      S L   ++   E++ TE  +E V     H    K+  M S   K KS    Q L+                            +M P++ N                        R+  T  +++      E+I ++S  A L+L+N+PGP +N   D NYM+++E LT+GL RVL VRG G EVIT ++
Sbjct:    2 SEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNS--ITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPTKTPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAIEIFLVYIVPRAAIFHSDDALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLFLACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTLSSRHIDVCSKTKEINNMTVPSK-----LWGFFC-NSSQFFNATCDEYFVHNNVTSIQGIPGLASGIITENLWSNYLP-KGEIIEKPSAKSSDVLGSLNHEYVLVDITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKANGEPTWALLLTAAIAELGILIASLDLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDEDL-HVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLENYGEALAAEQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKHNTVVMGWPNGWRQSEDARAWKTFIGTVRVTTAAHLALLVAKNISFFP--------SNVEQFSE----GNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMHDSDISAYTYERTLMMEQRSQMLRHMRLSKTERDREAQLVKDRN----------------------SMLRLTSIGSDEDEETETYQEKV-----HMTWTKDKYMASRGQKAKSMEGFQDLL----------------------------NMRPDQSNV-----------------------RRMHTAVKLN------EVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1091          
BLAST of slc12a-4 vs. Ensembl Human
Match: SLC12A6 (solute carrier family 12 member 6 [Source:HGNC Symbol;Acc:HGNC:10914])

HSP 1 Score: 926.776 bits (2394), Expect = 0.000e+0
Identity = 524/1196 (43.81%), Postives = 718/1196 (60.03%), Query Frame = 3
Query:   87 SEVINSENDLSSVA----AEKAAH--YVVESKVENSENITKEATPLTDE------EIEMSDDEEPAGDSKFD----LYEEEFHTRPPMANIFNKLAQYT----GGIEPTSGET---KKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIE-LDENI-MFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVAN-PSRSLRVCMLGDRLLNRSVV----LDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKG---QSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKES-MNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            SE+  +   L++VA    +++ +H   V+E   +NS  IT E + L D+         +++     GD  FD    L+EEE  TRP ++++ N++A YT    G  E    E     K K   + ++GT +GVY PCLQNIFGV+ FLRL W++G +G    F IV +CCC TMLT +SMSAIATNG VPAGGSYFMISR+LGPEFGG VG+ FY GTT AAAMYI+GAIE+ L YIVP+A++F   + L E+  M NN RVYG   L +M+  VFIG+++V+KF+++ LACV+ SIL +Y G   ++       VCMLG+R L+   +      KE NN    +K     L+  +C N ++  N    +YF  NNVT    IPG    ++ +  + NY   KG +  +P  +     G       + DI  SFT+L+GIFFPSVTGIMAGSNRSGDL + Q SIP+G+I A  TTSFVYLS V+ F A +E  VLRDKFG +V   L+V  L+WP+ WVI+IGSF ST GAGLQSLTGAPRLLQAIA+DN+IPFL VF  +   GEP  A  LT  I+ LG+LIAS+D +AP+++MFFLMCY FVNLA AL   L+ P+WRPRF+YYHW  S +G+ +C+ALMF+SSWYYA+VA+ +AG IYKYIEY+GA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ LDE    + HP+L+ F SQLKAG+GLTIVG+VI G   +   +++ A++T+   +  +++KG  ++VVA+ + E I  L Q+ GLG ++HN V++ +P  W   +    WK F+ T+RV  A+ LA+LV K I  FP        +NV         G +D+W IVHDGG+L+LL  LL + + W KC +R+F VA  +DN+I +KK++  F+Y LRI A+VEVVE+  +DISAY ++RT+ +  R ++L  M L   +  RE Q + D++                      S L   ++   E++ TE  +E V     H    K+  M S   K KS    Q L+         N R         D +N R      K+NE                                        +I ++S  A L+L+N+PGP +N   D NYM+++E LT+GL RVL VRG G EVIT ++
Sbjct:   61 SEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNS--ITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPTKTPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAIEIFLVYIVPRAAIFHSDDALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLFLACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTLSSRHIDVCSKTKEINNMTVPSK-----LWGFFC-NSSQFFNATCDEYFVHNNVTSIQGIPGLASGIITENLWSNYLP-KGEIIEKPSAKSSDVLGSLNHEYVLVDITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKANGEPTWALLLTAAIAELGILIASLDLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDEDL-HVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLENYGEALAAEQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKHNTVVMGWPNGWRQSEDARAWKTFIGTVRVTTAAHLALLVAKNISFFP--------SNVEQFS----EGNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMHDSDISAYTYERTLMMEQRSQMLRHMRLSKTERDREAQLVKDRN----------------------SMLRLTSIGSDEDEETETYQEKV-----HMTWTKDKYMASRGQKAKSMEGFQDLL---------NMRP--------DQSNVRRMHTAVKLNE----------------------------------------VIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1150          
BLAST of slc12a-4 vs. Ensembl Celegans
Match: kcc-2 (K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:V6CJH3])

HSP 1 Score: 788.489 bits (2035), Expect = 0.000e+0
Identity = 460/1147 (40.10%), Postives = 664/1147 (57.89%), Query Frame = 3
Query:  180 NITKEATPLTD-----EEIEMSDDEEPAGDSKFDLYEEEFHTR-PPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVA-NPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCR-NGTKDLNDEACKYFKENNVTEFPAI------PGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSV--SDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            N   EA  L D     E I + +   P       LYE+++ T+   +  +  KL+ Y    E TS E  +  + ++ K+GTI+GV+ PCLQNIFGVLFF+RL WIIG +G    F +V  C   T LT +S+SAIATNG VP+GG Y+MISR+LGPE GG VGILFY GTT+AA+MYI GAIE++L YI P+A LF  I       ++N RV G +LL I+   V  G+KFV++ +   +  V+  IL   +G+FV  + S SL+ CM+GDR ++ S   +K       CT D    L  L+C  NGT D   +  K  K    +  PAI       G    +  D  +  Y      L  +   +  L++G  PS   ++   +F IL+G+FFPS TGIMAGSNRSG+L +   SIPLG++AA   +SF+YL  V+ F A+V    +RDK+G S    LI+++++WP   VIL G F+ST GAG+QSLTGAPRLLQAIA D+V+PFL+ F+    RGEP+RA  LT  I   G+LIA I++I  LIT FFLMCY  VN A AL   L+ P WRP F+Y+HW+ S++G ILC+A+MF+S+W++AL AI +  G+YKYIEY GA KEWGD  RG  +SAA+ A+L L DKP H++NWRPQ+L+L    E+        ++ F SQLKAG+GLT+V   +EGE  D    +   +E L   ++  +IKG  +++V SNVIE I  L QTSGLG +RHN V++S+P +W  ++  +   +F++ +R   A+  A++VPK  ++FP   +K             ++G +D+W +VHDGGLL+LL  LL + + W    +R+F +A  +DN + +K ++ +F+Y LRI+A V V+E+  +DIS Y ++RTM +  R + L+  NL   D  ++ Q     H         ++ IN+ +P +                P ++  E V+DE+    E+ +S N       S+  E   +   D    ++ + V     TL+ +                                  + ++     +MH+AV+LNE++R +SS+A L+ VNLPGP   +S  Y YM ++E LT+GL RVL VRGTG EV+T ++
Sbjct:   13 NPNNEAIRLLDIDEGAERIPLCEQHSP-----LALYEQDYDTQGQKIGTMLRKLSVYNA-TEATSVEADEKPKAAAAKMGTIMGVFLPCLQNIFGVLFFIRLAWIIGTAGVFQAFFVVLTCVSVTFLTSISLSAIATNGVVPSGGPYYMISRNLGPELGGAVGILFYLGTTIAASMYITGAIEILLLYIYPQAKLFDDI-------YHNFRVLGTVLLLILGLIVMAGVKFVNRCALPLVIVVILCILSAILGVFVRYDGSDSLKFCMVGDRPVDLSTYFEKTQVQP-NCTAD---GLQDLFCSTNGTCDHYYDRMKNIKVWKSSGMPAIREERAIKGIASGVFFDNLWPKYLRAGEVLSKDRKDKGDLNRGGHPSYIYAESVTNFMILVGVFFPSATGIMAGSNRSGNLRDAAKSIPLGTLAAQNFSSFIYLLGVVLFGASVSEMFIRDKYGRSAMGKLIISEISWPFPQVILFGCFMSTAGAGMQSLTGAPRLLQAIAADDVLPFLKPFRKMDSRGEPIRAILLTLAICECGILIAVIENITALITQFFLMCYLGVNAACALQSLLKSPGWRPGFRYFHWSLSMIGAILCVAVMFISAWHFALFAIIIGAGVYKYIEYAGAEKEWGDGLRGLGLSAARFALLNLDDKPQHSRNWRPQLLVLAPDVESANTNG---ILSFVSQLKAGKGLTLVAHCMEGEYADNYLKAQAVQEKLKAVVKKNKIKGFCDVLVTSNVIEGISCLVQTSGLGGMRHNTVVLSWPNDWKAEQEWVVANKFVSAIRAISAAKCAIMVPKYAEKFPANGTK-------------VSGFIDVWWVVHDGGLLMLLPFLLRQHKTWKNTTVRLFAIAQMEDNNVQMKTDLEKFLYHLRIDAAVNVIEMTDSDISDYTYERTMKMEERNQYLK--NLNKSDRDKDIQ----NHLEIVTRERKLSRINEEAPAVV---------------PEQRNLE-VVDEEQ---EDGKSENG------SAKIEHKGVRFSDD---EDSKEVKVGNGTLERDREE------------------------------RQRKRRYNVHKMHTAVKLNELMRQKSSDAQLVFVNLPGPPDADSDSY-YMDFIEALTEGLDRVLLVRGTGAEVVTIYS 1061          
BLAST of slc12a-4 vs. Ensembl Celegans
Match: kcc-2 (K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:V6CJH3])

HSP 1 Score: 788.104 bits (2034), Expect = 0.000e+0
Identity = 453/1117 (40.56%), Postives = 655/1117 (58.64%), Query Frame = 3
Query:  255 SKFDLYEEEFHTR-PPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVA-NPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCR-NGTKDLNDEACKYFKENNVTEFPAI------PGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSV--SDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            S   LYE+++ T+   +  +  KL+ Y    E TS E  +  + ++ K+GTI+GV+ PCLQNIFGVLFF+RL WIIG +G    F +V  C   T LT +S+SAIATNG VP+GG Y+MISR+LGPE GG VGILFY GTT+AA+MYI GAIE++L YI P+A LF  I       ++N RV G +LL I+   V  G+KFV++ +   +  V+  IL   +G+FV  + S SL+ CM+GDR ++ S   +K       CT D    L  L+C  NGT D   +  K  K    +  PAI       G    +  D  +  Y      L  +   +  L++G  PS   ++   +F IL+G+FFPS TGIMAGSNRSG+L +   SIPLG++AA   +SF+YL  V+ F A+V    +RDK+G S    LI+++++WP   VIL G F+ST GAG+QSLTGAPRLLQAIA D+V+PFL+ F+    RGEP+RA  LT  I   G+LIA I++I  LIT FFLMCY  VN A AL   L+ P WRP F+Y+HW+ S++G ILC+A+MF+S+W++AL AI +  G+YKYIEY GA KEWGD  RG  +SAA+ A+L L DKP H++NWRPQ+L+L    E+        ++ F SQLKAG+GLT+V   +EGE  D    +   +E L   ++  +IKG  +++V SNVIE I  L QTSGLG +RHN V++S+P +W  ++  +   +F++ +R   A+  A++VPK  ++FP   +K             ++G +D+W +VHDGGLL+LL  LL + + W    +R+F +A  +DN + +K ++ +F+Y LRI+A V V+E+  +DIS Y ++RTM +  R + L+  NL   D  ++ Q     H         ++ IN+ +P +                P ++  E V+DE+    E+ +S N       S+  E   +   D    ++ + V     TL+ +                                  + ++     +MH+AV+LNE++R +SS+A L+ VNLPGP   +S  Y YM ++E LT+GL RVL VRGTG EV+T ++
Sbjct:  106 SPLALYEQDYDTQGQKIGTMLRKLSVYNA-TEATSVEADEKPKAAAAKMGTIMGVFLPCLQNIFGVLFFIRLAWIIGTAGVFQAFFVVLTCVSVTFLTSISLSAIATNGVVPSGGPYYMISRNLGPELGGAVGILFYLGTTIAASMYITGAIEILLLYIYPQAKLFDDI-------YHNFRVLGTVLLLILGLIVMAGVKFVNRCALPLVIVVILCILSAILGVFVRYDGSDSLKFCMVGDRPVDLSTYFEKTQVQP-NCTAD---GLQDLFCSTNGTCDHYYDRMKNIKVWKSSGMPAIREERAIKGIASGVFFDNLWPKYLRAGEVLSKDRKDKGDLNRGGHPSYIYAESVTNFMILVGVFFPSATGIMAGSNRSGNLRDAAKSIPLGTLAAQNFSSFIYLLGVVLFGASVSEMFIRDKYGRSAMGKLIISEISWPFPQVILFGCFMSTAGAGMQSLTGAPRLLQAIAADDVLPFLKPFRKMDSRGEPIRAILLTLAICECGILIAVIENITALITQFFLMCYLGVNAACALQSLLKSPGWRPGFRYFHWSLSMIGAILCVAVMFISAWHFALFAIIIGAGVYKYIEYAGAEKEWGDGLRGLGLSAARFALLNLDDKPQHSRNWRPQLLVLAPDVESANTNG---ILSFVSQLKAGKGLTLVAHCMEGEYADNYLKAQAVQEKLKAVVKKNKIKGFCDVLVTSNVIEGISCLVQTSGLGGMRHNTVVLSWPNDWKAEQEWVVANKFVSAIRAISAAKCAIMVPKYAEKFPANGTK-------------VSGFIDVWWVVHDGGLLMLLPFLLRQHKTWKNTTVRLFAIAQMEDNNVQMKTDLEKFLYHLRIDAAVNVIEMTDSDISDYTYERTMKMEERNQYLK--NLNKSDRDKDIQ----NHLEIVTRERKLSRINEEAPAV---------------VPEQRNLE-VVDEEQ---EDGKSENG------SAKIEHKGVRFSDD---EDSKEVKVGNGTLERDREE------------------------------RQRKRRYNVHKMHTAVKLNELMRQKSSDAQLVFVNLPGPPDADSDSY-YMDFIEALTEGLDRVLLVRGTGAEVVTIYS 1129          
BLAST of slc12a-4 vs. Ensembl Celegans
Match: kcc-2 (K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:V6CJH3])

HSP 1 Score: 788.104 bits (2034), Expect = 0.000e+0
Identity = 458/1143 (40.07%), Postives = 662/1143 (57.92%), Query Frame = 3
Query:  177 ENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTR-PPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVA-NPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCR-NGTKDLNDEACKYFKENNVTEFPAI------PGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSV--SDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            EN   E  PL ++             S   LYE+++ T+   +  +  KL+ Y    E TS E  +  + ++ K+GTI+GV+ PCLQNIFGVLFF+RL WIIG +G    F +V  C   T LT +S+SAIATNG VP+GG Y+MISR+LGPE GG VGILFY GTT+AA+MYI GAIE++L YI P+A LF  I       ++N RV G +LL I+   V  G+KFV++ +   +  V+  IL   +G+FV  + S SL+ CM+GDR ++ S   +K       CT D    L  L+C  NGT D   +  K  K    +  PAI       G    +  D  +  Y      L  +   +  L++G  PS   ++   +F IL+G+FFPS TGIMAGSNRSG+L +   SIPLG++AA   +SF+YL  V+ F A+V    +RDK+G S    LI+++++WP   VIL G F+ST GAG+QSLTGAPRLLQAIA D+V+PFL+ F+    RGEP+RA  LT  I   G+LIA I++I  LIT FFLMCY  VN A AL   L+ P WRP F+Y+HW+ S++G ILC+A+MF+S+W++AL AI +  G+YKYIEY GA KEWGD  RG  +SAA+ A+L L DKP H++NWRPQ+L+L    E+        ++ F SQLKAG+GLT+V   +EGE  D    +   +E L   ++  +IKG  +++V SNVIE I  L QTSGLG +RHN V++S+P +W  ++  +   +F++ +R   A+  A++VPK  ++FP   +K             ++G +D+W +VHDGGLL+LL  LL + + W    +R+F +A  +DN + +K ++ +F+Y LRI+A V V+E+  +DIS Y ++RTM +  R + L+  NL   D  ++ Q     H         ++ IN+ +P +                P ++  E V+DE+    E+ +S N       S+  E   +   D    ++ + V     TL+ +                                  + ++     +MH+AV+LNE++R +SS+A L+ VNLPGP   +S  Y YM ++E LT+GL RVL VRGTG EV+T ++
Sbjct:   42 ENEGAERIPLCEQH------------SPLALYEQDYDTQGQKIGTMLRKLSVYNA-TEATSVEADEKPKAAAAKMGTIMGVFLPCLQNIFGVLFFIRLAWIIGTAGVFQAFFVVLTCVSVTFLTSISLSAIATNGVVPSGGPYYMISRNLGPELGGAVGILFYLGTTIAASMYITGAIEILLLYIYPQAKLFDDI-------YHNFRVLGTVLLLILGLIVMAGVKFVNRCALPLVIVVILCILSAILGVFVRYDGSDSLKFCMVGDRPVDLSTYFEKTQVQP-NCTAD---GLQDLFCSTNGTCDHYYDRMKNIKVWKSSGMPAIREERAIKGIASGVFFDNLWPKYLRAGEVLSKDRKDKGDLNRGGHPSYIYAESVTNFMILVGVFFPSATGIMAGSNRSGNLRDAAKSIPLGTLAAQNFSSFIYLLGVVLFGASVSEMFIRDKYGRSAMGKLIISEISWPFPQVILFGCFMSTAGAGMQSLTGAPRLLQAIAADDVLPFLKPFRKMDSRGEPIRAILLTLAICECGILIAVIENITALITQFFLMCYLGVNAACALQSLLKSPGWRPGFRYFHWSLSMIGAILCVAVMFISAWHFALFAIIIGAGVYKYIEYAGAEKEWGDGLRGLGLSAARFALLNLDDKPQHSRNWRPQLLVLAPDVESANTNG---ILSFVSQLKAGKGLTLVAHCMEGEYADNYLKAQAVQEKLKAVVKKNKIKGFCDVLVTSNVIEGISCLVQTSGLGGMRHNTVVLSWPNDWKAEQEWVVANKFVSAIRAISAAKCAIMVPKYAEKFPANGTK-------------VSGFIDVWWVVHDGGLLMLLPFLLRQHKTWKNTTVRLFAIAQMEDNNVQMKTDLEKFLYHLRIDAAVNVIEMTDSDISDYTYERTMKMEERNQYLK--NLNKSDRDKDIQ----NHLEIVTRERKLSRINEEAPAVV---------------PEQRNLE-VVDEEQ---EDGKSENG------SAKIEHKGVRFSDD---EDSKEVKVGNGTLERDREE------------------------------RQRKRRYNVHKMHTAVKLNELMRQKSSDAQLVFVNLPGPPDADSDSY-YMDFIEALTEGLDRVLLVRGTGAEVVTIYS 1079          
BLAST of slc12a-4 vs. Ensembl Celegans
Match: kcc-2 (K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:V6CJH3])

HSP 1 Score: 787.719 bits (2033), Expect = 0.000e+0
Identity = 453/1117 (40.56%), Postives = 655/1117 (58.64%), Query Frame = 3
Query:  255 SKFDLYEEEFHTR-PPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVA-NPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCR-NGTKDLNDEACKYFKENNVTEFPAI------PGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSV--SDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            S   LYE+++ T+   +  +  KL+ Y    E TS E  +  + ++ K+GTI+GV+ PCLQNIFGVLFF+RL WIIG +G    F +V  C   T LT +S+SAIATNG VP+GG Y+MISR+LGPE GG VGILFY GTT+AA+MYI GAIE++L YI P+A LF  I       ++N RV G +LL I+   V  G+KFV++ +   +  V+  IL   +G+FV  + S SL+ CM+GDR ++ S   +K       CT D    L  L+C  NGT D   +  K  K    +  PAI       G    +  D  +  Y      L  +   +  L++G  PS   ++   +F IL+G+FFPS TGIMAGSNRSG+L +   SIPLG++AA   +SF+YL  V+ F A+V    +RDK+G S    LI+++++WP   VIL G F+ST GAG+QSLTGAPRLLQAIA D+V+PFL+ F+    RGEP+RA  LT  I   G+LIA I++I  LIT FFLMCY  VN A AL   L+ P WRP F+Y+HW+ S++G ILC+A+MF+S+W++AL AI +  G+YKYIEY GA KEWGD  RG  +SAA+ A+L L DKP H++NWRPQ+L+L    E+        ++ F SQLKAG+GLT+V   +EGE  D    +   +E L   ++  +IKG  +++V SNVIE I  L QTSGLG +RHN V++S+P +W  ++  +   +F++ +R   A+  A++VPK  ++FP   +K             ++G +D+W +VHDGGLL+LL  LL + + W    +R+F +A  +DN + +K ++ +F+Y LRI+A V V+E+  +DIS Y ++RTM +  R + L+  NL   D  ++ Q     H         ++ IN+ +P +                P ++  E V+DE+    E+ +S N       S+  E   +   D    ++ + V     TL+ +                                  + ++     +MH+AV+LNE++R +SS+A L+ VNLPGP   +S  Y YM ++E LT+GL RVL VRGTG EV+T ++
Sbjct:   79 SPLALYEQDYDTQGQKIGTMLRKLSVYNA-TEATSVEADEKPKAAAAKMGTIMGVFLPCLQNIFGVLFFIRLAWIIGTAGVFQAFFVVLTCVSVTFLTSISLSAIATNGVVPSGGPYYMISRNLGPELGGAVGILFYLGTTIAASMYITGAIEILLLYIYPQAKLFDDI-------YHNFRVLGTVLLLILGLIVMAGVKFVNRCALPLVIVVILCILSAILGVFVRYDGSDSLKFCMVGDRPVDLSTYFEKTQVQP-NCTAD---GLQDLFCSTNGTCDHYYDRMKNIKVWKSSGMPAIREERAIKGIASGVFFDNLWPKYLRAGEVLSKDRKDKGDLNRGGHPSYIYAESVTNFMILVGVFFPSATGIMAGSNRSGNLRDAAKSIPLGTLAAQNFSSFIYLLGVVLFGASVSEMFIRDKYGRSAMGKLIISEISWPFPQVILFGCFMSTAGAGMQSLTGAPRLLQAIAADDVLPFLKPFRKMDSRGEPIRAILLTLAICECGILIAVIENITALITQFFLMCYLGVNAACALQSLLKSPGWRPGFRYFHWSLSMIGAILCVAVMFISAWHFALFAIIIGAGVYKYIEYAGAEKEWGDGLRGLGLSAARFALLNLDDKPQHSRNWRPQLLVLAPDVESANTNG---ILSFVSQLKAGKGLTLVAHCMEGEYADNYLKAQAVQEKLKAVVKKNKIKGFCDVLVTSNVIEGISCLVQTSGLGGMRHNTVVLSWPNDWKAEQEWVVANKFVSAIRAISAAKCAIMVPKYAEKFPANGTK-------------VSGFIDVWWVVHDGGLLMLLPFLLRQHKTWKNTTVRLFAIAQMEDNNVQMKTDLEKFLYHLRIDAAVNVIEMTDSDISDYTYERTMKMEERNQYLK--NLNKSDRDKDIQ----NHLEIVTRERKLSRINEEAPAV---------------VPEQRNLE-VVDEEQ---EDGKSENG------SAKIEHKGVRFSDD---EDSKEVKVGNGTLERDREE------------------------------RQRKRRYNVHKMHTAVKLNELMRQKSSDAQLVFVNLPGPPDADSDSY-YMDFIEALTEGLDRVLLVRGTGAEVVTIYS 1102          
BLAST of slc12a-4 vs. Ensembl Celegans
Match: kcc-2 (K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:V6CJH3])

HSP 1 Score: 780.4 bits (2014), Expect = 0.000e+0
Identity = 448/1098 (40.80%), Postives = 645/1098 (58.74%), Query Frame = 3
Query:  309 IFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVA-NPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCR-NGTKDLNDEACKYFKENNVTEFPAI------PGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSV--SDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            +  KL+ Y    E TS E  +  + ++ K+GTI+GV+ PCLQNIFGVLFF+RL WIIG +G    F +V  C   T LT +S+SAIATNG VP+GG Y+MISR+LGPE GG VGILFY GTT+AA+MYI GAIE++L YI P+A LF  I       ++N RV G +LL I+   V  G+KFV++ +   +  V+  IL   +G+FV  + S SL+ CM+GDR ++ S   +K       CT D    L  L+C  NGT D   +  K  K    +  PAI       G    +  D  +  Y      L  +   +  L++G  PS   ++   +F IL+G+FFPS TGIMAGSNRSG+L +   SIPLG++AA   +SF+YL  V+ F A+V    +RDK+G S    LI+++++WP   VIL G F+ST GAG+QSLTGAPRLLQAIA D+V+PFL+ F+    RGEP+RA  LT  I   G+LIA I++I  LIT FFLMCY  VN A AL   L+ P WRP F+Y+HW+ S++G ILC+A+MF+S+W++AL AI +  G+YKYIEY GA KEWGD  RG  +SAA+ A+L L DKP H++NWRPQ+L+L    E+        ++ F SQLKAG+GLT+V   +EGE  D    +   +E L   ++  +IKG  +++V SNVIE I  L QTSGLG +RHN V++S+P +W  ++  +   +F++ +R   A+  A++VPK  ++FP   +K             ++G +D+W +VHDGGLL+LL  LL + + W    +R+F +A  +DN + +K ++ +F+Y LRI+A V V+E+  +DIS Y ++RTM +  R + L+  NL   D  ++ Q     H         ++ IN+ +P +                P ++  E V+DE+    E+ +S N       S+  E   +   D    ++ + V     TL+ +                                  + ++     +MH+AV+LNE++R +SS+A L+ VNLPGP   +S  Y YM ++E LT+GL RVL VRGTG EV+T ++
Sbjct:    1 MLRKLSVYNA-TEATSVEADEKPKAAAAKMGTIMGVFLPCLQNIFGVLFFIRLAWIIGTAGVFQAFFVVLTCVSVTFLTSISLSAIATNGVVPSGGPYYMISRNLGPELGGAVGILFYLGTTIAASMYITGAIEILLLYIYPQAKLFDDI-------YHNFRVLGTVLLLILGLIVMAGVKFVNRCALPLVIVVILCILSAILGVFVRYDGSDSLKFCMVGDRPVDLSTYFEKTQVQP-NCTAD---GLQDLFCSTNGTCDHYYDRMKNIKVWKSSGMPAIREERAIKGIASGVFFDNLWPKYLRAGEVLSKDRKDKGDLNRGGHPSYIYAESVTNFMILVGVFFPSATGIMAGSNRSGNLRDAAKSIPLGTLAAQNFSSFIYLLGVVLFGASVSEMFIRDKYGRSAMGKLIISEISWPFPQVILFGCFMSTAGAGMQSLTGAPRLLQAIAADDVLPFLKPFRKMDSRGEPIRAILLTLAICECGILIAVIENITALITQFFLMCYLGVNAACALQSLLKSPGWRPGFRYFHWSLSMIGAILCVAVMFISAWHFALFAIIIGAGVYKYIEYAGAEKEWGDGLRGLGLSAARFALLNLDDKPQHSRNWRPQLLVLAPDVESANTNG---ILSFVSQLKAGKGLTLVAHCMEGEYADNYLKAQAVQEKLKAVVKKNKIKGFCDVLVTSNVIEGISCLVQTSGLGGMRHNTVVLSWPNDWKAEQEWVVANKFVSAIRAISAAKCAIMVPKYAEKFPANGTK-------------VSGFIDVWWVVHDGGLLMLLPFLLRQHKTWKNTTVRLFAIAQMEDNNVQMKTDLEKFLYHLRIDAAVNVIEMTDSDISDYTYERTMKMEERNQYLK--NLNKSDRDKDIQ----NHLEIVTRERKLSRINEEAPAVV---------------PEQRNLE-VVDEEQ---EDGKSENG------SAKIEHKGVRFSDD---EDSKEVKVGNGTLERDREE------------------------------RQRKRRYNVHKMHTAVKLNELMRQKSSDAQLVFVNLPGPPDADSDSY-YMDFIEALTEGLDRVLLVRGTGAEVVTIYS 1005          
BLAST of slc12a-4 vs. Ensembl Fly
Match: kcc (gene:FBgn0261794 transcript:FBtr0072139)

HSP 1 Score: 933.324 bits (2411), Expect = 0.000e+0
Identity = 504/1150 (43.83%), Postives = 723/1150 (62.87%), Query Frame = 3
Query:  150 VVESKVENSENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSL--YGEPGKEPHLDKGQSPS--VSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTI-NVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPE-KINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSK--NESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            V E+K E+S +I +             ++++ + D    LY+++  TRP ++   + +A Y   I P + +        S ++GT++GV+ PC+QNIFGV+ F+RL W++G +G   GF+IV  CCC TMLT +SMSAIATNG VPAGGSYFMISRSLGPEFGG VG+LFY GTT+AAAMYI+GA+E++L Y+ P AS+FG    D + M+NN RVYG +LL  M   VF+G+KFV+KF+T++LACV+ SI+ VY+GIF   + +  L +C+LG RLL + + L+        CTK+ +  L  +YC +G  +      +Y+  NNVT+   I G    +  D  F ++   KG    YG+   +     G+S +  ++DI  SFT+LIGIFFPSVTGIMAGSNRSGDLA+ Q SIP+G+I A  TTS VYLS+V+FF+ TV++ +LRDKFG S+G  L+VA +AWPN+WVILIGSFLST+GAGLQSLTGAPRLLQAIA+D +IPFL  F  ++KRGEP RA  LT  I   G+L+ ++D +APL++MFFLMCYGFVNLA A+   L+ P+WRPRFK+YHW+ SL+GL LCI++M ++SWY+AL+A+ +A  IYKYIEYRGA KEWGD  RG  ++AA+ ++L+L + P HTKNWRPQIL+L  L++      + K+  F +QLKAG+GLTI  +VI+G+     + ++ AK TL + + D+++KG  +++VA  + E +  + QT GLG ++ N V++ +P  W  +  +  WK F+ T+R   A  +A++VPKGI+ +P    K             + G +D+W IVHDGGLL+LL  LL + R W  C+LR+F VA  +DN+I +KK++  F+Y LRI A VEVVE++ +DISAY ++RT+ +  R ++L  + L   +  +  Q I+D H+ A            T+  + F+  PTI     H++Q  EK     LD   + D                        TP++T  +++ +            A GD     K +EF                            RRMH+A++LNE+I  +S +A L+++NLPGP +      + NYM+++E LT+GL +VL VRG G+EVIT ++
Sbjct:   24 VHETKNEDSGDIHRA-----------EENQKSSIDPNLYLYDDDLETRPHISTFISSIANYENTI-PAATDPDAKPAAPSARMGTLIGVFLPCIQNIFGVILFIRLTWVVGTAGAVCGFLIVLTCCCVTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGMLFYTGTTLAAAMYIVGAVEIVLTYMAPWASIFGDFTKDADAMYNNFRVYGTLLLIFMGLIVFLGVKFVNKFATVALACVILSIIAVYVGIFDNIHGNEKLYMCVLGKRLL-KDIPLEN-------CTKE-DSFLRDIYCPDGKCE------EYYLANNVTKVKGIKGLASGVFYDNIFPSFLE-KGQFISYGKSAIDIENTSGESYNQIMADITTSFTLLIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLLRDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARDEIIPFLAPFAKSSKRGEPTRALLLTIVICQCGILLGNVDLLAPLLSMFFLMCYGFVNLACAVQTLLRTPNWRPRFKFYHWSLSLIGLTLCISVMIMTSWYFALIAMGMAIIIYKYIEYRGAEKEWGDGIRGMALTAARYSLLRLEEGPPHTKNWRPQILVLSKLNDNLLP-KYRKIFSFATQLKAGKGLTICVSVIKGDHTKITNKAVDAKATLRKYMTDEKVKGFCDVLVAQQIGEGLSSVIQTIGLGGMKPNTVIIGWPYSWRQEGRN-SWKTFIQTVRTVAACHMALMVPKGINFYPESNHK-------------IGGNIDIWWIVHDGGLLMLLPFLLKQHRTWRNCKLRIFTVAQIEDNSIQMKKDLKTFLYHLRIEADVEVVEMNNSDISAYTYERTLMMEQRNQMLRALGLNKKENSKVVQTIVDHHYDAT----------KTASKVRFAD-PTIEETQHHDSQNDEKRNSIDLDGPENAD------------------------TPETTSNKDEST----------EKADGDFKSSVKPDEFNV--------------------------RRMHTAIKLNEVIVEKSQDAQLVIMNLPGPPREVRAERERNYMEFLEVLTEGLEKVLMVRGGGREVITIYS 1059          
BLAST of slc12a-4 vs. Ensembl Fly
Match: kcc (gene:FBgn0261794 transcript:FBtr0343301)

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 506/1154 (43.85%), Postives = 728/1154 (63.08%), Query Frame = 3
Query:  150 VVESKVENSENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSL--YGEPGKEPHLDKGQSPS--VSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKT-----EETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPE-KINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSK--NESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            V E+K E+S +I +             ++++ + D    LY+++  TRP ++   + +A Y   I P + +        S ++GT++GV+ PC+QNIFGV+ F+RL W++G +G   GF+IV  CCC TMLT +SMSAIATNG VPAGGSYFMISRSLGPEFGG VG+LFY GTT+AAAMYI+GA+E++L Y+ P AS+FG    D + M+NN RVYG +LL  M   VF+G+KFV+KF+T++LACV+ SI+ VY+GIF   + +  L +C+LG RLL + + L+        CTK+ +  L  +YC +G  +      +Y+  NNVT+   I G    +  D  F ++   KG    YG+   +     G+S +  ++DI  SFT+LIGIFFPSVTGIMAGSNRSGDLA+ Q SIP+G+I A  TTS VYLS+V+FF+ TV++ +LRDKFG S+G  L+VA +AWPN+WVILIGSFLST+GAGLQSLTGAPRLLQAIA+D +IPFL  F  ++KRGEP RA  LT  I   G+L+ ++D +APL++MFFLMCYGFVNLA A+   L+ P+WRPRFK+YHW+ SL+GL LCI++M ++SWY+AL+A+ +A  IYKYIEYRGA KEWGD  RG  ++AA+ ++L+L + P HTKNWRPQIL+L  L++      + K+  F +QLKAG+GLTI  +VI+G+     + ++ AK TL + + D+++KG  +++VA  + E +  + QT GLG ++ N V++ +P  W  +  +  WK F+ T+R   A  +A++VPKGI+ +P    K             + G +D+W IVHDGGLL+LL  LL + R W  C+LR+F VA  +DN+I +KK++  F+Y LRI A VEVVE++ +DISAY ++RT+ +  R ++L  + L   +  +  Q I+D                +T  D   S + TI VD H +     +     + T+ +  +H  +N E  NS I      N +     TP++T  +++ +            A GD     K +EF                            RRMH+A++LNE+I  +S +A L+++NLPGP +      + NYM+++E LT+GL +VL VRG G+EVIT ++
Sbjct:   24 VHETKNEDSGDIHRA-----------EENQKSSIDPNLYLYDDDLETRPHISTFISSIANYENTI-PAATDPDAKPAAPSARMGTLIGVFLPCIQNIFGVILFIRLTWVVGTAGAVCGFLIVLTCCCVTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGMLFYTGTTLAAAMYIVGAVEIVLTYMAPWASIFGDFTKDADAMYNNFRVYGTLLLIFMGLIVFLGVKFVNKFATVALACVILSIIAVYVGIFDNIHGNEKLYMCVLGKRLL-KDIPLEN-------CTKE-DSFLRDIYCPDGKCE------EYYLANNVTKVKGIKGLASGVFYDNIFPSFLE-KGQFISYGKSAIDIENTSGESYNQIMADITTSFTLLIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLLRDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARDEIIPFLAPFAKSSKRGEPTRALLLTIVICQCGILLGNVDLLAPLLSMFFLMCYGFVNLACAVQTLLRTPNWRPRFKFYHWSLSLIGLTLCISVMIMTSWYFALIAMGMAIIIYKYIEYRGAEKEWGDGIRGMALTAARYSLLRLEEGPPHTKNWRPQILVLSKLNDNLLP-KYRKIFSFATQLKAGKGLTICVSVIKGDHTKITNKAVDAKATLRKYMTDEKVKGFCDVLVAQQIGEGLSSVIQTIGLGGMKPNTVIIGWPYSWRQEGRN-SWKTFIQTVRTVAACHMALMVPKGINFYPESNHK-------------IGGNIDIWWIVHDGGLLMLLPFLLKQHRTWRNCKLRIFTVAQIEDNSIQMKKDLKTFLYHLRIEADVEVVEMNNSDISAYTYERTLMMEQRNQMLRALGLNKKENSKVVQTIMD--------------YKETPSDNKMSLVQTI-VDHHYDATKTASKVRFADPTIEETQHHDSQNDEKRNS-IDLDGPENAD-----TPETTSNKDEST----------EKADGDFKSSVKPDEFNV--------------------------RRMHTAIKLNEVIVEKSQDAQLVIMNLPGPPREVRAERERNYMEFLEVLTEGLEKVLMVRGGGREVITIYS 1077          
BLAST of slc12a-4 vs. Ensembl Fly
Match: kcc (gene:FBgn0261794 transcript:FBtr0072137)

HSP 1 Score: 931.784 bits (2407), Expect = 0.000e+0
Identity = 498/1123 (44.35%), Postives = 713/1123 (63.49%), Query Frame = 3
Query:  231 DDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSL--YGEPGKEPHLDKGQSPS--VSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTI-NVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPE-KINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSK--NESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            ++++ + D    LY+++  TRP ++   + +A Y   I P + +        S ++GT++GV+ PC+QNIFGV+ F+RL W++G +G   GF+IV  CCC TMLT +SMSAIATNG VPAGGSYFMISRSLGPEFGG VG+LFY GTT+AAAMYI+GA+E++L Y+ P AS+FG    D + M+NN RVYG +LL  M   VF+G+KFV+KF+T++LACV+ SI+ VY+GIF   + +  L +C+LG RLL + + L+        CTK+ +  L  +YC +G  +      +Y+  NNVT+   I G    +  D  F ++   KG    YG+   +     G+S +  ++DI  SFT+LIGIFFPSVTGIMAGSNRSGDLA+ Q SIP+G+I A  TTS VYLS+V+FF+ TV++ +LRDKFG S+G  L+VA +AWPN+WVILIGSFLST+GAGLQSLTGAPRLLQAIA+D +IPFL  F  ++KRGEP RA  LT  I   G+L+ ++D +APL++MFFLMCYGFVNLA A+   L+ P+WRPRFK+YHW+ SL+GL LCI++M ++SWY+AL+A+ +A  IYKYIEYRGA KEWGD  RG  ++AA+ ++L+L + P HTKNWRPQIL+L  L++      + K+  F +QLKAG+GLTI  +VI+G+     + ++ AK TL + + D+++KG  +++VA  + E +  + QT GLG ++ N V++ +P  W  +  +  WK F+ T+R   A  +A++VPKGI+ +P    K             + G +D+W IVHDGGLL+LL  LL + R W  C+LR+F VA  +DN+I +KK++  F+Y LRI A VEVVE++ +DISAY ++RT+ +  R ++L  + L   +  +  Q I+D H+ A            T+  + F+  PTI     H++Q  EK     LD   + D                        TP++T  +++ +            A GD     K +EF                            RRMH+A++LNE+I  +S +A L+++NLPGP +      + NYM+++E LT+GL +VL VRG G+EVIT ++
Sbjct:   55 ENQKSSIDPNLYLYDDDLETRPHISTFISSIANYENTI-PAATDPDAKPAAPSARMGTLIGVFLPCIQNIFGVILFIRLTWVVGTAGAVCGFLIVLTCCCVTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGMLFYTGTTLAAAMYIVGAVEIVLTYMAPWASIFGDFTKDADAMYNNFRVYGTLLLIFMGLIVFLGVKFVNKFATVALACVILSIIAVYVGIFDNIHGNEKLYMCVLGKRLL-KDIPLEN-------CTKE-DSFLRDIYCPDGKCE------EYYLANNVTKVKGIKGLASGVFYDNIFPSFLE-KGQFISYGKSAIDIENTSGESYNQIMADITTSFTLLIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLLRDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARDEIIPFLAPFAKSSKRGEPTRALLLTIVICQCGILLGNVDLLAPLLSMFFLMCYGFVNLACAVQTLLRTPNWRPRFKFYHWSLSLIGLTLCISVMIMTSWYFALIAMGMAIIIYKYIEYRGAEKEWGDGIRGMALTAARYSLLRLEEGPPHTKNWRPQILVLSKLNDNLLP-KYRKIFSFATQLKAGKGLTICVSVIKGDHTKITNKAVDAKATLRKYMTDEKVKGFCDVLVAQQIGEGLSSVIQTIGLGGMKPNTVIIGWPYSWRQEGRN-SWKTFIQTVRTVAACHMALMVPKGINFYPESNHK-------------IGGNIDIWWIVHDGGLLMLLPFLLKQHRTWRNCKLRIFTVAQIEDNSIQMKKDLKTFLYHLRIEADVEVVEMNNSDISAYTYERTLMMEQRNQMLRALGLNKKENSKVVQTIVDHHYDA----------TKTASKVRFAD-PTIEETQHHDSQNDEKRNSIDLDGPENAD------------------------TPETTSNKDEST----------EKADGDFKSSVKPDEFNV--------------------------RRMHTAIKLNEVIVEKSQDAQLVIMNLPGPPREVRAERERNYMEFLEVLTEGLEKVLMVRGGGREVITIYS 1074          
BLAST of slc12a-4 vs. Ensembl Fly
Match: kcc (gene:FBgn0261794 transcript:FBtr0343300)

HSP 1 Score: 931.784 bits (2407), Expect = 0.000e+0
Identity = 498/1123 (44.35%), Postives = 713/1123 (63.49%), Query Frame = 3
Query:  231 DDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSL--YGEPGKEPHLDKGQSPS--VSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTI-NVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPE-KINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSK--NESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            ++++ + D    LY+++  TRP ++   + +A Y   I P + +        S ++GT++GV+ PC+QNIFGV+ F+RL W++G +G   GF+IV  CCC TMLT +SMSAIATNG VPAGGSYFMISRSLGPEFGG VG+LFY GTT+AAAMYI+GA+E++L Y+ P AS+FG    D + M+NN RVYG +LL  M   VF+G+KFV+KF+T++LACV+ SI+ VY+GIF   + +  L +C+LG RLL + + L+        CTK+ +  L  +YC +G  +      +Y+  NNVT+   I G    +  D  F ++   KG    YG+   +     G+S +  ++DI  SFT+LIGIFFPSVTGIMAGSNRSGDLA+ Q SIP+G+I A  TTS VYLS+V+FF+ TV++ +LRDKFG S+G  L+VA +AWPN+WVILIGSFLST+GAGLQSLTGAPRLLQAIA+D +IPFL  F  ++KRGEP RA  LT  I   G+L+ ++D +APL++MFFLMCYGFVNLA A+   L+ P+WRPRFK+YHW+ SL+GL LCI++M ++SWY+AL+A+ +A  IYKYIEYRGA KEWGD  RG  ++AA+ ++L+L + P HTKNWRPQIL+L  L++      + K+  F +QLKAG+GLTI  +VI+G+     + ++ AK TL + + D+++KG  +++VA  + E +  + QT GLG ++ N V++ +P  W  +  +  WK F+ T+R   A  +A++VPKGI+ +P    K             + G +D+W IVHDGGLL+LL  LL + R W  C+LR+F VA  +DN+I +KK++  F+Y LRI A VEVVE++ +DISAY ++RT+ +  R ++L  + L   +  +  Q I+D H+ A            T+  + F+  PTI     H++Q  EK     LD   + D                        TP++T  +++ +            A GD     K +EF                            RRMH+A++LNE+I  +S +A L+++NLPGP +      + NYM+++E LT+GL +VL VRG G+EVIT ++
Sbjct:   47 ENQKSSIDPNLYLYDDDLETRPHISTFISSIANYENTI-PAATDPDAKPAAPSARMGTLIGVFLPCIQNIFGVILFIRLTWVVGTAGAVCGFLIVLTCCCVTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGMLFYTGTTLAAAMYIVGAVEIVLTYMAPWASIFGDFTKDADAMYNNFRVYGTLLLIFMGLIVFLGVKFVNKFATVALACVILSIIAVYVGIFDNIHGNEKLYMCVLGKRLL-KDIPLEN-------CTKE-DSFLRDIYCPDGKCE------EYYLANNVTKVKGIKGLASGVFYDNIFPSFLE-KGQFISYGKSAIDIENTSGESYNQIMADITTSFTLLIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLLRDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARDEIIPFLAPFAKSSKRGEPTRALLLTIVICQCGILLGNVDLLAPLLSMFFLMCYGFVNLACAVQTLLRTPNWRPRFKFYHWSLSLIGLTLCISVMIMTSWYFALIAMGMAIIIYKYIEYRGAEKEWGDGIRGMALTAARYSLLRLEEGPPHTKNWRPQILVLSKLNDNLLP-KYRKIFSFATQLKAGKGLTICVSVIKGDHTKITNKAVDAKATLRKYMTDEKVKGFCDVLVAQQIGEGLSSVIQTIGLGGMKPNTVIIGWPYSWRQEGRN-SWKTFIQTVRTVAACHMALMVPKGINFYPESNHK-------------IGGNIDIWWIVHDGGLLMLLPFLLKQHRTWRNCKLRIFTVAQIEDNSIQMKKDLKTFLYHLRIEADVEVVEMNNSDISAYTYERTLMMEQRNQMLRALGLNKKENSKVVQTIVDHHYDA----------TKTASKVRFAD-PTIEETQHHDSQNDEKRNSIDLDGPENAD------------------------TPETTSNKDEST----------EKADGDFKSSVKPDEFNV--------------------------RRMHTAIKLNEVIVEKSQDAQLVIMNLPGPPREVRAERERNYMEFLEVLTEGLEKVLMVRGGGREVITIYS 1066          
BLAST of slc12a-4 vs. Ensembl Fly
Match: kcc (gene:FBgn0261794 transcript:FBtr0343299)

HSP 1 Score: 931.784 bits (2407), Expect = 0.000e+0
Identity = 498/1123 (44.35%), Postives = 713/1123 (63.49%), Query Frame = 3
Query:  231 DDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSL--YGEPGKEPHLDKGQSPS--VSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTI-NVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPE-KINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSK--NESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            ++++ + D    LY+++  TRP ++   + +A Y   I P + +        S ++GT++GV+ PC+QNIFGV+ F+RL W++G +G   GF+IV  CCC TMLT +SMSAIATNG VPAGGSYFMISRSLGPEFGG VG+LFY GTT+AAAMYI+GA+E++L Y+ P AS+FG    D + M+NN RVYG +LL  M   VF+G+KFV+KF+T++LACV+ SI+ VY+GIF   + +  L +C+LG RLL + + L+        CTK+ +  L  +YC +G  +      +Y+  NNVT+   I G    +  D  F ++   KG    YG+   +     G+S +  ++DI  SFT+LIGIFFPSVTGIMAGSNRSGDLA+ Q SIP+G+I A  TTS VYLS+V+FF+ TV++ +LRDKFG S+G  L+VA +AWPN+WVILIGSFLST+GAGLQSLTGAPRLLQAIA+D +IPFL  F  ++KRGEP RA  LT  I   G+L+ ++D +APL++MFFLMCYGFVNLA A+   L+ P+WRPRFK+YHW+ SL+GL LCI++M ++SWY+AL+A+ +A  IYKYIEYRGA KEWGD  RG  ++AA+ ++L+L + P HTKNWRPQIL+L  L++      + K+  F +QLKAG+GLTI  +VI+G+     + ++ AK TL + + D+++KG  +++VA  + E +  + QT GLG ++ N V++ +P  W  +  +  WK F+ T+R   A  +A++VPKGI+ +P    K             + G +D+W IVHDGGLL+LL  LL + R W  C+LR+F VA  +DN+I +KK++  F+Y LRI A VEVVE++ +DISAY ++RT+ +  R ++L  + L   +  +  Q I+D H+ A            T+  + F+  PTI     H++Q  EK     LD   + D                        TP++T  +++ +            A GD     K +EF                            RRMH+A++LNE+I  +S +A L+++NLPGP +      + NYM+++E LT+GL +VL VRG G+EVIT ++
Sbjct:   55 ENQKSSIDPNLYLYDDDLETRPHISTFISSIANYENTI-PAATDPDAKPAAPSARMGTLIGVFLPCIQNIFGVILFIRLTWVVGTAGAVCGFLIVLTCCCVTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGMLFYTGTTLAAAMYIVGAVEIVLTYMAPWASIFGDFTKDADAMYNNFRVYGTLLLIFMGLIVFLGVKFVNKFATVALACVILSIIAVYVGIFDNIHGNEKLYMCVLGKRLL-KDIPLEN-------CTKE-DSFLRDIYCPDGKCE------EYYLANNVTKVKGIKGLASGVFYDNIFPSFLE-KGQFISYGKSAIDIENTSGESYNQIMADITTSFTLLIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLLRDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARDEIIPFLAPFAKSSKRGEPTRALLLTIVICQCGILLGNVDLLAPLLSMFFLMCYGFVNLACAVQTLLRTPNWRPRFKFYHWSLSLIGLTLCISVMIMTSWYFALIAMGMAIIIYKYIEYRGAEKEWGDGIRGMALTAARYSLLRLEEGPPHTKNWRPQILVLSKLNDNLLP-KYRKIFSFATQLKAGKGLTICVSVIKGDHTKITNKAVDAKATLRKYMTDEKVKGFCDVLVAQQIGEGLSSVIQTIGLGGMKPNTVIIGWPYSWRQEGRN-SWKTFIQTVRTVAACHMALMVPKGINFYPESNHK-------------IGGNIDIWWIVHDGGLLMLLPFLLKQHRTWRNCKLRIFTVAQIEDNSIQMKKDLKTFLYHLRIEADVEVVEMNNSDISAYTYERTLMMEQRNQMLRALGLNKKENSKVVQTIVDHHYDA----------TKTASKVRFAD-PTIEETQHHDSQNDEKRNSIDLDGPENAD------------------------TPETTSNKDEST----------EKADGDFKSSVKPDEFNV--------------------------RRMHTAIKLNEVIVEKSQDAQLVIMNLPGPPREVRAERERNYMEFLEVLTEGLEKVLMVRGGGREVITIYS 1074          
BLAST of slc12a-4 vs. Ensembl Zebrafish
Match: slc12a5a (solute carrier family 12 member 5a [Source:ZFIN;Acc:ZDB-GENE-120927-3])

HSP 1 Score: 937.176 bits (2421), Expect = 0.000e+0
Identity = 503/1127 (44.63%), Postives = 699/1127 (62.02%), Query Frame = 3
Query:  267 LYEEEFHTRPPMANIFNKLAQYTG-------GIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELD----ENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPS------VSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTL-------DLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            L+E+E  T P ++++ + LA Y+          E  + E  + K   + ++GT++GVY PCLQNI GV+ FLR+ W++G+ G    F+IV +CC +TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VGI FY GTT A AMYI+G IE++L YIVP+A++F    L+    E  M NN RVYG ++L  M   VF+G+K+V+K + + LACV+CSIL VY G+   A       VC+LG+R L      D  A    R    +   L++L+C   ++ LN     YF  NNVTE   IPG     L++  F NY   KG+   + G    ++    P+      ++DI   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP+G+I A  TTS +Y+S+V+ F A +E TVLRDKFG +V   L++  LAWP+ WVI+IGSF ST GAGLQSLTGAPRL+QAIA+D ++PFL VF      GEP  A  LT  I   G+LIAS+D++AP+++MFFLMCY FVNLA A+   L+ P+WRPRFK+YHWT S LG+ LC++LMF+ SWYYA+VA+ +AG IYKYIE+RGA KEWGD  RG  +SAA+ A+++L + P HTKNWRPQIL+L+N+D    K+  P+++   SQLKAG+GLTIVGT +EG   +       A+++L + +  +++KG S++V++SN+ +A+  L Q SGLG L+HN V+ S+P  W   + H  W+ F+  +R   A   A+LVPK I  F            PS+G     G +D+W IVHDGG+L+LL  LL + + W KC++R+F VA   DN+I +KK++  F+Y LRI+A VEVVE+  +DISAY +++T+ +  R +IL+ +NL   + +RE Q+I D             +I   +P        T  + V E +P   ++E   +E+  P     S    +   KS+N       TP S     Q   T    T        + N   G   PE I +            F+  P   + N+     RRMH+A+RLNE+I  +S  A L+L+N+PGP +N S D NYM+++E LT+GL RVL VRG G+EVIT ++
Sbjct:    3 LFEDEMDTIPMVSSLLSSLANYSNLPQGSKEHEEAENNEGSRKKPVQAPRMGTLMGVYLPCLQNILGVILFLRMTWMVGIGGVIEAFIIVLMCCSTTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGICFYLGTTYAGAMYILGCIEILLVYIVPQAAIFKMEGLEGAEAEAAMLNNMRVYGTLVLSFMAIVVFVGVKYVNKLALVFLACVICSILAVYAGVIKTAFEPPVFPVCVLGNRTLVWKG-FDVCAKVIERENATVTTKLWRLFC--DSEFLNATCDTYFTNNNVTEMQGIPGVMSGTLRENLFGNYMD-KGAFIEKTGLSSVVEPDSIPTNTNRYVLADITSFFTMLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPIGTILAITTTSIIYMSSVVLFGACIEGTVLRDKFGEAVRGNLVIGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLMQAIARDGIVPFLRVFGHGKANGEPTWALLLTACICESGILIASLDNVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFKFYHWTLSFLGMSLCLSLMFICSWYYAIVAMGIAGCIYKYIEFRGAEKEWGDGIRGLSLSAARFALMRLEEGPPHTKNWRPQILVLVNMDGEL-KVDQPRMLSLTSQLKAGKGLTIVGTALEGTYLENHDQGQQAEQSLRKLMETEKVKGFSQVVISSNMRDAMSHLVQASGLGGLQHNTVLASWPRNWKQAEDHQSWRNFIELVRETTAGSKALLVPKNISAF------------PSNGERFTEGHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQMDDNSIQMKKDLTTFLYHLRIDAAVEVVEMHDSDISAYTYEKTLMMEQRSQILKQINLTKTEREREIQSITDSSR---------GSIRRKNP-----AAVTTQLSVTE-EPAASSKEQKPEEECVPV--SPSQQEQLIHDKSTNPPTP--ATPQSPSADAQTPGTAVQMTWSEVKCDGEQNKPVGATTPEAIKDL-----------FNMKPEWENLNQSNV--RRMHTALRLNEVIIKKSQEAKLVLLNMPGPPRNRSGDENYMEFMEVLTEGLNRVLLVRGGGREVITIYS 1080          
BLAST of slc12a-4 vs. Ensembl Zebrafish
Match: slc12a7a (solute carrier family 12 member 7a [Source:ZFIN;Acc:ZDB-GENE-070912-696])

HSP 1 Score: 909.827 bits (2350), Expect = 0.000e+0
Identity = 490/1151 (42.57%), Postives = 701/1151 (60.90%), Query Frame = 3
Query:  177 ENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYT----GGIEPTSGETKKLKEK---SSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVA--NPSRSLRVCMLGDRLLN---RSVVLDKEANNTFRCTKDINGP--LYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNY--YTT---KGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            E I  + TP     +  +D ++        LYEEE  + P ++++ NKLA YT    G +E    E++   ++   +  ++GT +GV+ PC QNI GV+ FLRL WI+G +G      +VF+CC  TMLT +SMSAIATNG VPAGGSY+MISR+LGPE GG VG+ FY GTT A +MYI+G +E+ L YI+P A++F     +   M NN R+YG   L IM   VF+G+K+V+K S + L+CV+ SI+ +Y G+  +   PS S  +C+LG+R L    +S   DK          +I  P  L+  +C NGT D      +YF  N +TE  A+PG     + +  +  Y  Y T   K ++  E       +   S  V+D+   FT+L+GI+FPSVTGIMAGSNRSGDL +PQ SIP G+I A ATTSF+Y+S V+ F A  E  VLRDK+G SV + L+VA LAWP+ WVI+IGSF S  GAGLQSLTGAPR+LQAIA+D ++PFL+VF  +   GEP  A  LT  I  +G+LIAS+D++AP+++MFFLMCY FVNLA A+   L+ P+WRPRFK+YHW+ S LG+ L ++LMFVSSWYYALV I +AG IYKYIEYRGA KEWGD  RG  ++AA+ A+++L +   HTKNWRPQ+L+L+ LD   T + HP+L+ F SQLKAG+GLTIV +V+EG    + +D+ +A++ +  A+  ++ KG   +VV+SN  +    L Q++GLG ++HN V+V++P  W   +S + WK F+ T+R   A+  A+LV K +D FP  + +               GT+D+W IVHDGGLL+LL  LL + + W KC++R+F VA   DN+I +KK++  F+Y LR++A+VEVVE++  DISA+ +++T+ +  R ++L+ M L   + +RE Q+I D+  ++                      P      H ++   K     LDE+     +K             NT+    L   +TP  ++  +T+    L     R   A   + +            F+  P    +N      RRMH+AV+LNE++  +S  A L+L+N+PGP KN+  D NYM+++E LT+GL  VL VRG G+EVIT ++
Sbjct:    9 EQILGDETPRETSSLISTDHDDSTYGKNMALYEEEMDSTPMVSSLLNKLANYTNITQGAVEHEEAESEDGIQRVTVNGPQMGTFIGVFLPCTQNILGVILFLRLTWIVGTAGILEALAVVFMCCACTMLTAISMSAIATNGVVPAGGSYYMISRALGPEIGGAVGLCFYLGTTFAGSMYILGTMEIFLTYIMPSAAVFEAN--NPTGMQNNMRIYGTCCLAIMTLVVFVGVKYVNKLSLVFLSCVVLSIMAIYAGVIQSAIKPS-SFTICLLGNRTLQHFGKSGKFDKCMKT--EVIDNITKPTELWYHFC-NGTCD------EYFNLNELTEISAVPGLLSNAITENLWSRYGEYRTTVEKENITSEAALSSEPEVLNSYVVNDMATFFTLLVGIYFPSVTGIMAGSNRSGDLRDPQRSIPTGTIMAIATTSFIYISCVVLFGACFEGVVLRDKYGDSVNKNLVVATLAWPSPWVIVIGSFFSCCGAGLQSLTGAPRILQAIARDGIMPFLQVFGRSKSGGEPTWALLLTAAICEIGILIASLDAVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKFYHWSLSFLGMSLSLSLMFVSSWYYALVVILIAGCIYKYIEYRGAVKEWGDGLRGLSLNAARYALIKLEEAQPHTKNWRPQLLVLMKLDTDLT-VKHPRLLSFTSQLKAGKGLTIVCSVLEGTFMVRGADAKLAEQNIKAAMAKEKTKGFCHVVVSSNQRDGFSHLIQSAGLGGMKHNAVLVAWPANWKQAESSLSWKNFIETVRETTAAHQALLVAKNVDTFPSNQDRLAE------------GTIDVWWIVHDGGLLMLLPFLLRQHKVWRKCKMRIFTVAQMDDNSIQMKKDLQMFLYHLRLDAKVEVVEMNAGDISAFTYEKTLVMEQRSQMLKQMQLSKTEREREIQSISDESRIS------------------IRRKPCGEKQTHNSKL--KVATVNLDEEAQLIHDK-------------NTKSHATLVEKATPTSDRVHMTWTKEKLIGERNRLRDASMHVRDI-----------FNMKPEW--ENLDQTNVRRMHTAVKLNEVVVKKSKGAQLVLLNMPGPPKNKGGDENYMEFLEVLTEGLDHVLLVRGGGREVITIYS 1088          
BLAST of slc12a-4 vs. Ensembl Zebrafish
Match: slc12a4 (solute carrier family 12 member 4 [Source:ZFIN;Acc:ZDB-GENE-090218-27])

HSP 1 Score: 906.36 bits (2341), Expect = 0.000e+0
Identity = 491/1125 (43.64%), Postives = 690/1125 (61.33%), Query Frame = 3
Query:  252 DSKFDLYEEEFHTRPPMANIFNKLAQYTGGI-------EPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGP--IELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF--VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEAC-KYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSV------SDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            D    L+EEE   RP ++++ ++L  YT          E  S +  + +   S  +GT++GVY PCLQNIFGV+ FLRL WI+G +G    F+IV +CC  TMLT +SMSAIATNG VPAGG+YFMISRSLGPEFGG VG+ FY GTT AAAMYI+GAIE+ LKY++P+A++F P  I      M NN RVYG I L +M   VF+G+K+V+K +++ LACV+ SI+ +Y G    + +P     +CMLG+R L R +  D          + +   L+K +C   + +++   C +YF  NNVTE   IPG    ++K+  + +Y   KG +  E  K P +D   S         +DI  SFT+L+GIFFPS TGIMAGSNRSGDL + Q SIP+G+I A  TTS VY S+V+ F A +E  VLRDKFG +V + L+V  L+WP+ WVI+IGSF STVGAGLQSLTGAPRLLQAIA+DN+IPFL VF      GEP  A  LT  I+ LG+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRF+YYHW  S LG+ +C+ALMF+SSWYYA+VA+ +AG IYKYIEY+GA KEWGD  RG  +SAA+ ++L+L   P HTKNWRPQ+L+L+ LDE    + +P+L+ F SQLKAG+GLTIVG+VI+G   +   ++  +++ +   +  +++KG  ++VVAS V E I  L Q+ GLG ++HN V++ +P  W   +    WK F+ T+R   A+ LA++VPK +  +P    +               G +D+W IVHDGG+L+LL  LL + + W KC++R+F VA   DN+I +KK++  F+Y LR+ A+VEVVE+  +DISAY ++RT+ +  R ++L+ M L +                                                    E+  E  L +D H           +  L S   E+T+ + P+    +NQ  +T+ +  ++      + APE   E                  +  K  Q+   RRMH+AV+LNE+I ++S +A L+L+N+PGP +N+  D NYM+++E LT+GL RVL VRG G+EVIT ++
Sbjct:   72 DRNLALFEEELDIRPKVSSLLSRLVNYTNVTQGAKEHEEAESADASRRQAPKSPNMGTLMGVYLPCLQNIFGVILFLRLTWIVGTAGVVQSFLIVLMCCSCTMLTAISMSAIATNGVVPAGGAYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEIFLKYLIPQAAIFHPADIHAGNGAMLNNMRVYGTICLSLMAVVVFVGVKYVNKLASLFLACVIISIVSIYAGAVKSIFHPPE-FPICMLGNRTLVRDL-FDVCGKTVVVGNETVPSKLWKNFCT--SDNISSAHCDEYFFHNNVTEIKGIPGLASGIIKENMWGDY-MEKGQIL-EKAKLPSVDVHGSMETFGFYVSADIATSFTLLVGIFFPSATGIMAGSNRSGDLRDAQKSIPIGTILAITTTSLVYFSSVVLFGACIEGVVLRDKFGDAVSKNLVVGTLSWPSPWVIVIGSFFSTVGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKANGEPTWALLLTGLIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFRYYHWALSFLGMSMCLALMFISSWYYAIVAMGIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYSLLRLEAGPPHTKNWRPQLLVLLKLDEDL-HVKYPRLLTFASQLKAGKGLTIVGSVIQGNFLECYGETQASEQAIKNMMEIERVKGFCQVVVASKVREGIAHLIQSCGLGGMKHNTVVMGWPYGWRQSEDPRAWKTFINTVRCTTAAHLALMVPKNVSFYPSNHERFTD------------GYIDVWWIVHDGGMLMLLPFLLKQHKVWRKCKMRIFTVAQMDDNSIQMKKDLATFLYQLRLEAEVEVVEMHDSDISAYTYERTLMMEQRSQMLKQMRLSS---------------------------------------------------AERDREAQLVKDRHS-------LIRMGSLYSDEEEETIEILPE----KNQ--MTWTSEKIEAERRNRNNAPENFREL-----------------ISIKPDQSNV-RRMHTAVKLNEVIVNKSHDARLVLLNMPGPPRNQEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1095          
BLAST of slc12a-4 vs. Ensembl Zebrafish
Match: slc12a7a (solute carrier family 12 member 7a [Source:ZFIN;Acc:ZDB-GENE-070912-696])

HSP 1 Score: 906.36 bits (2341), Expect = 0.000e+0
Identity = 488/1146 (42.58%), Postives = 699/1146 (60.99%), Query Frame = 3
Query:  192 EATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYT----GGIEPTSGETKKLKEK---SSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVA--NPSRSLRVCMLGDRLLN---RSVVLDKEANNTFRCTKDINGP--LYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNY--YTT---KGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            + TP     +  +D ++        LYEEE  + P ++++ NKLA YT    G +E    E++   ++   +  ++GT +GV+ PC QNI GV+ FLRL WI+G +G      +VF+CC  TMLT +SMSAIATNG VPAGGSY+MISR+LGPE GG VG+ FY GTT A +MYI+G +E+ L YI+P A++F     +   M NN R+YG   L IM   VF+G+K+V+K S + L+CV+ SI+ +Y G+  +   PS S  +C+LG+R L    +S   DK          +I  P  L+  +C NGT D      +YF  N +TE  A+PG     + +  +  Y  Y T   K ++  E       +   S  V+D+   FT+L+GI+FPSVTGIMAGSNRSGDL +PQ SIP G+I A ATTSF+Y+S V+ F A  E  VLRDK+G SV + L+VA LAWP+ WVI+IGSF S  GAGLQSLTGAPR+LQAIA+D ++PFL+VF  +   GEP  A  LT  I  +G+LIAS+D++AP+++MFFLMCY FVNLA A+   L+ P+WRPRFK+YHW+ S LG+ L ++LMFVSSWYYALV I +AG IYKYIEYRGA KEWGD  RG  ++AA+ A+++L +   HTKNWRPQ+L+L+ LD   T + HP+L+ F SQLKAG+GLTIV +V+EG    + +D+ +A++ +  A+  ++ KG   +VV+SN  +    L Q++GLG ++HN V+V++P  W   +S + WK F+ T+R   A+  A+LV K +D FP  + +               GT+D+W IVHDGGLL+LL  LL + + W KC++R+F VA   DN+I +KK++  F+Y LR++A+VEVVE++  DISA+ +++T+ +  R ++L+ M L   + +RE Q+I D+  ++                      P      H ++   K     LDE+     +K             NT+    L   +TP  ++  +T+    L     R   A   + +            F+  P    +N      RRMH+AV+LNE++  +S  A L+L+N+PGP KN+  D NYM+++E LT+GL  VL VRG G+EVIT ++
Sbjct:   43 DETPRETSSLISTDHDDSTYGKNMALYEEEMDSTPMVSSLLNKLANYTNITQGAVEHEEAESEDGIQRVTVNGPQMGTFIGVFLPCTQNILGVILFLRLTWIVGTAGILEALAVVFMCCACTMLTAISMSAIATNGVVPAGGSYYMISRALGPEIGGAVGLCFYLGTTFAGSMYILGTMEIFLTYIMPSAAVFEAN--NPTGMQNNMRIYGTCCLAIMTLVVFVGVKYVNKLSLVFLSCVVLSIMAIYAGVIQSAIKPS-SFTICLLGNRTLQHFGKSGKFDKCMKT--EVIDNITKPTELWYHFC-NGTCD------EYFNLNELTEISAVPGLLSNAITENLWSRYGEYRTTVEKENITSEAALSSEPEVLNSYVVNDMATFFTLLVGIYFPSVTGIMAGSNRSGDLRDPQRSIPTGTIMAIATTSFIYISCVVLFGACFEGVVLRDKYGDSVNKNLVVATLAWPSPWVIVIGSFFSCCGAGLQSLTGAPRILQAIARDGIMPFLQVFGRSKSGGEPTWALLLTAAICEIGILIASLDAVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKFYHWSLSFLGMSLSLSLMFVSSWYYALVVILIAGCIYKYIEYRGAVKEWGDGLRGLSLNAARYALIKLEEAQPHTKNWRPQLLVLMKLDTDLT-VKHPRLLSFTSQLKAGKGLTIVCSVLEGTFMVRGADAKLAEQNIKAAMAKEKTKGFCHVVVSSNQRDGFSHLIQSAGLGGMKHNAVLVAWPANWKQAESSLSWKNFIETVRETTAAHQALLVAKNVDTFPSNQDRLAE------------GTIDVWWIVHDGGLLMLLPFLLRQHKVWRKCKMRIFTVAQMDDNSIQMKKDLQMFLYHLRLDAKVEVVEMNAGDISAFTYEKTLVMEQRSQMLKQMQLSKTEREREIQSISDESRIS------------------IRRKPCGEKQTHNSKL--KVATVNLDEEAQLIHDK-------------NTKSHATLVEKATPTSDRVHMTWTKEKLIGERNRLRDASMHVRDI-----------FNMKPEW--ENLDQTNVRRMHTAVKLNEVVVKKSKGAQLVLLNMPGPPKNKGGDENYMEFLEVLTEGLDHVLLVRGGGREVITIYS 1117          
BLAST of slc12a-4 vs. Ensembl Zebrafish
Match: slc12a7a (solute carrier family 12 member 7a [Source:ZFIN;Acc:ZDB-GENE-070912-696])

HSP 1 Score: 905.205 bits (2338), Expect = 0.000e+0
Identity = 489/1146 (42.67%), Postives = 699/1146 (60.99%), Query Frame = 3
Query:  192 EATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYT----GGIEPTSGETKKLKEK---SSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVA--NPSRSLRVCMLGDRLLN---RSVVLDKEANNTFRCTKDINGP--LYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNY--YTT---KGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            + TP     +  +D ++        LYEEE  + P ++++ NKLA YT    G +E    E++   ++   +  ++GT +GV+ PC QNI GV+ FLRL WI+G +G      +VF+CC  TMLT +SMSAIATNG VPAGGSY+MISR+LGPE GG VG+ FY GTT A +MYI+G +E+ L YI+P A++F     +   M NN R+YG   L IM   VF+G+K+V+K S + L+CV+ SI+ +Y G+  +   PS S  +C+LG+R L    +S   DK          +I  P  L+  +C NGT D      +YF  N +TE  A+PG     + +  +  Y  Y T   K ++  E       +   S  V+D+   FT+L+GI+FPSVTGIMAGSNRSGDL +PQ SIP G+I A ATTSF+Y+S V+ F A  E  VLRDK+G SV + L+VA LAWP+ WVI+IGSF S  GAGLQSLTGAPR+LQAIA+D ++PFL+VF  +   GEP  A  LT  I  +G+LIAS+D++AP+++MFFLMCY FVNLA A+   L+ P+WRPRFK+YHW+ S LG+ L ++LMFVSSWYYALV I +AG IYKYIEYRGA KEWGD  RG  ++AA+ A+++L +   HTKNWRPQ+L+L+ LD   T + HP+L+ F SQLKAG+GLTIV +V+EG    + +D+ +A++ +  A+  ++ KG   +VV+SN  +    L Q++GLG ++HN V+V++P  W   +S + WK F+ T+R   A+  A+LV K +D FP  + +               GT+D+W IVHDGGLL+LL  LL + + W KC++R+F VA   DN+I +KK++  F+Y LR++A+VEVVE++  DISA+ +++T+ +  R ++L+ M L   + +RE Q+I D+  ++                      P      H ++   K     LDE+     +K             NT+    L   +TP  ++  +T+    L     R   A   + +            F+  P       QT   RRMH+AV+LNE++  +S  A L+L+N+PGP KN+  D NYM+++E LT+GL  VL VRG G+EVIT ++
Sbjct:   43 DETPRETSSLISTDHDDSTYGKNMALYEEEMDSTPMVSSLLNKLANYTNITQGAVEHEEAESEDGIQRVTVNGPQMGTFIGVFLPCTQNILGVILFLRLTWIVGTAGILEALAVVFMCCACTMLTAISMSAIATNGVVPAGGSYYMISRALGPEIGGAVGLCFYLGTTFAGSMYILGTMEIFLTYIMPSAAVFEAN--NPTGMQNNMRIYGTCCLAIMTLVVFVGVKYVNKLSLVFLSCVVLSIMAIYAGVIQSAIKPS-SFTICLLGNRTLQHFGKSGKFDKCMKT--EVIDNITKPTELWYHFC-NGTCD------EYFNLNELTEISAVPGLLSNAITENLWSRYGEYRTTVEKENITSEAALSSEPEVLNSYVVNDMATFFTLLVGIYFPSVTGIMAGSNRSGDLRDPQRSIPTGTIMAIATTSFIYISCVVLFGACFEGVVLRDKYGDSVNKNLVVATLAWPSPWVIVIGSFFSCCGAGLQSLTGAPRILQAIARDGIMPFLQVFGRSKSGGEPTWALLLTAAICEIGILIASLDAVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKFYHWSLSFLGMSLSLSLMFVSSWYYALVVILIAGCIYKYIEYRGAVKEWGDGLRGLSLNAARYALIKLEEAQPHTKNWRPQLLVLMKLDTDLT-VKHPRLLSFTSQLKAGKGLTIVCSVLEGTFMVRGADAKLAEQNIKAAMAKEKTKGFCHVVVSSNQRDGFSHLIQSAGLGGMKHNAVLVAWPANWKQAESSLSWKNFIETVRETTAAHQALLVAKNVDTFPSNQDRLAE------------GTIDVWWIVHDGGLLMLLPFLLRQHKVWRKCKMRIFTVAQMDDNSIQMKKDLQMFLYHLRLDAKVEVVEMNAGDISAFTYEKTLVMEQRSQMLKQMQLSKTEREREIQSISDESRIS------------------IRRKPCGEKQTHNSKL--KVATVNLDEEAQLIHDK-------------NTKSHATLVEKATPTSDRVHMTWTKEKLIGERNRLRDASMHVRDI-----------FNMKPD------QTNV-RRMHTAVKLNEVVVKKSKGAQLVLLNMPGPPKNKGGDENYMEFLEVLTEGLDHVLLVRGGGREVITIYS 1112          
BLAST of slc12a-4 vs. Ensembl Xenopus
Match: slc12a5 (solute carrier family 12 member 5 [Source:NCBI gene;Acc:779759])

HSP 1 Score: 936.021 bits (2418), Expect = 0.000e+0
Identity = 503/1143 (44.01%), Postives = 708/1143 (61.94%), Query Frame = 3
Query:  189 KEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTG---GI----EPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDEN--IMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYY-----TTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            KE++P  +   EM   +  A      L+EEE  T P ++++ + LA YT    G+    E  + E  K K   + ++GT +GVY PCLQNIFGV+ FLRL W++GV G    F++V +CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ FY GTT A AMYI+G IE++L Y+ P  ++F   E  E    + NN RVYG  +L  M   VF+G+K+V+KF+ + L CV+ SI+ +Y G+   A       +C+LG+R L+R    D  A       + +   L+ L+C   +  LN     YF +NNVTE   IPG    L++D  +  Y        K  L   P  +  L+  Q    SD+   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP+G+I A ATTSFVY+S+VI F A +E  VLRDKFG +V   L+V  LAWP+ WVI+IGSF ST GAGLQSLTGAPRLLQAIA+D ++PFL+VF      GEP  A  LT  I  +G+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRFKYYHWT S LG+ LC++LMF+ SWYYALVA+++AG IYKYIEYRGA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ +D+    + HP+L+   SQLKAG+GLTIVG+V+EG   +       A+E++ R +  +++KG  ++V++SN  + I  L Q+SGLG L+HN ++V +P  W   + H  W+ F+  +R   A+ LA++V K +  FP    +    N            +D+W +VHDGG+L+LL  LL   + W +C +R+F VA   DN+I +KK++  F+Y LRINA+VEVVE+  +DISAY +++T+ +  R +IL+ M+L   + +RE Q+I D+            +I   +P          N  +H + P    EE V D +   +E  + ++   +    S + Q+    PD+T  +   + T    T + N+++    PE I +F           F+  P+      Q+   RRMH+AV+LNE+I  +S +A L+L+N+PGP +N   D NYM+++E LT+ L RV+ VRG G+EVIT ++
Sbjct:   30 KESSPFINSS-EMDTGKNMA------LFEEEMDTSPMVSSLLSGLANYTNLTQGVKEHEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILFLRLTWVVGVGGIMESFIMVVMCCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLTYLFPGMAIFIAQEAREEPAALLNNMRVYGTCVLTCMAIVVFVGVKYVNKFALVFLGCVILSIIAIYAGVIKSAFDPPDFPICLLGNRTLSRKG-FDVCAKFIDSGNETVTTKLWALFC--SSPFLNATCDTYFSQNNVTEVQGIPGVASGLIRDNLWAGYMQKGIIVEKQGLRSAPNSDA-LNLDQPYVFSDMTTYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPIGTIMAIATTSFVYISSVILFGACIEGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIARDGIVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFKYYHWTLSFLGMSLCLSLMFICSWYYALVAMSIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQD-QNVVHPQLLSLTSQLKAGKGLTIVGSVVEGTYLENHPQCQRAEESIRRLMEAEKVKGFCKVVISSNTRDGISHLIQSSGLGGLQHNTLLVGWPRNWRQKEDHQTWRNFIELVRETTAAHLALIVSKNVAMFPGNLERFSEGN------------IDVWWVVHDGGMLMLLPFLLRHHKVWKRCTMRIFTVAQMDDNSIQMKKDLTTFLYHLRINAEVEVVEMHDSDISAYTYEKTLVMEQRSQILKQMHLTKTEREREIQSITDESR---------GSIRRKNPS---------NSRLHLSVP----EEQVGDCEEKSEEEVQLIHDK-NTTGFSESAQSPAEEPDTTQEKVHLTWTKDKCTAEKNSSKCPSTPEAIKDF-----------FNMKPN------QSNV-RRMHTAVKLNEVIVKKSHDAKLVLLNMPGPPRNRKGDENYMEFLEVLTEHLDRVMLVRGGGREVITIYS 1107          
BLAST of slc12a-4 vs. Ensembl Xenopus
Match: slc12a5 (solute carrier family 12 member 5 [Source:NCBI gene;Acc:779759])

HSP 1 Score: 935.25 bits (2416), Expect = 0.000e+0
Identity = 503/1143 (44.01%), Postives = 708/1143 (61.94%), Query Frame = 3
Query:  189 KEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTG---GI----EPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDEN--IMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYY-----TTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            KE++P  +   EM   +  A      L+EEE  T P ++++ + LA YT    G+    E  + E  K K   + ++GT +GVY PCLQNIFGV+ FLRL W++GV G    F++V +CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ FY GTT A AMYI+G IE++L Y+ P  ++F   E  E    + NN RVYG  +L  M   VF+G+K+V+KF+ + L CV+ SI+ +Y G+   A       +C+LG+R L+R    D  A       + +   L+ L+C   +  LN     YF +NNVTE   IPG    L++D  +  Y        K  L   P  +  L+  Q    SD+   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP+G+I A ATTSFVY+S+VI F A +E  VLRDKFG +V   L+V  LAWP+ WVI+IGSF ST GAGLQSLTGAPRLLQAIA+D ++PFL+VF      GEP  A  LT  I  +G+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRFKYYHWT S LG+ LC++LMF+ SWYYALVA+++AG IYKYIEYRGA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ +D+    + HP+L+   SQLKAG+GLTIVG+V+EG   +       A+E++ R +  +++KG  ++V++SN  + I  L Q+SGLG L+HN ++V +P  W   + H  W+ F+  +R   A+ LA++V K +  FP    +    N            +D+W +VHDGG+L+LL  LL   + W +C +R+F VA   DN+I +KK++  F+Y LRINA+VEVVE+  +DISAY +++T+ +  R +IL+ M+L   + +RE Q+I D+            +I   +P          N  +H + P    EE V D +   +E  + ++   +    S + Q+    PD+T  +   + T    T + N+++    PE I +F           F+  P+      Q+   RRMH+AV+LNE+I  +S +A L+L+N+PGP +N   D NYM+++E LT+ L RV+ VRG G+EVIT ++
Sbjct:   23 KESSPFINSS-EMDTGKNMA------LFEEEMDTSPMVSSLLSGLANYTNLTQGVKEHEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILFLRLTWVVGVGGIMESFIMVVMCCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLTYLFPGMAIFIAQEAREEPAALLNNMRVYGTCVLTCMAIVVFVGVKYVNKFALVFLGCVILSIIAIYAGVIKSAFDPPDFPICLLGNRTLSRKG-FDVCAKFIDSGNETVTTKLWALFC--SSPFLNATCDTYFSQNNVTEVQGIPGVASGLIRDNLWAGYMQKGIIVEKQGLRSAPNSDA-LNLDQPYVFSDMTTYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPIGTIMAIATTSFVYISSVILFGACIEGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIARDGIVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFKYYHWTLSFLGMSLCLSLMFICSWYYALVAMSIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQD-QNVVHPQLLSLTSQLKAGKGLTIVGSVVEGTYLENHPQCQRAEESIRRLMEAEKVKGFCKVVISSNTRDGISHLIQSSGLGGLQHNTLLVGWPRNWRQKEDHQTWRNFIELVRETTAAHLALIVSKNVAMFPGNLERFSEGN------------IDVWWVVHDGGMLMLLPFLLRHHKVWKRCTMRIFTVAQMDDNSIQMKKDLTTFLYHLRINAEVEVVEMHDSDISAYTYEKTLVMEQRSQILKQMHLTKTEREREIQSITDESR---------GSIRRKNPS---------NSRLHLSVP----EEQVGDCEEKSEEEVQLIHDK-NTTGFSESAQSPAEEPDTTQEKVHLTWTKDKCTAEKNSSKCPSTPEAIKDF-----------FNMKPN------QSNV-RRMHTAVKLNEVIVKKSHDAKLVLLNMPGPPRNRKGDENYMEFLEVLTEHLDRVMLVRGGGREVITIYS 1100          
BLAST of slc12a-4 vs. Ensembl Xenopus
Match: slc12a5 (solute carrier family 12 member 5 [Source:NCBI gene;Acc:779759])

HSP 1 Score: 934.48 bits (2414), Expect = 0.000e+0
Identity = 503/1143 (44.01%), Postives = 708/1143 (61.94%), Query Frame = 3
Query:  189 KEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTG---GI----EPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDEN--IMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYY-----TTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            KE++P  +   EM   +  A      L+EEE  T P ++++ + LA YT    G+    E  + E  K K   + ++GT +GVY PCLQNIFGV+ FLRL W++GV G    F++V +CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ FY GTT A AMYI+G IE++L Y+ P  ++F   E  E    + NN RVYG  +L  M   VF+G+K+V+KF+ + L CV+ SI+ +Y G+   A       +C+LG+R L+R    D  A       + +   L+ L+C   +  LN     YF +NNVTE   IPG    L++D  +  Y        K  L   P  +  L+  Q    SD+   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP+G+I A ATTSFVY+S+VI F A +E  VLRDKFG +V   L+V  LAWP+ WVI+IGSF ST GAGLQSLTGAPRLLQAIA+D ++PFL+VF      GEP  A  LT  I  +G+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRFKYYHWT S LG+ LC++LMF+ SWYYALVA+++AG IYKYIEYRGA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ +D+    + HP+L+   SQLKAG+GLTIVG+V+EG   +       A+E++ R +  +++KG  ++V++SN  + I  L Q+SGLG L+HN ++V +P  W   + H  W+ F+  +R   A+ LA++V K +  FP    +    N            +D+W +VHDGG+L+LL  LL   + W +C +R+F VA   DN+I +KK++  F+Y LRINA+VEVVE+  +DISAY +++T+ +  R +IL+ M+L   + +RE Q+I D+            +I   +P          N  +H + P    EE V D +   +E  + ++   +    S + Q+    PD+T  +   + T    T + N+++    PE I +F           F+  P+      Q+   RRMH+AV+LNE+I  +S +A L+L+N+PGP +N   D NYM+++E LT+ L RV+ VRG G+EVIT ++
Sbjct:   20 KESSPFINSS-EMDTGKNMA------LFEEEMDTSPMVSSLLSGLANYTNLTQGVKEHEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILFLRLTWVVGVGGIMESFIMVVMCCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLTYLFPGMAIFIAQEAREEPAALLNNMRVYGTCVLTCMAIVVFVGVKYVNKFALVFLGCVILSIIAIYAGVIKSAFDPPDFPICLLGNRTLSRKG-FDVCAKFIDSGNETVTTKLWALFC--SSPFLNATCDTYFSQNNVTEVQGIPGVASGLIRDNLWAGYMQKGIIVEKQGLRSAPNSDA-LNLDQPYVFSDMTTYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPIGTIMAIATTSFVYISSVILFGACIEGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIARDGIVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFKYYHWTLSFLGMSLCLSLMFICSWYYALVAMSIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQD-QNVVHPQLLSLTSQLKAGKGLTIVGSVVEGTYLENHPQCQRAEESIRRLMEAEKVKGFCKVVISSNTRDGISHLIQSSGLGGLQHNTLLVGWPRNWRQKEDHQTWRNFIELVRETTAAHLALIVSKNVAMFPGNLERFSEGN------------IDVWWVVHDGGMLMLLPFLLRHHKVWKRCTMRIFTVAQMDDNSIQMKKDLTTFLYHLRINAEVEVVEMHDSDISAYTYEKTLVMEQRSQILKQMHLTKTEREREIQSITDESR---------GSIRRKNPS---------NSRLHLSVP----EEQVGDCEEKSEEEVQLIHDK-NTTGFSESAQSPAEEPDTTQEKVHLTWTKDKCTAEKNSSKCPSTPEAIKDF-----------FNMKPN------QSNV-RRMHTAVKLNEVIVKKSHDAKLVLLNMPGPPRNRKGDENYMEFLEVLTEHLDRVMLVRGGGREVITIYS 1097          
BLAST of slc12a-4 vs. Ensembl Xenopus
Match: slc12a5 (solute carrier family 12 member 5 [Source:NCBI gene;Acc:779759])

HSP 1 Score: 912.909 bits (2358), Expect = 0.000e+0
Identity = 488/1114 (43.81%), Postives = 677/1114 (60.77%), Query Frame = 3
Query:  276 EEFHTRPPMANIFNKLAQYTG---GI----EPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDEN--IMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYY-----TTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            EE  T P ++++ + LA YT    G+    E  + E  K K   + ++GT +GVY PCLQNIFGV+ FLRL W++GV G    F++V +CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ FY GTT A AMYI+G IE++L Y+ P  ++F   E  E    + NN RVYG  +L  M   VF+G+K+V+KF+ + L CV+ SI+ +Y G+   A       +C+LG+R L+R    D  A       + +   L+ L+C   +  LN     YF +NNVTE   IPG    L++D  +  Y        K  L   P  +  L+  Q    SD+   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP+G+I A ATTSFVY+S+VI F A +E  VLRDKFG +V   L+V  LAWP+ WVI+IGSF ST GAGLQSLTGAPRLLQAIA+D ++PFL+VF      GEP  A  LT  I  +G+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRFKYYHWT S LG+ LC++LMF+ SWYYALVA+++AG IYKYIEYRGA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ +D+    + HP+L+   SQLKAG+GLTIVG+V+EG   +       A+E++ R +  +++KG  ++V++SN  + I  L Q+SGLG L+HN ++V +P  W   + H  W+ F+  +R   A+ LA++V K +  FP    +    N            +D+W +VHDGG+L+LL  LL   + W +C +R+F VA   DN+I +KK++  F+Y LRINA+VEVVE+  +DISAY +++T+ +  R +IL+ M+L   + +RE Q I DK+     E                              P E+           PD  +E +  H++  K   T +                          N+++    PE I +F           F+  P+      Q+   RRMH+AV+LNE+I  +S +A L+L+N+PGP +N   D NYM+++E LT+ L RV+ VRG G+EVIT ++
Sbjct:   23 EEMDTSPMVSSLLSGLANYTNLTQGVKEHEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILFLRLTWVVGVGGIMESFIMVVMCCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLTYLFPGMAIFIAQEAREEPAALLNNMRVYGTCVLTCMAIVVFVGVKYVNKFALVFLGCVILSIIAIYAGVIKSAFDPPDFPICLLGNRTLSRKG-FDVCAKFIDSGNETVTTKLWALFC--SSPFLNATCDTYFSQNNVTEVQGIPGVASGLIRDNLWAGYMQKGIIVEKQGLRSAPNSDA-LNLDQPYVFSDMTTYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPIGTIMAIATTSFVYISSVILFGACIEGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIARDGIVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFKYYHWTLSFLGMSLCLSLMFICSWYYALVAMSIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQD-QNVVHPQLLSLTSQLKAGKGLTIVGSVVEGTYLENHPQCQRAEESIRRLMEAEKVKGFCKVVISSNTRDGISHLIQSSGLGGLQHNTLLVGWPRNWRQKEDHQTWRNFIELVRETTAAHLALIVSKNVAMFPGNLERFSEGN------------IDVWWVVHDGGMLMLLPFLLRHHKVWKRCTMRIFTVAQMDDNSIQMKKDLTTFLYHLRINAEVEVVEMHDSDISAYTYEKTLVMEQRSQILKQMHLTKTEREREVQLIHDKNTTGFSE--------------------------SAQSPAEE-----------PDTTQEKV--HLTWTKDKCTAEK-------------------------NSSKCPSTPEAIKDF-----------FNMKPN------QSNV-RRMHTAVKLNEVIVKKSHDAKLVLLNMPGPPRNRKGDENYMEFLEVLTEHLDRVMLVRGGGREVITIYS 1037          
BLAST of slc12a-4 vs. Ensembl Xenopus
Match: slc12a5 (solute carrier family 12 member 5 [Source:NCBI gene;Acc:779759])

HSP 1 Score: 912.138 bits (2356), Expect = 0.000e+0
Identity = 495/1144 (43.27%), Postives = 689/1144 (60.23%), Query Frame = 3
Query:  189 KEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTG---GI----EPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDEN--IMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYY-----TTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKE-TLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            KE++P  +   EM   +  A      L+EEE  T P ++++ + LA YT    G+    E  + E  K K   + ++GT +GVY PCLQNIFGV+ FLRL W++GV G    F++V +CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ FY GTT A AMYI+G IE++L Y+ P  ++F   E  E    + NN RVYG  +L  M   VF+G+K+V+KF+ + L CV+ SI+ +Y G+   A       +C+LG+R L+R    D  A       + +   L+ L+C   +  LN     YF +NNVTE   IPG    L++D  +  Y        K  L   P  +  L+  Q    SD+   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP+G+I A ATTSFVY+S+VI F A +E  VLRDKFG +V   L+V  LAWP+ WVI+IGSF ST GAGLQSLTGAPRLLQAIA+D ++PFL+VF      GEP  A  LT  I  +G+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRFKYYHWT S LG+ LC++LMF+ SWYYALVA+++AG IYKYIEYRGA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ +D+    + HP+L+   SQLKAG+GLTIVG+V+EG   +       A+E +++     +++KG  ++V++SN  + I  L Q+SGLG L+HN ++V +P  W   + H  W+ F+  +R   A+ LA++V K +  FP    +    N            +D+W +VHDGG+L+LL  LL   + W +C +R+F VA   DN+I +KK++  F+Y LRINA+VEVVE+  +DISAY +++T+ +  R +IL+ M+L   + +RE Q I DK+     E                              P E+           PD  +E +  H++  K   T +                          N+++    PE I +F           F+  P   + N+     RRMH+AV+LNE+I  +S +A L+L+N+PGP +N   D NYM+++E LT+ L RV+ VRG G+EVIT ++
Sbjct:   16 KESSPFINSS-EMDTGKNMA------LFEEEMDTSPMVSSLLSGLANYTNLTQGVKEHEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILFLRLTWVVGVGGIMESFIMVVMCCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLTYLFPGMAIFIAQEAREEPAALLNNMRVYGTCVLTCMAIVVFVGVKYVNKFALVFLGCVILSIIAIYAGVIKSAFDPPDFPICLLGNRTLSRKG-FDVCAKFIDSGNETVTTKLWALFC--SSPFLNATCDTYFSQNNVTEVQGIPGVASGLIRDNLWAGYMQKGIIVEKQGLRSAPNSDA-LNLDQPYVFSDMTTYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPIGTIMAIATTSFVYISSVILFGACIEGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIARDGIVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFKYYHWTLSFLGMSLCLSLMFICSWYYALVAMSIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQD-QNVVHPQLLSLTSQLKAGKGLTIVGSVVEGTYLENHPQCQRAEEVSISMKYAAEKVKGFCKVVISSNTRDGISHLIQSSGLGGLQHNTLLVGWPRNWRQKEDHQTWRNFIELVRETTAAHLALIVSKNVAMFPGNLERFSEGN------------IDVWWVVHDGGMLMLLPFLLRHHKVWKRCTMRIFTVAQMDDNSIQMKKDLTTFLYHLRINAEVEVVEMHDSDISAYTYEKTLVMEQRSQILKQMHLTKTEREREVQLIHDKNTTGFSE--------------------------SAQSPAEE-----------PDTTQEKV--HLTWTKDKCTAEK-------------------------NSSKCPSTPEAIKDF-----------FNMKPEWENLNQSNV--RRMHTAVKLNEVIVKKSHDAKLVLLNMPGPPRNRKGDENYMEFLEVLTEHLDRVMLVRGGGREVITIYS 1058          
BLAST of slc12a-4 vs. Ensembl Mouse
Match: Slc12a5 (solute carrier family 12, member 5 [Source:MGI Symbol;Acc:MGI:1862037])

HSP 1 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 503/1167 (43.10%), Postives = 713/1167 (61.10%), Query Frame = 3
Query:  132 EKAAHYVVESKVENSENITKEATPLTDEEIEMSDDEEPAGD---SKFDLYEEEFHTRPPMANIFNKLAQYTG-------GIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIEL--DENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEP-------HLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            E   H V + +    E++  +  P        S D E   +       L+EEE  T P ++++ + LA YT          E  + E  K K   + ++GT +GVY PCLQNIFGV+ FLRL W++G++G    F +VF+CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ FY GTT A AMYI+G IE++L Y+ P  ++F   +   +   M NN RVYG  +L  M + VF+G+K+V+KF+ + L CV+ SIL +Y G+   A    +  +C+LG+R L+R    D  A   +   + +   L+ L+C   ++ LN    +YF  NNVTE   IPG    L+K+  + +Y T KG +    G           +D       SD+   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP G+I A ATTS VY+S+V+ F A +E  VLRDKFG +V   L+V  LAWP+ WVI+IGSF ST GAGLQSLTGAPRLLQAI++D ++PFL+VF      GEP  A  LT  I  +G+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRF+YYHWT S LG+ LC+ALMF+ SWYYALVA+ +AG IYKYIEYRGA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ +D+    + HP+L+   SQLKAG+GLTIVG+V+EG   D    +  A+E++ R +  +++KG  ++V++SN+ + +  L Q+ GLG L+HN V+V +P  W   + H  W+ F+  +R   A  LA+LV K +  FP    +               G++D+W IVHDGG+L+LL  LL   + W KC++R+F VA   DN+I +KK++  F+Y LRI A+VEVVE+ ++DISAY +++T+ +  R +IL+ M+L   + +RE Q+I D+   + G +             P +P   +NV           EET  D +  P+E  + ++   +    S++               +  +T+   T D + A  +  P        SP +  G+K  FS     +N      RRMH+AVRLNE+I ++S +A L+L+N+PGP +N + D NYM+++E LT+ L RV+ VRG G+EVIT ++
Sbjct:   22 ESRRHSVADPRRLPREDVKGDGNPKESSPFINSTDTEKGREYDGRNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSREHEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAEDASGEAAAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKSAFDPPNFPICLLGNRTLSRHG-FDVCAKLAWEGNETVTTRLWGLFC--SSRLLNATCDEYFTRNNVTEIQGIPGAASGLIKENLWSSYLT-KGVIVERRGMPSVGLADGTPVDMDHPYVFSDMTSYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACIEGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDGIVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQD-QNVVHPQLLSLTSQLKAGKGLTIVGSVLEGTFLDNHPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHLIQSGGLGGLQHNTVLVGWPRNWRQKEDHQTWRNFIELVRETTAGHLALLVTKNVSMFPGNPERFSE------------GSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTTFLYHLRITAEVEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDE---SRGSIRRKN---------PANPRLRLNV----------PEETACDNEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGERETDPEVHLTW---TKDKSVAEKNKGP--------SPVSSEGIKDFFSMKPEWENLNQSNVRRMHTAVRLNEVIVNKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEQLDRVMLVRGGGREVITIYS 1138          
BLAST of slc12a-4 vs. Ensembl Mouse
Match: Slc12a5 (solute carrier family 12, member 5 [Source:MGI Symbol;Acc:MGI:1862037])

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 503/1167 (43.10%), Postives = 712/1167 (61.01%), Query Frame = 3
Query:  132 EKAAHYVVESKVENSENITKEATPLTDEEIEMSDDEEPAGD---SKFDLYEEEFHTRPPMANIFNKLAQYTG-------GIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIEL--DENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEP-------HLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            E   H V + +    E++  +  P        S D E   +       L+EEE  T P ++++ + LA YT          E  + E  K K   + ++GT +GVY PCLQNIFGV+ FLRL W++G++G    F +VF+CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ FY GTT A AMYI+G IE++L Y+ P  ++F   +   +   M NN RVYG  +L  M + VF+G+K+V+KF+ + L CV+ SIL +Y G+   A    +  +C+LG+R L+R    D  A   +   + +   L+ L+C   ++ LN    +YF  NNVTE   IPG    L+K+  + +Y T KG +    G           +D       SD+   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP G+I A ATTS VY+S+V+ F A +E  VLRDKFG +V   L+V  LAWP+ WVI+IGSF ST GAGLQSLTGAPRLLQAI++D ++PFL+VF      GEP  A  LT  I  +G+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRF+YYHWT S LG+ LC+ALMF+ SWYYALVA+ +AG IYKYIEYRGA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ +D+    + HP+L+   SQLKAG+GLTIVG+V+EG   D    +  A+E++ R +  +++KG  ++V++SN+ + +  L Q+ GLG L+HN V+V +P  W   + H  W+ F+  +R   A  LA+LV K +  FP    +               G++D+W IVHDGG+L+LL  LL   + W KC++R+F VA   DN+I +KK++  F+Y LRI A+VEVVE+ ++DISAY +++T+ +  R +IL+ M+L   + +RE Q+I D+   + G +             P +P   +NV           EET  D +  P+E  + ++   +    S++               +  +T+   T D + A  +  P        SP +  G+K  FS      N      RRMH+AVRLNE+I ++S +A L+L+N+PGP +N + D NYM+++E LT+ L RV+ VRG G+EVIT ++
Sbjct:   22 ESRRHSVADPRRLPREDVKGDGNPKESSPFINSTDTEKGREYDGRNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSREHEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAEDASGEAAAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKSAFDPPNFPICLLGNRTLSRHG-FDVCAKLAWEGNETVTTRLWGLFC--SSRLLNATCDEYFTRNNVTEIQGIPGAASGLIKENLWSSYLT-KGVIVERRGMPSVGLADGTPVDMDHPYVFSDMTSYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACIEGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDGIVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQD-QNVVHPQLLSLTSQLKAGKGLTIVGSVLEGTFLDNHPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHLIQSGGLGGLQHNTVLVGWPRNWRQKEDHQTWRNFIELVRETTAGHLALLVTKNVSMFPGNPERFSE------------GSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTTFLYHLRITAEVEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDE---SRGSIRRKN---------PANPRLRLNV----------PEETACDNEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGERETDPEVHLTW---TKDKSVAEKNKGP--------SPVSSEGIKDFFSMKPNQSNV-----RRMHTAVRLNEVIVNKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEQLDRVMLVRGGGREVITIYS 1133          
BLAST of slc12a-4 vs. Ensembl Mouse
Match: Slc12a4 (solute carrier family 12, member 4 [Source:MGI Symbol;Acc:MGI:1309465])

HSP 1 Score: 932.554 bits (2409), Expect = 0.000e+0
Identity = 515/1133 (45.45%), Postives = 691/1133 (60.99%), Query Frame = 3
Query:  252 DSKFDLYEEEFHTRPPMANIFNKLAQYTGGI-------EPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDE--NIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF--VANPSRSLRVCMLGDRLLNR--------SVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACK-YFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSL---YGEPGKEPHLDKGQSPS---VSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            D    L+EEE   RP ++++  KL  YT          E  SGE  + +   +  +GT++GVY PCLQNIFGV+ FLRL W++G +G     +IV +CCC T+LT +SMSAIATNG VPAGGSYFMISRSLGPEFGG VG+ FY GTT AAAMYI+GAIE++L YI P A++F P    +  +   NN RVYG I L +M   VF+G+K+V+KF+++ LACV+ SIL +Y G    + +P     VCMLG+R L+R        +VV+D E   T          L+  +C   + +L  ++C  YF  NNVTE P IPG    +L++  + + Y  KG +   +G P  +  L   +S S   V+DI  SFT+L+GIFFPSVTGIMAGSNRSGDL + Q SIP+G+I A  TTS VY S+VI F A +E  VLRDK+G  V   L+V  LAWP+ WVI++GSF ST GAGLQSLTGAPRLLQAIA+DN+IPFL VF      GEP  A  LT  I+ LG+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRFKYYHWT S LG+ LC+ALMFVSSWYYALVA+ +AG IYKYIEY+GA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ LDE    + +P+L+ F SQLKAG+GLTIVG+VI+G   +   ++  A++T+   +  +++KG  ++VVAS V E +  L Q+ GLG +RHN V++ +P  W   +    WK F+ T+R   A+ LA+LVPK I            A  PS+    + G +D+W IVHDGG+L+LL  LL + + W KC +R+F VA   DN+I +KK++  F+Y LR+ A+VEVVE+  +DISAY ++RT+ +  R ++L  M L    TK                                               TE+  E  L +D H     ES+         S+ E+  +   D   +   R    A P  D ++A     P+   E                    H        RRMH+AV+LNE+I +RS +A L+L+N+PGP KN   D NYM+++E LT+GL RVL VRG G+EVIT ++
Sbjct:   65 DRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGGRRRAAKAPSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFYPSGTHDMSSATLNNMRVYGTIFLTLMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSIFDPP-VFPVCMLGNRTLSRDQFDICAKTVVVDNETVAT---------RLWTFFCH--SPNLTADSCDPYFLLNNVTEIPGIPGAAAGVLQENLW-SAYLEKGEVVEKHGLPSTDT-LGLKESLSLYVVADIATSFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIVTTSLVYFSSVILFGACIEGVVLRDKYGDGVSRNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKANGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWTLSFLGMSLCLALMFVSSWYYALVAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDL-HVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLESYGEAQAAEQTIKNMMDIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQSEDPRAWKTFIDTVRCTTAAHLALLVPKNI------------AFYPSNHERYLDGHIDVWWIVHDGGMLMLLPFLLRQHKVWKKCRMRIFTVAQMDDNSIQMKKDLAIFLYHLRLEAEVEVVEMHNSDISAYTYERTLMMEQRSQMLRQMRL----TK-----------------------------------------------TERDREAQLVKDRHSALRLESL--------YSDEEEESVAGADKIQMTWTRDKYMAEP-WDPSHA-----PDNFRELV------------------HIKPDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPKNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1087          
BLAST of slc12a-4 vs. Ensembl Mouse
Match: Slc12a5 (solute carrier family 12, member 5 [Source:MGI Symbol;Acc:MGI:1862037])

HSP 1 Score: 932.554 bits (2409), Expect = 0.000e+0
Identity = 501/1148 (43.64%), Postives = 709/1148 (61.76%), Query Frame = 3
Query:  189 KEATPLTDEEIEMSDDEEPAGD---SKFDLYEEEFHTRPPMANIFNKLAQYTG-------GIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIEL--DENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEP-------HLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            KE++P  +     S D E   +       L+EEE  T P ++++ + LA YT          E  + E  K K   + ++GT +GVY PCLQNIFGV+ FLRL W++G++G    F +VF+CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ FY GTT A AMYI+G IE++L Y+ P  ++F   +   +   M NN RVYG  +L  M + VF+G+K+V+KF+ + L CV+ SIL +Y G+   A    +  +C+LG+R L+R    D  A   +   + +   L+ L+C   ++ LN    +YF  NNVTE   IPG    L+K+  + +Y T KG +    G           +D       SD+   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP G+I A ATTS VY+S+V+ F A +E  VLRDKFG +V   L+V  LAWP+ WVI+IGSF ST GAGLQSLTGAPRLLQAI++D ++PFL+VF      GEP  A  LT  I  +G+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRF+YYHWT S LG+ LC+ALMF+ SWYYALVA+ +AG IYKYIEYRGA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ +D+    + HP+L+   SQLKAG+GLTIVG+V+EG   D    +  A+E++ R +  +++KG  ++V++SN+ + +  L Q+ GLG L+HN V+V +P  W   + H  W+ F+  +R   A  LA+LV K +  FP    +               G++D+W IVHDGG+L+LL  LL   + W KC++R+F VA   DN+I +KK++  F+Y LRI A+VEVVE+ ++DISAY +++T+ +  R +IL+ M+L   + +RE Q+I D+   + G +             P +P   +NV           EET  D +  P+E  + ++   +    S++               +  +T+   T D + A  +  P        SP +  G+K  FS     +N      RRMH+AVRLNE+I ++S +A L+L+N+PGP +N + D NYM+++E LT+ L RV+ VRG G+EVIT ++
Sbjct:   23 KESSPFIN-----STDTEKGREYDGRNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSREHEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAEDASGEAAAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKSAFDPPNFPICLLGNRTLSRHG-FDVCAKLAWEGNETVTTRLWGLFC--SSRLLNATCDEYFTRNNVTEIQGIPGAASGLIKENLWSSYLT-KGVIVERRGMPSVGLADGTPVDMDHPYVFSDMTSYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACIEGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDGIVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQD-QNVVHPQLLSLTSQLKAGKGLTIVGSVLEGTFLDNHPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHLIQSGGLGGLQHNTVLVGWPRNWRQKEDHQTWRNFIELVRETTAGHLALLVTKNVSMFPGNPERFSE------------GSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTTFLYHLRITAEVEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDE---SRGSIRRKN---------PANPRLRLNV----------PEETACDNEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGERETDPEVHLTW---TKDKSVAEKNKGP--------SPVSSEGIKDFFSMKPEWENLNQSNVRRMHTAVRLNEVIVNKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEQLDRVMLVRGGGREVITIYS 1115          
BLAST of slc12a-4 vs. Ensembl Mouse
Match: Slc12a4 (solute carrier family 12, member 4 [Source:MGI Symbol;Acc:MGI:1309465])

HSP 1 Score: 932.169 bits (2408), Expect = 0.000e+0
Identity = 515/1133 (45.45%), Postives = 691/1133 (60.99%), Query Frame = 3
Query:  252 DSKFDLYEEEFHTRPPMANIFNKLAQYTGGI-------EPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDE--NIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF--VANPSRSLRVCMLGDRLLNR--------SVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACK-YFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSL---YGEPGKEPHLDKGQSPS---VSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            D    L+EEE   RP ++++  KL  YT          E  SGE  + +   +  +GT++GVY PCLQNIFGV+ FLRL W++G +G     +IV +CCC T+LT +SMSAIATNG VPAGGSYFMISRSLGPEFGG VG+ FY GTT AAAMYI+GAIE++L YI P A++F P    +  +   NN RVYG I L +M   VF+G+K+V+KF+++ LACV+ SIL +Y G    + +P     VCMLG+R L+R        +VV+D E   T          L+  +C   + +L  ++C  YF  NNVTE P IPG    +L++  + + Y  KG +   +G P  +  L   +S S   V+DI  SFT+L+GIFFPSVTGIMAGSNRSGDL + Q SIP+G+I A  TTS VY S+VI F A +E  VLRDK+G  V   L+V  LAWP+ WVI++GSF ST GAGLQSLTGAPRLLQAIA+DN+IPFL VF      GEP  A  LT  I+ LG+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRFKYYHWT S LG+ LC+ALMFVSSWYYALVA+ +AG IYKYIEY+GA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ LDE    + +P+L+ F SQLKAG+GLTIVG+VI+G   +   ++  A++T+   +  +++KG  ++VVAS V E +  L Q+ GLG +RHN V++ +P  W   +    WK F+ T+R   A+ LA+LVPK I            A  PS+    + G +D+W IVHDGG+L+LL  LL + + W KC +R+F VA   DN+I +KK++  F+Y LR+ A+VEVVE+  +DISAY ++RT+ +  R ++L  M L    TK                                               TE+  E  L +D H     ES+         S+ E+  +   D   +   R    A P  D ++A     P+   E                    H        RRMH+AV+LNE+I +RS +A L+L+N+PGP KN   D NYM+++E LT+GL RVL VRG G+EVIT ++
Sbjct:   63 DRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGGRRRAAKAPSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFYPSGTHDMSSATLNNMRVYGTIFLTLMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSIFDPP-VFPVCMLGNRTLSRDQFDICAKTVVVDNETVAT---------RLWTFFCH--SPNLTADSCDPYFLLNNVTEIPGIPGAAAGVLQENLW-SAYLEKGEVVEKHGLPSTDT-LGLKESLSLYVVADIATSFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIVTTSLVYFSSVILFGACIEGVVLRDKYGDGVSRNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKANGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWTLSFLGMSLCLALMFVSSWYYALVAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDL-HVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLESYGEAQAAEQTIKNMMDIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQSEDPRAWKTFIDTVRCTTAAHLALLVPKNI------------AFYPSNHERYLDGHIDVWWIVHDGGMLMLLPFLLRQHKVWKKCRMRIFTVAQMDDNSIQMKKDLAIFLYHLRLEAEVEVVEMHNSDISAYTYERTLMMEQRSQMLRQMRL----TK-----------------------------------------------TERDREAQLVKDRHSALRLESL--------YSDEEEESVAGADKIQMTWTRDKYMAEP-WDPSHA-----PDNFRELV------------------HIKPDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPKNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1085          
BLAST of slc12a-4 vs. UniProt/SwissProt
Match: sp|Q91V14|S12A5_MOUSE (Solute carrier family 12 member 5 OS=Mus musculus OX=10090 GN=Slc12a5 PE=1 SV=2)

HSP 1 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 503/1167 (43.10%), Postives = 713/1167 (61.10%), Query Frame = 3
Query:  132 EKAAHYVVESKVENSENITKEATPLTDEEIEMSDDEEPAGD---SKFDLYEEEFHTRPPMANIFNKLAQYTG-------GIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIEL--DENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEP-------HLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            E   H V + +    E++  +  P        S D E   +       L+EEE  T P ++++ + LA YT          E  + E  K K   + ++GT +GVY PCLQNIFGV+ FLRL W++G++G    F +VF+CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ FY GTT A AMYI+G IE++L Y+ P  ++F   +   +   M NN RVYG  +L  M + VF+G+K+V+KF+ + L CV+ SIL +Y G+   A    +  +C+LG+R L+R    D  A   +   + +   L+ L+C   ++ LN    +YF  NNVTE   IPG    L+K+  + +Y T KG +    G           +D       SD+   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP G+I A ATTS VY+S+V+ F A +E  VLRDKFG +V   L+V  LAWP+ WVI+IGSF ST GAGLQSLTGAPRLLQAI++D ++PFL+VF      GEP  A  LT  I  +G+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRF+YYHWT S LG+ LC+ALMF+ SWYYALVA+ +AG IYKYIEYRGA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ +D+    + HP+L+   SQLKAG+GLTIVG+V+EG   D    +  A+E++ R +  +++KG  ++V++SN+ + +  L Q+ GLG L+HN V+V +P  W   + H  W+ F+  +R   A  LA+LV K +  FP    +               G++D+W IVHDGG+L+LL  LL   + W KC++R+F VA   DN+I +KK++  F+Y LRI A+VEVVE+ ++DISAY +++T+ +  R +IL+ M+L   + +RE Q+I D+   + G +             P +P   +NV           EET  D +  P+E  + ++   +    S++               +  +T+   T D + A  +  P        SP +  G+K  FS     +N      RRMH+AVRLNE+I ++S +A L+L+N+PGP +N + D NYM+++E LT+ L RV+ VRG G+EVIT ++
Sbjct:   22 ESRRHSVADPRRLPREDVKGDGNPKESSPFINSTDTEKGREYDGRNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSREHEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAEDASGEAAAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKSAFDPPNFPICLLGNRTLSRHG-FDVCAKLAWEGNETVTTRLWGLFC--SSRLLNATCDEYFTRNNVTEIQGIPGAASGLIKENLWSSYLT-KGVIVERRGMPSVGLADGTPVDMDHPYVFSDMTSYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACIEGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDGIVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQD-QNVVHPQLLSLTSQLKAGKGLTIVGSVLEGTFLDNHPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHLIQSGGLGGLQHNTVLVGWPRNWRQKEDHQTWRNFIELVRETTAGHLALLVTKNVSMFPGNPERFSE------------GSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTTFLYHLRITAEVEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDE---SRGSIRRKN---------PANPRLRLNV----------PEETACDNEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGERETDPEVHLTW---TKDKSVAEKNKGP--------SPVSSEGIKDFFSMKPEWENLNQSNVRRMHTAVRLNEVIVNKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEQLDRVMLVRGGGREVITIYS 1138          
BLAST of slc12a-4 vs. UniProt/SwissProt
Match: sp|Q63633|S12A5_RAT (Solute carrier family 12 member 5 OS=Rattus norvegicus OX=10116 GN=Slc12a5 PE=1 SV=2)

HSP 1 Score: 935.636 bits (2417), Expect = 0.000e+0
Identity = 502/1167 (43.02%), Postives = 711/1167 (60.93%), Query Frame = 3
Query:  132 EKAAHYVVESKVENSENITKEATPLTDEEIEMSDDEEPAGD---SKFDLYEEEFHTRPPMANIFNKLAQYTG-------GIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIEL--DENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEP-------HLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            E   H V + +    E++  +  P        S D E   +       L+EEE  T P ++++ + LA YT          E  + E  K K   + ++GT +GVY PCLQNIFGV+ FLRL W++G++G    F +VF+CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ FY GTT A AMYI+G IE++L Y+ P  ++F   +   +   M NN RVYG  +L  M + VF+G+K+V+KF+ + L CV+ SIL +Y G+   A    +  +C+LG+R L+R    D  A   +   + +   L+ L+C   ++ LN    +YF  NNVTE   IPG    L+K+  + +Y T KG +    G           +D       SD+   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP G+I A ATTS VY+S+V+ F A +E  VLRDKFG +V   L+V  LAWP+ WVI+IGSF ST GAGLQSLTGAPRLLQAI++D ++PFL+VF      GEP  A  LT  I  +G+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRF+YYHWT S LG+ LC+ALMF+ SWYYALVA+ +AG IYKYIEYRGA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ +D+    + HP+L+   SQLKAG+GLTIVG+V+EG   D    +  A+E++ R +  +++KG  ++V++SN+ + +  L Q+ GLG L+HN V+V +P  W   + H  W+ F+  +R   A  LA+LV K +  FP    +               G++D+W IVHDGG+L+LL  LL   + W KC++R+F VA   DN+I +KK++  F+Y LRI A+VEVVE+ ++DISAY +++T+ +  R +IL+ M+L   + +RE Q+I D+            +I   +P          N  +  N P    EET  D +  P+E  + ++   +    S++               ++       T D + A+ +  P        SP +  G+K  FS     +N      RRMH+AVRLNE+I ++S +A L+L+N+PGP +N + D NYM+++E LT+ L RV+ VRG G+EVIT ++
Sbjct:   22 ESRRHSVADPRRLPREDVKGDGNPKESSPFINSTDTEKGREYDGRNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSKEHEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAEDASGEAAAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKSAFDPPNFPICLLGNRTLSRHG-FDVCAKLAWEGNETVTTRLWGLFC--SSRLLNATCDEYFTRNNVTEIQGIPGAASGLIKENLWSSYLT-KGVIVERRGMPSVGLADGTPVDMDHPYVFSDMTSYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACIEGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDGIVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQD-QNVVHPQLLSLTSQLKAGKGLTIVGSVLEGTFLDNHPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHLIQSGGLGGLQHNTVLVGWPRNWRQKEDHQTWRNFIELVRETTAGHLALLVTKNVSMFPGNPERFSE------------GSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTTFLYHLRITAEVEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDESR---------GSIRRKNP---------ANTRLRLNVP----EETACDNEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEK--VHLTWTKDKSAAQKNKGP--------SPVSSEGIKDFFSMKPEWENLNQSNVRRMHTAVRLNEVIVNKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEQLDRVMLVRGGGREVITIYS 1139          
BLAST of slc12a-4 vs. UniProt/SwissProt
Match: sp|Q9H2X9|S12A5_HUMAN (Solute carrier family 12 member 5 OS=Homo sapiens OX=9606 GN=SLC12A5 PE=1 SV=3)

HSP 1 Score: 933.324 bits (2411), Expect = 0.000e+0
Identity = 501/1167 (42.93%), Postives = 709/1167 (60.75%), Query Frame = 3
Query:  132 EKAAHYVVESKVENSENITKEATPLTDEEIEMSDDEEPAGD---SKFDLYEEEFHTRPPMANIFNKLAQYTG-------GIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIEL--DENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEP-------HLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            E   H V + +    E++  +  P        S D E   +       L+EEE  T P ++++ + LA YT          E  + E  K K   + ++GT +GVY PCLQNIFGV+ FLRL W++G++G    F +VF+CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ FY GTT A AMYI+G IE++L Y+ P  ++F   +   +   M NN RVYG  +L  M + VF+G+K+V+KF+ + L CV+ SIL +Y G+   A    +  +C+LG+R L+R    D  A   +   + +   L+ L+C   ++ LN    +YF  NNVTE   IPG    L+K+  + +Y T KG +    G           +D       SD+   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP G+I A ATTS VY+S+V+ F A +E  VLRDKFG +V   L+V  LAWP+ WVI+IGSF ST GAGLQSLTGAPRLLQAI++D ++PFL+VF      GEP  A  LT  I  +G+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRF+YYHWT S LG+ LC+ALMF+ SWYYALVA+ +AG IYKYIEYRGA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ +D+    + HP+L+   SQLKAG+GLTIVG+V+EG   +    +  A+E++ R +  +++KG  ++V++SN+ + +  L Q+ GLG L+HN V+V +P  W   + H  W+ F+  +R   A  LA+LV K +  FP    +               G++D+W IVHDGG+L+LL  LL   + W KC++R+F VA   DN+I +KK++  F+Y LRI A+VEVVE+ ++DISAY +++T+ +  R +IL+ M+L   + +RE Q+I D+            +I   +P          N  +  N P    EET  D +  P+E  + ++   +    S++               ++       T D + A  +  P        SP +  G+K  FS     +N      RRMH+AVRLNE+I  +S +A L+L+N+PGP +N + D NYM+++E LT+ L RV+ VRG G+EVIT ++
Sbjct:   22 ESRRHSVADPRHLPGEDVKGDGNPKESSPFINSTDTEKGKEYDGKNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSREHEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAEDASGEAAAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKSAFDPPNFPICLLGNRTLSRHG-FDVCAKLAWEGNETVTTRLWGLFC--SSRFLNATCDEYFTRNNVTEIQGIPGAASGLIKENLWSSYLT-KGVIVERSGMTSVGLADGTPIDMDHPYVFSDMTSYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACIEGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDGIVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQD-QNVVHPQLLSLTSQLKAGKGLTIVGSVLEGTFLENHPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHLIQSGGLGGLQHNTVLVGWPRNWRQKEDHQTWRNFIELVRETTAGHLALLVTKNVSMFPGNPERFSE------------GSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTTFLYHLRITAEVEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDESR---------GSIRRKNP---------ANTRLRLNVP----EETAGDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEK--VHLTWTKDKSVAEKNKGP--------SPVSSEGIKDFFSMKPEWENLNQSNVRRMHTAVRLNEVIVKKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEHLDRVMLVRGGGREVITIYS 1139          
BLAST of slc12a-4 vs. UniProt/SwissProt
Match: sp|Q63632|S12A4_RAT (Solute carrier family 12 member 4 OS=Rattus norvegicus OX=10116 GN=Slc12a4 PE=1 SV=1)

HSP 1 Score: 933.324 bits (2411), Expect = 0.000e+0
Identity = 515/1132 (45.49%), Postives = 688/1132 (60.78%), Query Frame = 3
Query:  252 DSKFDLYEEEFHTRPPMANIFNKLAQYTGGI-------EPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDE--NIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIG-IFVANPSRSLRVCMLGDRLLNR--------SVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACK-YFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSL---YGEPGKEPHLDKGQSPS---VSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            D    L+EEE   RP ++++  KL  YT          E  SGE  + +   +  +GT++GVY PCLQNIFGV+ FLRL W++G +G     +IV +CCC T+LT +SMSAIATNG VPAGGSYFMISRSLGPEFGG VG+ FY GTT AAAMYI+GAIE++L YI P A++F P    +  +   NN RVYG I L  M   VF+G+K+V+KF+++ LACV+ SIL +Y+G I  A       VCMLG+R L+R        +VV+D E   T          L+  +C   + +L  ++C  YF  NNVTE P IPG    +L++  + + Y  KG +   +G P  +  L   +S S   V+DI  SFT+L+GIFFPSVTGIMAGSNRSGDL + Q SIP+G+I A  TTS VY S+VI F A +E  VLRDK+G  V   L+V  LAWP+ WVI++GSF ST GAGLQSLTGAPRLLQAIA+DN+IPFL VF      GEP  A  LT  I+ LG+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRFKYYHW  S LG+ LC+ALMFVSSWYYALVA+ +AG IYKYIEY+GA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ LDE    + +P+L+ F SQLKAG+GLTIVG+VI+G   +   ++  A++T+   +  +++KG  ++VVAS V E +  L Q+ GLG +RHN V++ +P  W   +    WK F+ T+R   A+ LA+LVPK I            A  PS+    + G +D+W IVHDGG+L+LL  LL + + W KC +R+F VA   DN+I +KK++  F+Y LR+ A+VEVVE+  +DISAY ++RT+ +  R ++L  M L    TK                                               TE+  E  L +D H     ES+         S+ E   +   D   +   R    A P  D ++A     P+   E                    H        RRMH+AV+LNE+I +RS +A L+L+N+PGP KN   D NYM+++E LT+GL RVL VRG G+EVIT ++
Sbjct:   63 DRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGGRRRAAKAPSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFYPSGTHDMSSATLNNMRVYGTIFLTFMTLVVFVGVKYVNKFASLFLACVIISILSIYVGGIKSAFDPPVFPVCMLGNRTLSRDQFDICAKTVVVDNETVAT---------RLWTFFCH--SPNLTADSCDPYFLLNNVTEIPGIPGAAAGVLQENLW-SAYLEKGEVVEKHGLPSTDT-LGLKESLSLYVVADIATSFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIVTTSLVYFSSVILFGACIEGVVLRDKYGDGVSRNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKANGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFVSSWYYALVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDL-HVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLESYGEAQAAEQTIKNMMEIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQSEDPRAWKTFIDTVRCTTAAHLALLVPKNI------------AFYPSNHERYLEGHIDVWWIVHDGGMLMLLPFLLRQHKVWKKCRMRIFTVAQMDDNSIQMKKDLAIFLYHLRLEAEVEVVEMHNSDISAYTYERTLMMEQRSQMLRQMRL----TK-----------------------------------------------TERDREAQLVKDRHSALRLESL--------YSDEEDESVTGADKIQMTWTRDKYMAEP-WDPSHA-----PDNFRELV------------------HIKPDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPKNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1085          
BLAST of slc12a-4 vs. UniProt/SwissProt
Match: sp|Q9JIS8|S12A4_MOUSE (Solute carrier family 12 member 4 OS=Mus musculus OX=10090 GN=Slc12a4 PE=1 SV=2)

HSP 1 Score: 932.169 bits (2408), Expect = 0.000e+0
Identity = 515/1133 (45.45%), Postives = 691/1133 (60.99%), Query Frame = 3
Query:  252 DSKFDLYEEEFHTRPPMANIFNKLAQYTGGI-------EPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDE--NIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF--VANPSRSLRVCMLGDRLLNR--------SVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACK-YFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSL---YGEPGKEPHLDKGQSPS---VSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            D    L+EEE   RP ++++  KL  YT          E  SGE  + +   +  +GT++GVY PCLQNIFGV+ FLRL W++G +G     +IV +CCC T+LT +SMSAIATNG VPAGGSYFMISRSLGPEFGG VG+ FY GTT AAAMYI+GAIE++L YI P A++F P    +  +   NN RVYG I L +M   VF+G+K+V+KF+++ LACV+ SIL +Y G    + +P     VCMLG+R L+R        +VV+D E   T          L+  +C   + +L  ++C  YF  NNVTE P IPG    +L++  + + Y  KG +   +G P  +  L   +S S   V+DI  SFT+L+GIFFPSVTGIMAGSNRSGDL + Q SIP+G+I A  TTS VY S+VI F A +E  VLRDK+G  V   L+V  LAWP+ WVI++GSF ST GAGLQSLTGAPRLLQAIA+DN+IPFL VF      GEP  A  LT  I+ LG+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRFKYYHWT S LG+ LC+ALMFVSSWYYALVA+ +AG IYKYIEY+GA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ LDE    + +P+L+ F SQLKAG+GLTIVG+VI+G   +   ++  A++T+   +  +++KG  ++VVAS V E +  L Q+ GLG +RHN V++ +P  W   +    WK F+ T+R   A+ LA+LVPK I            A  PS+    + G +D+W IVHDGG+L+LL  LL + + W KC +R+F VA   DN+I +KK++  F+Y LR+ A+VEVVE+  +DISAY ++RT+ +  R ++L  M L    TK                                               TE+  E  L +D H     ES+         S+ E+  +   D   +   R    A P  D ++A     P+   E                    H        RRMH+AV+LNE+I +RS +A L+L+N+PGP KN   D NYM+++E LT+GL RVL VRG G+EVIT ++
Sbjct:   63 DRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGGRRRAAKAPSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFYPSGTHDMSSATLNNMRVYGTIFLTLMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSIFDPP-VFPVCMLGNRTLSRDQFDICAKTVVVDNETVAT---------RLWTFFCH--SPNLTADSCDPYFLLNNVTEIPGIPGAAAGVLQENLW-SAYLEKGEVVEKHGLPSTDT-LGLKESLSLYVVADIATSFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIVTTSLVYFSSVILFGACIEGVVLRDKYGDGVSRNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKANGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWTLSFLGMSLCLALMFVSSWYYALVAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDL-HVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLESYGEAQAAEQTIKNMMDIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQSEDPRAWKTFIDTVRCTTAAHLALLVPKNI------------AFYPSNHERYLDGHIDVWWIVHDGGMLMLLPFLLRQHKVWKKCRMRIFTVAQMDDNSIQMKKDLAIFLYHLRLEAEVEVVEMHNSDISAYTYERTLMMEQRSQMLRQMRL----TK-----------------------------------------------TERDREAQLVKDRHSALRLESL--------YSDEEEESVAGADKIQMTWTRDKYMAEP-WDPSHA-----PDNFRELV------------------HIKPDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPKNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1085          
BLAST of slc12a-4 vs. TrEMBL
Match: A0A0H3YK51 (Slc12a-4 OS=Schmidtea mediterranea OX=79327 GN=slc12a-4 PE=2 SV=1)

HSP 1 Score: 2295.78 bits (5948), Expect = 0.000e+0
Identity = 1121/1133 (98.94%), Postives = 1121/1133 (98.94%), Query Frame = 3
Query:  177 ENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFAE 3575
            ENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGLLLLLAHLLIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLK            QTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFAE
Sbjct:   11 ENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGLLLLLAHLLIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLK------------QTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFAE 1131          
BLAST of slc12a-4 vs. TrEMBL
Match: A0A5K4F357 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1201.42 bits (3107), Expect = 0.000e+0
Identity = 619/1145 (54.06%), Postives = 797/1145 (69.61%), Query Frame = 3
Query:  252 DSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEK----SSNK-LGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWAND--KSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSP-DLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDS----TPLQNQR---SVTFA-APTLDLNNARGDMAPEK----------INEFTFSP-----------GAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFAE 3575
            +++ +L+EE+  T PPM+N F KLA YTGGIEPT GETK+LKEK    S NK LGTILGV+ PC QNIFG+L F+R+ WI GV+G    F+IV +CC  TMLT LSMSAIATNGKVPAGGSYFMISRS+GP FGG VGILFY GTT+A+AMY++GA+EV LKYI P+ASLFG I  D   +FNNTRVYG ILL  +M CVF+GI+FVS+F+ +SLA VL SILCVY+G+F  NPSRS  VC LG RLL++  +     N T +C K+  GP+Y+ YC N  +   +E+C +F  NN++ FPA+PG       + FF+++Y  KG  Y           GQ P+++D+  SF +L+GI+FPSVTGIMAGSNRSGDL NPQ SIP+G+I A   TS VYLS+ + F+A  + +V+RDKFG S G  L+VA  AWP+ WVILIGS LST+GAGLQSLTGAPRLLQAIAQDNV+PFL+VFKV TKRGEPLRAQ L + I+ LG+LIASID + PLITMFFLMCYGFVNLAT LNGFL+EPSWRPRF++YHW  S +GL LCIALMF+SSWYY +VA ALA  IYKYIE+RGA+KEWGDATRG QMS AK+AIL+LG+KP+HTKNWRPQIL+ + LDE   +  H +L+D   QLKAG GLT+V +++EG++ D+++D I AK  L+  I+D +IKGL+E++VAS + E +K + Q +GLGNLRHN +MVS+PE+W  D   S  K  +F++TLR  QA D+A+LVPKGID FP  K              +M G VD+WCIVHDGGLLLL ++LL+R R W KC LR+FVVA+E+D+ + LKK++ +F+YDLRINA VEVV +  ADISAY  QRT  +  R+ +L  M + TV+ + + Q I+D+H   +          D +P D+  S     ++D H+  P      T    D  PD      N+  S   S    +   L PD+     P+ N     +V+FA    + ++ +     P++          INEFTFSP               G K ++  +  H  R T+T RR+H AVRLNE++R+ SS + L++VN+PGPS+   S+Y YM Y+ETLTDGL+R+L VRGTG+EVITAF+E
Sbjct:   54 NTQLNLFEEDDKTLPPMSNWFGKLAAYTGGIEPTVGETKQLKEKQTKSSDNKRLGTILGVFLPCCQNIFGILLFVRVGWITGVAGAFQTFLIVLLCCSCTMLTALSMSAIATNGKVPAGGSYFMISRSIGPAFGGAVGILFYLGTTIASAMYLVGAVEVFLKYIFPQASLFGDITSDA-ALFNNTRVYGTILLFTVMCCVFMGIRFVSRFAAVSLAAVLISILCVYLGVFTVNPSRSPYVCALGGRLLSQDFI---TVNGTAQCHKNTTGPIYEAYCNN-PEIATEESCAFFNANNISYFPAMPGLTSQKFFENFFESHYREKGKAYDNVDFPADRKYGQGPNIADVTSSFMLLLGIYFPSVTGIMAGSNRSGDLTNPQKSIPMGTILAITMTSLVYLSSPLLFAAICDGSVMRDKFGESYGGILLVAAFAWPHFWVILIGSCLSTIGAGLQSLTGAPRLLQAIAQDNVMPFLDVFKVITKRGEPLRAQLLCYGIAQLGILIASIDYLTPLITMFFLMCYGFVNLATMLNGFLKEPSWRPRFRFYHWFLSFVGLCLCIALMFISSWYYTIVAWALAFAIYKYIEFRGASKEWGDATRGLQMSTAKEAILKLGNKPIHTKNWRPQILVYLPLDEN-FQARHDRLLDLVYQLKAGHGLTLVASILEGDIIDRRNDMIAAKAHLSDLIQDHRIKGLAEVLVASTIDEGMKNMAQCAGLGNLRHNTLMVSYPEDWRVDCKSSGSKLSKFISTLRAAQACDIAMLVPKGIDSFPLSKGN------------QMIGNVDVWCIVHDGGLLLLTSYLLMRNRVWRKCHLRIFVVATEEDDIVNLKKDMTKFLYDLRINASVEVVAMSTADISAYVAQRTASIEQRRALLMQMKISTVEARCDPQLIVDQHRKPSSA--------DINPADIVKS---NCSIDSHKLLPAISATSTE-SSDQSPDHATNVTNTSSSDSASKEDTKPSNLKPDTESNDKPISNHSHHCTVSFATGSNVAVSESDKSTNPKENDANSELNRGINEFTFSPSNPLTKLVQKAAREAGSKEEYLLNKAHPGRITRTQRRLHCAVRLNELLRTHSSESDLVIVNMPGPSRTLGSEYYYMDYIETLTDGLSRILLVRGTGREVITAFSE 1168          
BLAST of slc12a-4 vs. TrEMBL
Match: A0A094ZXI2 (Solute carrier family 12 member 5 OS=Schistosoma haematobium OX=6185 GN=MS3_06245 PE=4 SV=1)

HSP 1 Score: 1192.56 bits (3084), Expect = 0.000e+0
Identity = 610/1139 (53.56%), Postives = 788/1139 (69.18%), Query Frame = 3
Query:  252 DSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSN-----KLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWAND--KSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHH------VAAGELTMMTNINDTSPDLP-FSPLPTINVDVHENQPTEKTEETVLD----EDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNA--RGDMAPEKINEFTFSP-----------GAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFAE 3575
            +++ +L+EE+  T PPM+N F KLA YTGGIEPT GETK+LKEK +      +LGTILGV+ PC QNIFG+L F+R+ WI GV+G    F+IVF+CC  TMLT LSMSAIATNGKVPAGGSYFMISRS+GP FGG VGILFY GTT+A+AMY++GA+EV LKYI P+ASLFG I  D   +FNNTRVYG ILL  +M CVF+GI+FVS+F+ +SLA VL SILCVY+G+F  NPSRS  VC LG RLL++  +     N T +C K+  GP+Y+ YC N  +   +E+C++F  NN++ FPA+PG       + FF+++Y  KG  Y           GQ P+++D+  SF +L+GI+FPSVTGIMAGSNRSGDL NPQ SIPLG+I A   TS VYLS+ + F+A  + +V+RDKFG S G  L+VA  AWP+ WVILIGS LST+GAGLQSLTGAPRLLQAIAQDNV+PFL+VFKV TKRGEPLRAQ L + I+ LG+LIASID + PLITMFFLMCYGFVNLA+ LNGFL+EPSWRPRF++YHW  S +GL LCIALMF+SSWYY +VA ALA  IYKYIE+RGA+KEWGDATRG QMS AK+AIL+LG+KP+HTKNWRPQIL+ + LDE   +  H +L+D   QLKAG GLT+V +++EG++ D+++D I  K  L+  I+  +IKGL+E++VAS + E +K + Q +GLGNLRHN +MVS+PE+W  D   S  K  +F++TLR  QA D+A+LVPKGID FP  K              +M G VD+WCIVHDGGLLLL ++LL+R R W KC LR+FVVA+E D+ + LKK++ +F+YDLRINA VEVV +  ADISAY  QRT  +  R+ +L  M +  V+ + + Q I+D+H       +   ++       D+   LP  S   T + D   +  T  T  +  D    ED  P   K    S+   + + +   T+     S    ++   +      D N+   RG      INEFTFSP               G K +   +  H  + T+T RR+H AVRLNE++R+ SS + L++VN+PGPS+   S+Y YM Y+ETLTDGL+R+L VRGTG+EVITAF+E
Sbjct:   54 NTQLNLFEEDDKTLPPMSNWFGKLAAYTGGIEPTVGETKQLKEKQTKSCDNKRLGTILGVFLPCCQNIFGILLFVRVGWITGVAGAFQTFLIVFLCCSCTMLTALSMSAIATNGKVPAGGSYFMISRSIGPAFGGAVGILFYLGTTIASAMYLVGAVEVFLKYIFPQASLFGDITSDA-ALFNNTRVYGTILLFTVMCCVFMGIRFVSRFAAVSLAAVLISILCVYLGVFTVNPSRSPYVCALGGRLLSQDFI---TVNGTAQCHKNTTGPIYEAYCNN-REIATEESCEFFNANNISYFPAMPGLTSKKFFENFFESHYREKGEAYDSIDFPADRKYGQGPNIADVTSSFMLLLGIYFPSVTGIMAGSNRSGDLTNPQKSIPLGTILAITMTSLVYLSSPLLFAAICDGSVMRDKFGESYGGILLVAAFAWPHFWVILIGSCLSTIGAGLQSLTGAPRLLQAIAQDNVMPFLDVFKVITKRGEPLRAQLLCYGIAQLGILIASIDHLTPLITMFFLMCYGFVNLASMLNGFLKEPSWRPRFRFYHWFLSFVGLCLCIALMFISSWYYTIVAWALAFAIYKYIEFRGASKEWGDATRGLQMSTAKQAILKLGNKPIHTKNWRPQILVYLPLDEN-FQARHDRLLDLVYQLKAGHGLTLVASILEGDIIDRRNDMIAVKSHLSDLIQQHRIKGLAEVLVASTIDEGMKNMAQCAGLGNLRHNTLMVSYPEDWRVDCKSSGSKLSKFISTLRAAQACDIAMLVPKGIDSFPLSKGN------------QMIGNVDVWCIVHDGGLLLLTSYLLMRNRVWRKCHLRIFVVATEDDDIVNLKKDMTKFMYDLRINASVEVVAMSTADISAYVTQRTASIEQRRALLMQMKISNVEARCDPQLIVDQHRKPSSVDINPADIIKSNCSIDSHKLLPAISATSTESSDQSPDHATNVTNTSSSDSASKEDTKPSNMKPDTESNNKSISNHSHHCTVSFATGSNVAVSESDKSTNPKENDTNSELNRG------INEFTFSPSNPLTKLVQKAAKEAGSKEEHLLNKAHPGKITRTQRRLHCAVRLNELLRTHSSESDLVIVNMPGPSRTLGSEYYYMDYIETLTDGLSRILLVRGTGREVITAFSE 1168          
BLAST of slc12a-4 vs. TrEMBL
Match: A0A4Z2DI78 (Solute carrier family 12 member 5 OS=Schistosoma japonicum OX=6182 GN=EWB00_000672 PE=4 SV=1)

HSP 1 Score: 1181.78 bits (3056), Expect = 0.000e+0
Identity = 612/1133 (54.02%), Postives = 781/1133 (68.93%), Query Frame = 3
Query:  300 MANIFNKLAQYTGGIEPTSGETKKLKEKSSN-----KLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWAND--KSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDE--------NKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAA--------PTLDLNNARGDMAPEKINEFTFSPG------------------AMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFAE 3575
            M+N F KLA YTGGIEPT GETK+L+EK +      +LGTILGV+ PC QNIFG+L F+R+ WI GV+G    F+IV +CC  TMLT LSMSAIATNGKVPAGGSYFMISRS+GP FGG VGILFY GTT+A+AMY++GA+EV LKYI P+ASLFG I  D   +FNNTRVYG ILL I+M CVF+GI+FVS+F+ +SLA VL SI+CVY+GIF  N SRS  VC LG RLL++  V     N T  C K++ GP+Y +YC N  +   DE+C +F  NN++ FPA+PG       + F Q+YY  KG  Y           GQ P+++D+  SF +L+GI+FPSVTGIMAGSNRSGDL NPQ SIPLG+I A A TSFVYLS+ + F+A  + +V+RDKFG S G  L+VA  AWP+ WVILIGS LST+GAGLQSLTGAPRLLQAIAQDNV+PFL VFKV TKRGEPLRAQ L + I+ LG+LIASID + PLITMFFLMCYGFVNLAT LNGFL+EPSWRPRF++YHW  S +GL LCIALMF+SSWYY +VA ALA  IYKYIE+RGA+KEWGDATRG QMS AK+AIL+LG+KP+HTKNWRPQIL+ + LDE   +  H +L+D   QLKAG GLT+V +++EG++ ++++D I AK  L+  I++ +IKGL+E++VAS V E +K + Q +GLGNLRHN +MVSFPE+W  D  +S  K  +F++TLR  QA D+A+LVPKGID FP  K              +MTG VD+WCIVHDGGLLLL ++LL+R R W KC LR+FVVA+E D+T+ L+K++ +F+YDLRINA VEVV +   D+SAY  QRT  +  R+ +L  M +  V  + + Q I+D+H          ++ +   PD+  S     +++ H+  P      T    D  PD         +KES     +K  +  T+    +  DS  L +  +V+FA         P    NN   +     INEFTFSP                    +   K +   +  H  + TKT RR+H AVRLNE++R+ SS++ L++VN+PGPS+   S+Y YM Y+ETLTDGL R+L VRGTG+EVITAF+E
Sbjct:    1 MSNWFGKLAAYTGGIEPTVGETKQLREKQTKSNDNKRLGTILGVFLPCCQNIFGILLFVRVGWITGVAGALQTFLIVLLCCSCTMLTALSMSAIATNGKVPAGGSYFMISRSIGPAFGGAVGILFYLGTTIASAMYLVGAVEVFLKYIFPQASLFGDITSDA-ALFNNTRVYGTILLFIVMCCVFMGIRFVSRFAAVSLAAVLISIICVYLGIFTVNSSRSPFVCALGGRLLSQDFV---TVNGTVECHKNVTGPIYDVYCSN-PETATDESCAFFNANNISYFPAMPGLTSKKFFENFLQSYYREKGQAYDNIDFPADRKYGQGPNIADVTSSFMLLLGIYFPSVTGIMAGSNRSGDLTNPQKSIPLGTILAIAMTSFVYLSSPLLFAAICDGSVMRDKFGESYGGILLVAAFAWPHFWVILIGSCLSTIGAGLQSLTGAPRLLQAIAQDNVMPFLNVFKVITKRGEPLRAQLLCYGIAQLGILIASIDHLTPLITMFFLMCYGFVNLATMLNGFLKEPSWRPRFRFYHWFLSFIGLCLCIALMFISSWYYTIVAWALAFAIYKYIEFRGASKEWGDATRGLQMSTAKQAILKLGNKPIHTKNWRPQILVYLPLDEN-FQARHDRLLDLVYQLKAGHGLTLVASILEGDIIERRNDMIAAKAHLSDLIQEHRIKGLAEVLVASTVDEGMKNMAQCAGLGNLRHNTLMVSFPEDWRIDCKRSGSKLSKFISTLRAAQACDIAMLVPKGIDSFPLSKGN------------QMTGNVDVWCIVHDGGLLLLTSYLLMRNRVWRKCHLRIFVVATEDDDTVNLQKDMTKFMYDLRINASVEVVAMSTVDVSAYITQRTASIEQRRALLMQMKITNVQARCDPQLIVDQHRKP-------SSADIYQPDIVKS---NCSIESHKILPAISAASTE-SSDQSPDHATNLTNTSSKESALKECTKPSNLKTDTEPNIKSDSD-LSHHCTVSFATGSTAAVNDPDKSTNNRPENDTNHGINEFTFSPSNPLTKLVQKAAREAAITNNVTSPKEEHLSNKTHPGKITKTQRRLHCAVRLNELLRNHSSDSVLVIVNMPGPSRTLGSEYYYMDYIETLTDGLPRILLVRGTGREVITAFSE 1103          
BLAST of slc12a-4 vs. TrEMBL
Match: A0A4V3SEW3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005496 PE=4 SV=1)

HSP 1 Score: 1177.16 bits (3044), Expect = 0.000e+0
Identity = 610/1154 (52.86%), Postives = 794/1154 (68.80%), Query Frame = 3
Query:  261 FDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSN-----KLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWAND--KSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHH--VAAGEL--TMMTNINDTSPDLPFSPLPTIN---VDVHENQPT-EKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFA----------------APTLDLNNARGDMAPEK-INEFTFSPGAMHGLKFDFSPSLGHKN-----------------RQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFAE 3575
              L+E+E  T  PM+N F KLA YTGGIEPT  ETK+L++K +      +LGT+LGV+ PC QNIFG+L F+R+ WI GV+G    F+IV +CC  TMLT LSMSAIATNGKVPAGGSYFMISRS+GPEFGG VG+LFY GTTVA+AMY++GA+EV LKY+ P+ASLFG I  D   +FNNTR+YG ILL ++M CV +GIKFVS+F+ I L  VLCSI+CVY+GIF+ NP+RS  VC LG RLL++  ++    N T+ C+K+  GP+++ YC N  +   +E+C +F  +N++ FPA+PG       + F  +YY  KG  Y +    P  + GQ P+V+D+  SF IL+ I+FPSVTGIMAGSNRSGDLANPQ SIPLG+I A   TSF YLSA +FFSA  +  V+RDKFG S G GL+VA  AWP+ WV+L+G+ LST+GAGLQ LTGAPRLLQAIAQDNV+P L  FKVTT+RGEPLRAQ +++ I+ LG+LIASIDS+ PLITMFFLMCYGFVNLAT LNGFL+EPSWRPRF+  HW  SL+GL LCIALMF+SSWYY +VA A+AG IYKYIEYRGA+KEWGDATRGFQMS A +AIL+LG KP+HTKNWRPQ+L+ + +D+   +  H  L+D   QLKAG GLT+V  +IEG++ ++  D+  AK TL   I+  +IKGL E++V+S + E +K + Q +GLGNLRHN +MVSFPE+W  D  +   K  QF++T++  QA D+A+LV KGID FP  KSK +          +M G+VD+WCIVHDGGLLLL ++LL+R R W KC+LRVFVVASE D+T+ LKK++ +F+YDLRINA V+VV +  ADISAY  QRT ++  R+++L  M L     + + Q I+D+H   ++ GE     + N    +   P + LP I    +    N P+ E   E+ +DE  H    ++ + S+I  L    T        DS     Q SVTFA                +P  D N+   +  P + +NEFTFSP      K   + +L  K                  +++K  RRMHSA RLNE++R+ SS+A L++VN+P PS++  S+Y YM Y+E LT+GL RVL VRGTG+EVITAF+E
Sbjct:   57 LQLFEDEHKTLTPMSNWFGKLAAYTGGIEPTVDETKQLRDKQAKSSERKRLGTVLGVFLPCCQNIFGILLFVRVGWITGVAGALQSFLIVLMCCSCTMLTALSMSAIATNGKVPAGGSYFMISRSIGPEFGGAVGLLFYLGTTVASAMYLVGAVEVFLKYMCPQASLFGDITSD-TALFNNTRIYGTILLILVMCCVLLGIKFVSRFAAIGLVAVLCSIICVYLGIFIVNPARSPYVCALGGRLLSQEFLV---VNGTYDCSKNETGPIHQAYCAN-PETATEESCAFFHNSNLSYFPAMPGISSTKFFENFLPSYYRKKGEAYDDIPFPPKREYGQGPNVADVTTSFMILLAIYFPSVTGIMAGSNRSGDLANPQVSIPLGTITAITVTSFFYLSAPLFFSAICDGAVMRDKFGESYGGGLLVAAFAWPHYWVVLVGTCLSTIGAGLQCLTGAPRLLQAIAQDNVMPMLNPFKVTTRRGEPLRAQLVSYGIAQLGILIASIDSLTPLITMFFLMCYGFVNLATMLNGFLREPSWRPRFRLSHWFLSLIGLGLCIALMFISSWYYTIVAWAIAGAIYKYIEYRGASKEWGDATRGFQMSTATRAILKLGIKPIHTKNWRPQLLVYLPVDDNL-QFRHLGLLDLVHQLKAGHGLTLVVCIIEGDVVERHEDATNAKNTLAELIQQHRIKGLPEVLVSSTISEGMKNMAQCAGLGNLRHNTLMVSFPEDWRADCEQGGRKLSQFISTVKSAQACDVAMLVAKGIDSFP--KSKAE----------QMEGSVDVWCIVHDGGLLLLTSYLLMRNRVWRKCDLRVFVVASEGDDTVNLKKDMTKFMYDLRINAAVDVVAMSTADISAYVAQRTANIEQRREMLMQMKLANTAARYDPQVIVDQHRKSLSGGEPEDVRLPNAGKEATVRPVNELPNIPKVVIAPDSNGPSNEAPPESGVDE-AHKGRPRDELLSNIPLLSQGTTG-------DSEKSSLQCSVTFASGPGPAASARERFLNGSPEGDKNSNLLNTEPNRQLNEFTFSPSHPLARKVAEAAALTAKTNLGNQTSVPPTTPGGGPKRSKMERRMHSAARLNELLRTHSSDADLVIVNMPTPSRSPGSEYYYMDYIEALTEGLTRVLLVRGTGREVITAFSE 1184          
BLAST of slc12a-4 vs. Ensembl Cavefish
Match: slc12a5a (solute carrier family 12 member 5 [Source:NCBI gene;Acc:103035347])

HSP 1 Score: 929.087 bits (2400), Expect = 0.000e+0
Identity = 506/1162 (43.55%), Postives = 705/1162 (60.67%), Query Frame = 3
Query:  189 KEATPLTDEEIEMSDDEEPAGDSKFD-----LYEEEFHTRPPMANIFNKLAQYTG-------GIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELD----ENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPS------VSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILD--------KHHVAAG-ELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNAR--GDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            KE++P  +         +P    ++D     L+EEE  T P ++++ + LA Y+          E  + E  + K   + ++GT++GVY PCLQNI GV+ FLR+ W++G+ G    FVIV +CC +TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VGI FY GTT A AMYI+G IE++L YIVP+A++F    L+    E  M NN RVYG ++L  M   VF+G+++V+K + + LACV+ SIL VY G+   A       VC LG+R L      D  A    R    +   L++++C   ++ LN     YF  NNVTE   IPG    +LK+  F  Y   KG    + G   +L+  + P+      ++DI   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP+G+I A  TTSF+Y+S+V+ F A +E TVLRDKFG +V   L++  LAWP+ WVI+ GSF ST GAGLQSLTGAPRLLQAIA+D ++PFL VF      GEP  A  LT  I   G+LIAS+DS+AP+++MFFLMCY FVNLA AL   L+ P+WRPRFK+YHW  S LG+ LC++LMF+ SWYYA+VA+A+A  IYKYIE+RGA KEWGD  RG  +SAA+ A+++L + P HTKNWRPQIL+L+N+D     +  P+L+   +QLKAG+GLTIVGT + G   +    +  A+++L + +  +++KG  ++VV+SN+ +A   L Q SGLG L+HN V+VS+P  W   + H  W+ F+  +R   A+  A+LVPK I  F            PS+G     G +D+W IVHDGG+L+LL  LL + + W KC++R+F VA   DN+I +KK++  F+Y LRI+AQVEVVE+  +DISAY +++T+ +  R +IL+ +NL   + +RE Q+I D        K+  A   +L++      +S +        +  D   N PT  T ++   E   P                            ST +Q    +T+     D   A+  G   PE I +            F+  P   + N+     RRMH+A+RLN  I  +S  A L+L+N+PGP KN + D NYM+++E LT+GL RVL VRG G+EVIT ++
Sbjct:   34 KESSPFIN-------SSDPEKSQQYDGKNMALFEEEMDTSPMVSSLLSSLANYSNLPQGSKEHEEAENNEGTRKKPVQAPRMGTLMGVYLPCLQNILGVILFLRMTWMVGIGGVIEAFVIVLMCCSTTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGICFYLGTTYAGAMYILGCIEILLIYIVPQAAIFKMEGLEGSEAEAAMLNNMRVYGSLVLTFMAIVVFVGVRYVNKLALVFLACVISSILAVYAGVIKTAFEPPLFPVCTLGNRTLVWKG-FDVCAKVIERDNATVTTKLWRMFC--DSEFLNATCDTYFSNNNVTEIQGIPGVTSGILKENLFSTYLE-KGMFLEKKGLSTYLEPDEIPTNSNRYVLADISTFFTMLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPIGTILAITTTSFIYMSSVVLFGACIEGTVLRDKFGEAVRGNLVIGTLAWPSPWVIVFGSFFSTCGAGLQSLTGAPRLLQAIARDGIVPFLRVFGHGKANGEPTWALLLTAVICESGILIASLDSVAPILSMFFLMCYMFVNLACALQTLLRTPNWRPRFKFYHWALSFLGMSLCLSLMFICSWYYAIVAMAIASCIYKYIEFRGAEKEWGDGIRGLSLSAARFALMRLEEGPPHTKNWRPQILVLVNVDAE-QNVEQPRLLSLTNQLKAGKGLTIVGTALAGTFLENHPQAQQAEQSLKKIMETEKVKGFCQVVVSSNIRDATSHLVQASGLGGLQHNTVLVSWPRNWKQAEDHQLWRNFIELVRETTAASKALLVPKNIAAF------------PSNGERFTEGHIDVWWIVHDGGMLMLLPFLLRQNKVWRKCKMRIFTVAQMDDNSIQMKKDLTTFLYHLRIDAQVEVVEMQDSDISAYTYEKTLVMEQRSQILKQINLTKTEREREIQSITDSSRGSIRRKNPAAVNTQLSVTEEPAASSKEEKPEEEEQLIHDKSTNPPTPATPQSPAAEAETP----------------------------STVVQ----MTWTEAKCDGEQAKPLGATTPEAIKDL-----------FNMKPEWENLNQFNV--RRMHTALRLNSEIVKKSQEAKLVLLNMPGPPKNRTGDENYMEFLEVLTEGLNRVLLVRGGGREVITIYS 1126          
BLAST of slc12a-4 vs. Ensembl Cavefish
Match: slc12a7b (solute carrier family 12 member 7-like [Source:NCBI gene;Acc:103031657])

HSP 1 Score: 927.546 bits (2396), Expect = 0.000e+0
Identity = 498/1157 (43.04%), Postives = 710/1157 (61.37%), Query Frame = 3
Query:  156 ESKVENSENITKEATPLTDEEIEMSDDEEPAGDSK-FDLYEEEFHTRPPMANIFNKLAQYTG---GIEPTSGETKKLKEKS----SNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIE--LDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF--VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNY----YTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLK--FDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            ES     +   KE++P  +      +D     D K   L+EEE  + P ++++ +KLA YT    G+       ++   K     S ++GT +GVY PCLQNI GV+ FLR+ WI+G +G    F+IV +CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ FY GTT A AMYI+G IE++L YIVP A++F   +   +   M NN RVYG   L +M   VF+G+K+V+K + + LACV+ SIL +Y G+   +  P     VC+LG+R L ++   DK A         +   L+ L+C   + +LN    +YF  NNVTE P IPG    ++ +  + +Y       + ++      E   D      V+DI   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP+G+I A ATT+ +YLS V+ F A ++  VLRDKFG SV   L++  L+WP+ WVI+IGSF S  GAGLQSLTGAPRLLQAIA+D ++PFLEVF      GEP  A  LT  I   G+LIAS+D++AP+++MFFLMCY FVNLA AL   L+ P+WRPRFKYYHW  S LG+ LC+ALMF+SSWYYALVA+ +AG IYKYIEYRGA KEWGD  RG  ++AA+ A+++L + P HTKNWRPQ+L+L+NLD    ++ HP+L+ F +QLKAG+GLTIVG+V+EG    K S++  A++ +  A+  ++ KG   +VV+SN+ + I  L Q++GLG ++HN V++++P  W      + WK F+ T+R   A+ LA+LV K +D FP+++   +             GT+D+W IVHDGG+L+LL  LL + + W KC++R+F VA   DN+I +KK++  F+Y LR++A+VEVVE+ ++DISA+ +++T+ +  R ++L+ M L   + +RE Q+I D+        + +   N T      S           NQ               P E+++   + +   K++ +   L    D+TP +   + T      + N  R              P    G++  F+  P     N+     RRMH+AV+LNE++ ++S  A L+L+N+PGP KN   D NYM+++E L +GL RVL VRG G+EVIT ++
Sbjct:    5 ESSRRQGDGNPKESSPFINNT---DNDRGTLYDGKNMALFEEEMDSNPMVSSLLSKLANYTNLTQGVREHEEADEEEGAKKQTVKSPQMGTFIGVYLPCLQNILGVILFLRMTWIVGTAGILEAFIIVAMCCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLTYIVPSAAIFKAEDKAYEAEAMLNNMRVYGTCCLTLMALVVFVGVKYVNKLALVFLACVVLSILAIYAGVIKTIFEPP-VFPVCLLGNRTL-KNHGFDKCAKTDIIGNVTVTTKLWSLFC--DSPELNSTCNEYFTLNNVTEIPGIPGLTSGVISENMWSSYGPAGMLVEKAIDAMEASETTRDVNLPYVVNDIATFFTLLVGIYFPSVTGIMAGSNRSGDLRDAQRSIPIGTILAIATTTIIYLSCVVLFGACIDGVVLRDKFGDSVRGNLVIGTLSWPSPWVIVIGSFFSCCGAGLQSLTGAPRLLQAIARDGIVPFLEVFGHGKANGEPTWALLLTAGICETGILIASLDAVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFISSWYYALVAMLIAGCIYKYIEYRGAEKEWGDGIRGISLNAARYALIRLEEAPPHTKNWRPQLLVLLNLDSEL-RVKHPRLLSFTTQLKAGKGLTIVGSVLEGTYLTKDSEAKKAEQNIKTAMATERTKGFCHVVVSSNLRDGISHLIQSAGLGGMKHNSVLMAWPGSWKQSNDPLSWKNFIETVRETTAAHLALLVAKNVDSFPHQERLGE-------------GTIDVWWIVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQMDDNSIQMKKDLQMFLYHLRLDAEVEVVEMHESDISAFTYEKTLVMEQRSQMLKQMQLSRTEREREIQSITDESR------SSIRRKNQTGAQCSGS----------SNQ-------------GAPLEDEKDNEAQLIHDKNTASHAALNDKADATPDRVHMTWTKEKLFTERNRNR-------------EPNTNMGVRDLFNMKPEWESLNQSNV--RRMHTAVKLNEVVVNKSQGAQLVLLNMPGPPKNRGGDENYMEFLEVLLEGLNRVLLVRGGGREVITIYS 1096          
BLAST of slc12a-4 vs. Ensembl Cavefish
Match: slc12a5a (solute carrier family 12 member 5 [Source:NCBI gene;Acc:103035347])

HSP 1 Score: 926.391 bits (2393), Expect = 0.000e+0
Identity = 502/1156 (43.43%), Postives = 704/1156 (60.90%), Query Frame = 3
Query:  189 KEATPLTDEEIEMSDDEEPAGDSKFD-----LYEEEFHTRPPMANIFNKLAQYTG-------GIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELD----ENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPS------VSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVA---AGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNAR--GDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            KE++P  +         +P    ++D     L+EEE  T P ++++ + LA Y+          E  + E  + K   + ++GT++GVY PCLQNI GV+ FLR+ W++G+ G    FVIV +CC +TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VGI FY GTT A AMYI+G IE++L YIVP+A++F    L+    E  M NN RVYG ++L  M   VF+G+++V+K + + LACV+ SIL VY G+   A       VC LG+R L      D  A    R    +   L++++C   ++ LN     YF  NNVTE   IPG    +LK+  F  Y   KG    + G   +L+  + P+      ++DI   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP+G+I A  TTSF+Y+S+V+ F A +E TVLRDKFG +V   L++  LAWP+ WVI+ GSF ST GAGLQSLTGAPRLLQAIA+D ++PFL VF      GEP  A  LT  I   G+LIAS+DS+AP+++MFFLMCY FVNLA AL   L+ P+WRPRFK+YHW  S LG+ LC++LMF+ SWYYA+VA+A+A  IYKYIE+RGA KEWGD  RG  +SAA+ A+++L + P HTKNWRPQIL+L+N+D     +  P+L+   +QLKAG+GLTIVGT + G   +    +  A+++L + +  +++KG  ++VV+SN+ +A   L Q SGLG L+HN V+VS+P  W   + H  W+ F+  +R   A+  A+LVPK I  F            PS+G     G +D+W IVHDGG+L+LL  LL + + W KC++R+F VA   DN+I +KK++  F+Y LRI+AQVEVVE+  +DISAY +++T+ +  R +IL+ +NL   + +RE Q+I D    +        + T ++ T      S       +     P  + E+ + D+  +P           S    + T  T++             +T+     D   A+  G   PE I +            F+  P   + N+     RRMH+A+RLN  I  +S  A L+L+N+PGP KN + D NYM+++E LT+GL RVL VRG G+EVIT ++
Sbjct:   24 KESSPFIN-------SSDPEKSQQYDGKNMALFEEEMDTSPMVSSLLSSLANYSNLPQGSKEHEEAENNEGTRKKPVQAPRMGTLMGVYLPCLQNILGVILFLRMTWMVGIGGVIEAFVIVLMCCSTTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGICFYLGTTYAGAMYILGCIEILLIYIVPQAAIFKMEGLEGSEAEAAMLNNMRVYGSLVLTFMAIVVFVGVRYVNKLALVFLACVISSILAVYAGVIKTAFEPPLFPVCTLGNRTLVWKG-FDVCAKVIERDNATVTTKLWRMFC--DSEFLNATCDTYFSNNNVTEIQGIPGVTSGILKENLFSTYLE-KGMFLEKKGLSTYLEPDEIPTNSNRYVLADISTFFTMLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPIGTILAITTTSFIYMSSVVLFGACIEGTVLRDKFGEAVRGNLVIGTLAWPSPWVIVFGSFFSTCGAGLQSLTGAPRLLQAIARDGIVPFLRVFGHGKANGEPTWALLLTAVICESGILIASLDSVAPILSMFFLMCYMFVNLACALQTLLRTPNWRPRFKFYHWALSFLGMSLCLSLMFICSWYYAIVAMAIASCIYKYIEFRGAEKEWGDGIRGLSLSAARFALMRLEEGPPHTKNWRPQILVLVNVDAE-QNVEQPRLLSLTNQLKAGKGLTIVGTALAGTFLENHPQAQQAEQSLKKIMETEKVKGFCQVVVSSNIRDATSHLVQASGLGGLQHNTVLVSWPRNWKQAEDHQLWRNFIELVRETTAASKALLVPKNIAAF------------PSNGERFTEGHIDVWWIVHDGGMLMLLPFLLRQNKVWRKCKMRIFTVAQMDDNSIQMKKDLTTFLYHLRIDAQVEVVEMQDSDISAYTYEKTLVMEQRSQILKQINLTKTEREREIQSITDSSRGSIRRKNPAAVNTQLSVTEEPAASSKEEKPEEECATVSPPPQ-EQLIHDKSTNPPTPATPQ----SPAAEAETPSTVV------------QMTWTEAKCDGEQAKPLGATTPEAIKDL-----------FNMKPEWENLNQFNV--RRMHTALRLNSEIVKKSQEAKLVLLNMPGPPKNRTGDENYMEFLEVLTEGLNRVLLVRGGGREVITIYS 1125          
BLAST of slc12a-4 vs. Ensembl Cavefish
Match: slc12a7b (solute carrier family 12 member 7-like [Source:NCBI gene;Acc:103031657])

HSP 1 Score: 926.006 bits (2392), Expect = 0.000e+0
Identity = 497/1146 (43.37%), Postives = 708/1146 (61.78%), Query Frame = 3
Query:  189 KEATPLTDEEIEMSDDEEPAGDSK-FDLYEEEFHTRPPMANIFNKLAQYTG---GIEPTSGETKKLKEKS----SNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIE--LDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF--VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNY----YTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLK--FDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            KE++P  +      +D     D K   L+EEE  + P ++++ +KLA YT    G+       ++   K     S ++GT +GVY PCLQNI GV+ FLR+ WI+G +G    F+IV +CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ FY GTT A AMYI+G IE++L YIVP A++F   +   +   M NN RVYG   L +M   VF+G+K+V+K + + LACV+ SIL +Y G+   +  P     VC+LG+R L ++   DK A         +   L+ L+C   + +LN    +YF  NNVTE P IPG    ++ +  + +Y       + ++      E   D      V+DI   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP+G+I A ATT+ +YLS V+ F A ++  VLRDKFG SV   L++  L+WP+ WVI+IGSF S  GAGLQSLTGAPRLLQAIA+D ++PFLEVF      GEP  A  LT  I   G+LIAS+D++AP+++MFFLMCY FVNLA AL   L+ P+WRPRFKYYHW  S LG+ LC+ALMF+SSWYYALVA+ +AG IYKYIEYRGA KEWGD  RG  ++AA+ A+++L + P HTKNWRPQ+L+L+NLD    ++ HP+L+ F +QLKAG+GLTIVG+V+EG    K S++  A++ +  A+  ++ KG   +VV+SN+ + I  L Q++GLG ++HN V++++P  W      + WK F+ T+R   A+ LA+LV K +D FP+++   +             GT+D+W IVHDGG+L+LL  LL + + W KC++R+F VA   DN+I +KK++  F+Y LR++A+VEVVE+ ++DISA+ +++T+ +  R ++L+ M L   + +RE Q+I D+        + +   N T      S         ++  P E  ++  + +  H D+N  S  +   K  +         TPD   +   +   F     + N  R              P    G++  F+  P     N+     RRMH+AV+LNE++ ++S  A L+L+N+PGP KN   D NYM+++E L +GL RVL VRG G+EVIT ++
Sbjct:   69 KESSPFINNT---DNDRGTLYDGKNMALFEEEMDSNPMVSSLLSKLANYTNLTQGVREHEEADEEEGAKKQTVKSPQMGTFIGVYLPCLQNILGVILFLRMTWIVGTAGILEAFIIVAMCCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLTYIVPSAAIFKAEDKAYEAEAMLNNMRVYGTCCLTLMALVVFVGVKYVNKLALVFLACVVLSILAIYAGVIKTIFEPP-VFPVCLLGNRTL-KNHGFDKCAKTDIIGNVTVTTKLWSLFCD--SPELNSTCNEYFTLNNVTEIPGIPGLTSGVISENMWSSYGPAGMLVEKAIDAMEASETTRDVNLPYVVNDIATFFTLLVGIYFPSVTGIMAGSNRSGDLRDAQRSIPIGTILAIATTTIIYLSCVVLFGACIDGVVLRDKFGDSVRGNLVIGTLSWPSPWVIVIGSFFSCCGAGLQSLTGAPRLLQAIARDGIVPFLEVFGHGKANGEPTWALLLTAGICETGILIASLDAVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFISSWYYALVAMLIAGCIYKYIEYRGAEKEWGDGIRGISLNAARYALIRLEEAPPHTKNWRPQLLVLLNLDSEL-RVKHPRLLSFTTQLKAGKGLTIVGSVLEGTYLTKDSEAKKAEQNIKTAMATERTKGFCHVVVSSNLRDGISHLIQSAGLGGMKHNSVLMAWPGSWKQSNDPLSWKNFIETVRETTAAHLALLVAKNVDSFPHQERLGE-------------GTIDVWWIVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQMDDNSIQMKKDLQMFLYHLRLDAEVEVVEMHESDISAFTYEKTLVMEQRSQMLKQMQLSRTEREREIQSITDESR------SSIRRKNQTGAQCSGSS--------NQGAPLEDEKDNEVAQLIH-DKNTASHAALNDKADA---------TPDRVHMTWTKEKLFT----ERNRNR-------------EPNTNMGVRDLFNMKPEWESLNQSNV--RRMHTAVKLNEVVVNKSQGAQLVLLNMPGPPKNRGGDENYMEFLEVLLEGLNRVLLVRGGGREVITIYS 1150          
BLAST of slc12a-4 vs. Ensembl Cavefish
Match: slc12a5a (solute carrier family 12 member 5 [Source:NCBI gene;Acc:103035347])

HSP 1 Score: 924.465 bits (2388), Expect = 0.000e+0
Identity = 505/1162 (43.46%), Postives = 704/1162 (60.59%), Query Frame = 3
Query:  189 KEATPLTDEEIEMSDDEEPAGDSKFD-----LYEEEFHTRPPMANIFNKLAQYTG-------GIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELD----ENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF-VANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPS------VSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILD--------KHHVAAG-ELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNAR--GDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            KE++P  +         +P    ++D     L+EEE  T P ++++ + LA Y+          E  + E  + K   + ++GT++GVY PCLQNI GV+ FLR+ W++G+ G    FVIV +CC +TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VGI FY GTT A AMYI+G IE++L YIVP+A++F    L+    E  M NN RVYG ++L  M   VF+G+++V+K + + LACV+ SIL VY G+   A       VC LG+R L      D  A    R    +   L++++C   ++ LN     YF  NNVTE   IPG    +LK+  F  Y   KG    + G   +L+  + P+      ++DI   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP+G+I A  TTSF+Y+S+V+ F A +E TVLRDKFG +V   L++  LAWP+ WVI+ GSF ST GAGLQSLTGAPRLLQAIA+D ++PFL VF      GEP  A  LT  I   G+LIAS+DS+AP+++MFFLMCY FVNLA AL   L+ P+WRPRFK+YHW  S LG+ LC++LMF+ SWYYA+VA+A+A  IYKYIE+RGA KEWGD  RG  +SAA+ A+++L + P HTKNWRPQIL+L+N+D     +  P+L+   +QLKAG+GLTIVGT + G   +    +  A+++L + +  +++KG  ++VV+SN+ +A   L Q SGLG L+HN V+VS+P  W   + H  W+ F+  +R   A+  A+LVPK I  F            PS+G     G +D+W IVHDGG+L+LL  LL + + W KC++R+F VA   DN+I +KK++  F+Y LRI+AQVEVVE+  +DISAY +++T+ +  R +IL+ +NL   + +RE Q+I D        K+  A   +L++      +S +        +  D   N PT  T ++   E   P                            ST +Q    +T+     D   A+  G   PE I +            F+  P+  +        RRMH+A+RLN  I  +S  A L+L+N+PGP KN + D NYM+++E LT+GL RVL VRG G+EVIT ++
Sbjct:   34 KESSPFIN-------SSDPEKSQQYDGKNMALFEEEMDTSPMVSSLLSSLANYSNLPQGSKEHEEAENNEGTRKKPVQAPRMGTLMGVYLPCLQNILGVILFLRMTWMVGIGGVIEAFVIVLMCCSTTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGICFYLGTTYAGAMYILGCIEILLIYIVPQAAIFKMEGLEGSEAEAAMLNNMRVYGSLVLTFMAIVVFVGVRYVNKLALVFLACVISSILAVYAGVIKTAFEPPLFPVCTLGNRTLVWKG-FDVCAKVIERDNATVTTKLWRMFC--DSEFLNATCDTYFSNNNVTEIQGIPGVTSGILKENLFSTYLE-KGMFLEKKGLSTYLEPDEIPTNSNRYVLADISTFFTMLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPIGTILAITTTSFIYMSSVVLFGACIEGTVLRDKFGEAVRGNLVIGTLAWPSPWVIVFGSFFSTCGAGLQSLTGAPRLLQAIARDGIVPFLRVFGHGKANGEPTWALLLTAVICESGILIASLDSVAPILSMFFLMCYMFVNLACALQTLLRTPNWRPRFKFYHWALSFLGMSLCLSLMFICSWYYAIVAMAIASCIYKYIEFRGAEKEWGDGIRGLSLSAARFALMRLEEGPPHTKNWRPQILVLVNVDAE-QNVEQPRLLSLTNQLKAGKGLTIVGTALAGTFLENHPQAQQAEQSLKKIMETEKVKGFCQVVVSSNIRDATSHLVQASGLGGLQHNTVLVSWPRNWKQAEDHQLWRNFIELVRETTAASKALLVPKNIAAF------------PSNGERFTEGHIDVWWIVHDGGMLMLLPFLLRQNKVWRKCKMRIFTVAQMDDNSIQMKKDLTTFLYHLRIDAQVEVVEMQDSDISAYTYEKTLVMEQRSQILKQINLTKTEREREIQSITDSSRGSIRRKNPAAVNTQLSVTEEPAASSKEEKPEEEEQLIHDKSTNPPTPATPQSPAAEAETP----------------------------STVVQ----MTWTEAKCDGEQAKPLGATTPEAIKDL-----------FNMKPNQFNV-------RRMHTALRLNSEIVKKSQEAKLVLLNMPGPPKNRTGDENYMEFLEVLTEGLNRVLLVRGGGREVITIYS 1121          
BLAST of slc12a-4 vs. Ensembl Sea Lamprey
Match: slc12a4 (solute carrier family 12 member 4 [Source:ZFIN;Acc:ZDB-GENE-090218-27])

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 402/858 (46.85%), Postives = 553/858 (64.45%), Query Frame = 3
Query:  393 KLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIE--LDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIG-IFVANPSRSLRVCMLGDRLL-----NRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVS------DIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPF-LEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAK--ETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKRE 2915
            ++GT +GVY PCLQNIFGV+ FLRL W++G +G    F IVFVCCC TMLT +SMSAIATNG VPAGGSYFMISRSLGPEFGG VG+ FY GTT AA+MYI+GAIE++L YIVP A++F   +   D   M NN R+YG   L  M   VF+G+K+V+KF+ + LACV+ SIL +Y G +  A       +CMLG+R L     +       + N+T   TK     L+ L+C   +  LN    +YF  NNVTE P IPG     + +  + +Y + KG L  + G E  L  G+ PS S      DI  SFT L+GIFFPSVTGIMAGSNRSGDL + Q SIP+G+I A ATTS VYL++VI F A VE  VLRDK        L++    W + ++ ++ +       G   L+  PR+  +I    + PF ++VF      GEP  A  LT  I+ LG+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRFKYYHW  S LG+ +C+ALMF+SSWYYA+VA+ +AG IYKYIEYRGA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ L E   ++  P+L+ F SQLKAG+GLTIVG+V+ G+     +++  A+  +++ R +  +++KG  ++VV+  V + I  L Q+ GLG ++ N V++ +P  W   +    WK F+ T+R   A+  A+LV K +  FP    +               GT+D+W IVHDGG+L+LL  LL + + W KC++R+F VA  +DN+I +KK++  F+Y LRI+A+VEVVE+  +DISAY ++RT+ +  R ++L+ M L   + +RE
Sbjct:    2 RMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGVLEAFCIVFVCCCCTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAASMYILGAIEILLTYIVPSAAIFRAEDGGSDAAAMLNNMRMYGTAFLAFMAVVVFVGVKYVNKFAMLFLACVILSILAIYAGAVKTAWSPPHFPICMLGNRTLSGKDFDVCAKTTLQENDTLVATK-----LWSLFCD--STFLNASCDEYFDLNNVTEVPGIPGMSSGAILENVWSSY-SGKGDLAEKAGVEA-LGGGEYPSRSLPYVFADIATSFTALVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTIMAIATTSTVYLTSVILFGACVEGVVLRDKHSNPNRNLLLINDFTWVSNFLAVVFTHFDAFQFGTLELS-EPRVSCSIPNVILFPFPIQVFGHGKANGEPTWALLLTAGIAELGILIASLDMVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQVLVLLKLGEG-MEVRAPRLLSFASQLKAGKGLTIVGSVLHGDFLSSCAEAQAAEPHQSIKRLVETEKVKGFYQVVVSPRVRDGISHLIQSCGLGGMKPNTVVMGWPYGWRQSEDPRSWKTFIDTVRATTAAHRALLVAKNVSLFPANSERFAE------------GTIDVWWIVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQLEDNSIQMKKDLAMFLYHLRIDAEVEVVEMHDSDISAYTYERTLMMEQRCQMLKQMRLSKWERERE 836          
BLAST of slc12a-4 vs. Ensembl Sea Lamprey
Match: slc12a4 (solute carrier family 12 member 4 [Source:ZFIN;Acc:ZDB-GENE-090218-27])

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 401/856 (46.85%), Postives = 550/856 (64.25%), Query Frame = 3
Query:  393 KLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIE--LDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIG-IFVANPSRSLRVCMLGDRLL-----NRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVS------DIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPF-LEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKRE 2915
            ++GT +GVY PCLQNIFGV+ FLRL W++G +G    F IVFVCCC TMLT +SMSAIATNG VPAGGSYFMISRSLGPEFGG VG+ FY GTT AA+MYI+GAIE++L YIVP A++F   +   D   M NN R+YG   L  M   VF+G+K+V+KF+ + LACV+ SIL +Y G +  A       +CMLG+R L     +       + N+T   TK     L+ L+C   +  LN    +YF  NNVTE P IPG     + +  + +Y + KG L  + G E  L  G+ PS S      DI  SFT L+GIFFPSVTGIMAGSNRSGDL + Q SIP+G+I A ATTS + L++VI F A VE  VLRDKF         +    W + ++ ++ +       G   L+  PR+  +I    + PF ++VF      GEP  A  LT  I+ LG+LIAS+D +AP+++MFFLMCY FVNLA A+   L+ P+WRPRFKYYHW  S LG+ +C+ALMF+SSWYYA+VA+ +AG IYKYIEYRGA KEWGD  RG  +SAA+ A+L+L + P HTKNWRPQ+L+L+ L E   ++  P+L+ F SQLKAG+GLTIVG+V+ G+     +++  A E++ R +  +++KG  ++VV+  V + I  L Q+ GLG ++ N V++ +P  W   +    WK F+ T+R   A+  A+LV K +  FP    +               GT+D+W IVHDGG+L+LL  LL + + W KC++R+F VA  +DN+I +KK++  F+Y LRI+A+VEVVE+  +DISAY ++RT+ +  R ++L+ M L   + +RE
Sbjct:    3 RMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGVLEAFCIVFVCCCCTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAASMYILGAIEILLTYIVPSAAIFRAEDGGSDAAAMLNNMRMYGTAFLAFMAVVVFVGVKYVNKFAMLFLACVILSILAIYAGAVKTAWSPPHFPICMLGNRTLSGKDFDVCAKTTLQENDTLVATK-----LWSLFCD--STFLNASCDEYFDLNNVTEVPGIPGMSSGAILENVWSSY-SGKGDLAEKAGVEA-LGGGEYPSRSLPYVFADIATSFTALVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTIMAIATTSRINLTSVILFGACVEGVVLRDKFSCRFCLHSKINDFTWVSNFLAVVFTHFDAFQFGTLELS-EPRVSCSIPNVILFPFPIQVFGHGKANGEPTWALLLTAGIAELGILIASLDMVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQVLVLLKLGEG-MEVRAPRLLSFASQLKAGKGLTIVGSVLHGDFLSSCAEA-QAAESIKRLVETEKVKGFYQVVVSPRVRDGISHLIQSCGLGGMKPNTVVMGWPYGWRQSEDPRSWKTFIDTVRATTAAHRALLVAKNVSLFPANSERFAE------------GTIDVWWIVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQLEDNSIQMKKDLAMFLYHLRIDAEVEVVEMHDSDISAYTYERTLMMEQRCQMLKQMRLSKWERERE 834          
BLAST of slc12a-4 vs. Ensembl Sea Lamprey
Match: slc12a9 (solute carrier family 12 member 9 [Source:NCBI gene;Acc:793341])

HSP 1 Score: 263.077 bits (671), Expect = 9.230e-74
Identity = 200/710 (28.17%), Postives = 337/710 (47.46%), Query Frame = 3
Query:  357 GETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEW--VILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIP-FLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILI-NLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDK-QIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMA 2471
             E    + + S KL T  GV  P L ++F V+ +LR+ +++G +G     ++  V      LTVLS+ AI+TNG V  GG YFMISR+LGPEFGG++G++F+     ++A++++G  E ++     +     P  L +  ++    +Y   LL I +  V +G    SK + I   CV+  +L V+I  F                  NR +V+ K  N T     + +GP            L+D                        LK+ + Q+Y T                         + ++F  +  I F   TGIMAGSN SGDL +P ++IP G+IAA   T  VY+      S +    +L   +            +   N W   + IG + +++ A +  L GA R+L A+A D++    L+V K T++ G P  A  +++F+  L +    +++IA ++T+FFL+ Y  V+LA     +   P++RP F+++ W T LLG++ C+ +MF+ S  YA  +IA+   +  +I YR  +  WG  ++       +K +L L  +  H K WRPQIL+++ N   +C       LI F + +K G GL I+G V  G+L     D + ++     ++ DK  +K   +I ++  V + ++ L + +GLG ++ N + + F ++   D   +    F A
Sbjct:   16 AEAAPPRAEPSGKLNTFFGVVVPTLLSMFSVVLYLRIGFVVGQAGLLESLLMFVVAYVIIGLTVLSVCAISTNGAVQGGGVYFMISRALGPEFGGSIGVMFFLANVCSSAVFLLGLTEAIMDSFRKRPDF--PHGLPDAYIW--VVLYASCLLLICLVVVLVGADIYSKAAFIIFLCVILVLLTVFISFFAVR---------------NRHIVI-KHGNITMNL--NYSGP--------SLGTLHDN-----------------------LKEHYTQDYTT------------------------GVTMTFASVFAIMFNGCTGIMAGSNMSGDLKDPSYAIPRGTIAAVVFTFCVYVLLCFMVSCSCPRDLLLYNY----------VFMRDINVWGPFVTIGIYAASLSAAMSCLIGASRVLHAVALDDIFGVLLKVVKRTSRSGNPWVAVLVSWFLVQLVLFAGQLNTIAGIVTVFFLIAYATVDLACLAMEWASAPNFRPTFQFFSWHTCLLGMVGCLIMMFIISPIYASASIAVMLLLLVFIHYRSPSSSWGYISQALIFHQVRKYLLLLDIRKDHVKFWRPQILLMVANPRSSC------HLIHFVNDIKKG-GLYILGHVEVGDLDSIPYDPLESQVNYWLSLVDKLNVKAFVDITLSPTVRQGVQNLLRIAGLGGMKPNTLFLGFYDDCVPDDYFLSEPAFAA 631          
BLAST of slc12a-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000732.1 (pep scaffold:Pmarinus_7.0:GL479336:3629:33813:1 gene:ENSPMAG00000000665.1 transcript:ENSPMAT00000000732.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.732 bits (343), Expect = 1.312e-33
Identity = 120/438 (27.40%), Postives = 197/438 (44.98%), Query Frame = 3
Query: 1545 VILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTT-KRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGD--KPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTV-IEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSH------------IKWKQFMATLRVCQASDLAVLVP-KGIDQFPYRKSKKQSANVPS------------DGPVEMT-----GTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVI 2756
            +I  G F +T+ + L SL  AP++ QA+ +DN+ P +++F V   K  EP+R   LTF I+   +LIA ++ IAP+I+ FFL  Y  +N +       + P WRP FKYY+   SL G  LC  +MFV +W+ ALV   +   +Y Y+ Y+     WG +T+      A    + +    K V     R Q L+L    E     S P L+DF        GL +   V +E      K    + ++         + K     V A ++        Q +GLG ++ N +++ F + W   +S               ++  +   R+ +  D++ +V  + + +F    S K +++               D   +       GT+D+W +  DGGL LL+ +LL   + W  C++RVF+    K N I   K V+
Sbjct:   13 LITAGIFAATLSSALASLVSAPKVFQALCKDNIYPKMQMFAVGYGKNNEPIRGYILTFIIAIAFILIAELNVIAPIISNFFLASYALINFSCFHASLAKSPGWRPAFKYYNMWVSLFGAALCCGVMFVINWWAALVTYVIIFSLYIYVTYQKPDVNWGSSTQRALHGRAVNLCVNVTKLVKDVCACVGR-QCLVLTGPPE-----SRPALVDFVHAFTKNVGLMVCSHVCVELTANASKQHQYLLRQ---------RRKAFYSAVCADDLRGGTLHFLQAAGLGRMKPNTLVIGFKKNWRRAESKDVDEYINIIHDAFDFQYGVLVFRLHEGLDVSHIVQIQVLPKFNEDASHKINSSCCRAVFQTNFDQKLLDASAQFNSRQGKGTIDVWWLFDDGGLTLLVPYLLTTKKTWRDCKIRVFI--GGKINRIDHDKRVM 433          
BLAST of slc12a-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003053.1 (pep scaffold:Pmarinus_7.0:GL478333:5880:33924:-1 gene:ENSPMAG00000002656.1 transcript:ENSPMAT00000003053.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.346 bits (342), Expect = 1.278e-32
Identity = 110/429 (25.64%), Postives = 186/429 (43.36%), Query Frame = 3
Query: 1287 FTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFG--------GSVGEGLIVAKLAWP-----------------------------NEWVILI--GSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVF-KVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIAL----MFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDK 2441
            F  L G+FFP+VTGI+AG+N  GDL +P  +IP G++ A  TT+  YL      + T+   +LRD  G           G   +  +L W                              + W  LI  G F + + + L +L  AP+  Q +A+DN+ P + +F K   +  EPL    L + IS   ++IA ++ IAP+I+ FF++ Y  +N +     F++ P      +       + G+ L        M +S     L  + + G   + +    A   WG + +    + A    L L  +  H KN+RP  L+L     T      P L+DF        GL + G ++ G  G+K  + + +K   N  +  +++       VA+N+ +    L Q++G+G L  N +++ F   W  ++
Sbjct:  303 FFRLFGVFFPAVTGILAGANICGDLKDPASAIPKGTLLAILTTALSYL----IINTTIGAVMLRDASGLLSDSFAWVCNGSSKLACELGWNFTACSLFRPDTTSPCTFGFVNNYQVMAMVSAWAPLIYAGIFGAALSSALANLISAPKCFQGVARDNIYPGISIFGKGFGRNQEPLFGYLLAYLISICFIIIAELNIIAPIISCFFIISYTILNFSCFHASFIKTPG---ETELMQMPIDVEGMQLAAQRLPHSMSLSMSSVELQCVVITGEYQQLLWSLFADVNWGSSMQAMSFNTALYTNLTLDRELYHVKNYRPNCLVL-----TGPPNLRPALVDFVGTFTKDIGLMVCGNILVGPKGEKVKELLESKH--NEWLHRRKVNAFYTGFVATNMQDGAFGLLQSTGIGKLCPNILIMGFKNMWQEEE 717          

HSP 2 Score: 107.457 bits (267), Expect = 1.071e-23
Identity = 69/200 (34.50%), Postives = 107/200 (53.50%), Query Frame = 3
Query:  348 PTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFV-ANPSR 944
            P     +++K       G   GV    + NI+GVL +LRL WI   +G  L +VIV V    T ++ LS+SAI+ NGKV  GG+YFM+SR+LG E G   GIL+ F   V  AM+ +G  E  L+ I+  ++L   I +D+    N+ R+ GVI +  ++     G+ + +K   I    ++ S+L   +G  + A P +
Sbjct:   85 PDGEPVEEVKPPEPVLFGWFRGVMMRVIVNIWGVLMYLRLPWITAQAGIGLTWVIVLVAVIITSISGLSISAISNNGKVARGGTYFMVSRTLGYELGAPFGILYSFAAAVGIAMHTVGFAET-LRDILHASNL---IMVDK---VNDIRIIGVITVTFLLGIAMAGLAWENKAQLIFFVLIIISLLNYLLGTVIPATPEK 277          
BLAST of slc12a-4 vs. Ensembl Yeast
Match: VHC1 (Vacuolar membrane cation-chloride cotransporter (CCC); likely mediates K+ and Cl- cotransport into the vacuole; has a role in potassium homeostasis and salt tolerance; localizes to sites of contact between the vacuole and mitochondria (vCLAMPs); similar to mammalian electroneutral Na(+)-(K+)-C1- cotransporter family [Source:SGD;Acc:S000000439])

HSP 1 Score: 169.859 bits (429), Expect = 3.409e-43
Identity = 157/590 (26.61%), Postives = 262/590 (44.41%), Query Frame = 3
Query: 1236 PHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRD-KQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSF-------------------------------------------PEEWANDKSHI---KWKQFMATLRVCQASDLAVL-------VP---------KGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCE-LRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQ 2813
            PHL KG + S+     +F  L G+FFP+  GI AG+  S +L  P  SIP G++     T   Y   V     ++    L D       E  I+  ++   +WVI +G   +++ + +  + GA  +L+AIA+DN+IP LE+F        PL +   T+ ++ L  L + ++ IA  ITM FLM +  +NLA  L G    P++RP FKY++  T+ +G +L +  M +     A V       ++ +I Y    K WGD ++       +K +L+L  +  + K WRPQIL+ ++   T        LI FC+ LK G GL I+G V       K+ + +  ++     IRD   IK   ++    ++I  I+ +   SGLG ++ N  +V F                                           P +   +++ +   +W Q +  L + Q S++A+        +P         K ID +P +   K  A    D P  +T   D + ++      L LA +L+    W +   LRV +   ++ +     + + + +  LRI+A+V VV LDQ
Sbjct:  267 PHLTKGAAGSLLKGKETFNDLFGVFFPATAGIFAGAGMSSELRKPSKSIPKGTLWGLLFTFICYAVVVFSMGCSIPRRSLYD-------EVQIIQTIS-SVQWVIFMGEMATSLFSIIVGMLGAAYVLEAIAKDNIIPGLEIFA-----HSPLYSLIFTWILTQL-CLFSDVNKIATFITMTFLMTFVVMNLACFLLGISSAPNFRPSFKYFNRYTTAIGALLSVVAMLIVDGISASVLFLAMILLFLFIHYFSPPKSWGDVSQSLIYHQVRKYLLRL--RQDNIKYWRPQILLFVDNPRTSW-----NLIRFCNHLKKG-GLYILGHVAVTADFPKQLNELKTQQKAWMKIRDMAAIKAFVQVGTGPSLIWGIRNVFIGSGLGGMKPNITVVGFFDLESYRKHIPQSRSQNNLQKQVEIKATVPRSTCSDVKINVPLPTDECKNETKVNVQQWVQIVEDLSLMQ-SNIAIAHGFKNLEIPNKRDSCFPKKTIDLYPIQMCGKVEAK--GDQPAAITTNFDTYTLI------LQLAAILVTVPEWKRTHSLRVILFVEQEYHRTNETQRMKKLLQVLRIDAEVLVVSLDQ 825          

HSP 2 Score: 113.235 bits (282), Expect = 1.157e-25
Identity = 65/187 (34.76%), Postives = 101/187 (54.01%), Query Frame = 3
Query:  384 SSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTR--VYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANP 938
            + +KLGT  GV+ P   N+  +L FLR  +I+G  G      ++ +     +LT LS+SAI+TNG V  GG+Y+MISRSLGPEFGG++G++F+ G    A M  +G IE +L  +   A    P  L E +   +     Y  ++L +  S  F+G + VS+   I    +  SI  + +   + +P
Sbjct:   59 NKDKLGTYDGVFVPTALNVLSILMFLRFGFILGQLGIICTIGLLLLSYTINLLTTLSISAISTNGTVRGGGAYYMISRSLGPEFGGSIGLVFFLGQVFNAGMNAVGIIEPLLYNLGYSAQGEPPAALGELLPRGHWHEFTYATVILFLCFSVAFVGSQTVSRAGNILFLVLAASIFSIPLSALIRSP 245          
BLAST of slc12a-4 vs. Ensembl Nematostella
Match: EDO35443 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLI2])

HSP 1 Score: 738.799 bits (1906), Expect = 0.000e+0
Identity = 434/1076 (40.33%), Postives = 618/1076 (57.43%), Query Frame = 3
Query:  396 LGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQAL--------TFFISFLGVLIASIDSIAPLITM---FFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAIL-----DKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTE-KTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            +GTI+GVY P +QNIFGV+ F+R+ WI+G++G    F IVF+CCC TMLT +SMSA+ATNG VPAGGSYFMISR+LGPEFGG VG+LFY GTT A++MYI+GAIE+++        LF  +EL                                 FS  SL  ++   +      F+    +   VC+LGD +L +S       N++   T   + P++           N    +Y K         +PG    +  +   +++Y  K  +  + G     ++G+  S  D   SF IL+ IFFPSVTGIMAGSNRSGDL + Q SIP G+IAA ATTSFVYL++V+ F AT++  +LRDKFG S+G  L+VA +AWP +WVILIGS LST+GAG+QSLTGAP LLQAIA+DN+IPFL++   T  +    ++ AL        T F+  LG L   +D   P  ++   FFLMCYGFVNLA A+   L+ P+WRPRFKYYHW TS LG+ LC+ALMF+SSWYYALVA+ +A  +YKYIE++GA KEWGD  RG  +SAA+ ++L+L + P HTKNWRPQILIL  LDE+    S  +L+   SQLK G+GL+IVG+V+EGE  +  +D   AKE L   ++++++KG  +IV + NV + I  L Q SGLG L  N V+++FPE W   +    W  F+ T +     + A+LVP+ ID FP             D    + G+VD+W IVHDGG+++L+  LL + + W +C+LR+F VA  +DN+I +KK++  F+Y LRI A+V+V+E+   DIS Y ++RT+ +  R ++L+ M+L   ++KRE QA++      + H +A +       + TS  L  S      V     +P+E +  ET+++E   PD  K+S                                  A+PT  L       AP++ N                        R+  T  +++      ++++ +S  A L+++NLP P  +     NYM +++ LT+GL RVL VRG G+EVIT ++
Sbjct:    1 MGTIMGVYLPTIQNIFGVILFIRMSWIVGIAGVTQAFFIVFICCCCTMLTAISMSAVATNGVVPAGGSYFMISRALGPEFGGAVGLLFYLGTTFASSMYILGAIEILVI-------LFEELEL---------------------------------FSFFSLPYLISRPVASSFSYFLVFTVKFSEVCILGDAILAKSSYETCSYNDSMLRTAYGSDPVF----------WNSTRLRYVK--------GVPGITSGVFTENA-KSHYLKKNEI--KMGVAAGSNEGEIRS--DTTTSFFILLAIFFPSVTGIMAGSNRSGDLKDAQNSIPKGTIAAIATTSFVYLTSVLLFGATIQGELLRDKFGRSIGGVLVVANIAWPTKWVILIGSLLSTIGAGMQSLTGAPCLLQAIAKDNIIPFLDLSTGTLSQLFTQKSAALAKINLLLKTCFVMVLGYL--PLDFCVPGFSLCYGFFLMCYGFVNLACAVQSLLRTPNWRPRFKYYHWFTSFLGVCLCLALMFISSWYYALVAMIIAAAVYKYIEFQGAKKEWGDGIRGLALSAARFSLLRLEEGPPHTKNWRPQILILCKLDESLQPQSR-RLLSLASQLKHGKGLSIVGSVLEGEYQNLVTDITSAKENLKVCMKEEKVKGFMKIVTSENVKQGISFLIQGSGLGGLDPNTVLLAFPENW---RERELWMSFVETTQTVSLGEQALLVPRHIDAFP-------------DNHERLQGSVDVWWIVHDGGMMILILFLLRQHKVWKRCKLRIFTVAQLEDNSIQMKKDLETFMYHLRIEAEVQVIEMVDNDISEYTYERTLVMEQRNQMLKQMHLSRKESKREIQAVVVNSYRSRSHSSASQ---AAEGSRTSSMLDASSSGGSKV---VRRPSEGEAPETIIEE---PDAEKDSEGK-------------------------------ASPTSSLT------APQEQNV-----------------------RRMNTAVKLN------DIVKEKSKEAQLVVINLPAPPTSMDEWQNYMDFLDVLTEGLDRVLMVRGGGREVITIYS 919          
BLAST of slc12a-4 vs. Ensembl Nematostella
Match: EDO41391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G9])

HSP 1 Score: 212.616 bits (540), Expect = 1.882e-56
Identity = 131/408 (32.11%), Postives = 209/408 (51.23%), Query Frame = 3
Query: 1287 FTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFG--GSVGEGLIVAKLAWP----------------------NEWVILI--GSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGE-PLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEW 2429
            F  +  +FFP+ TGI+AG N SGDL + Q +IP G++ A   ++ VY++      A +    LRD  G   +V        +A P                      + W  L+  G F +T+ + L SL GAP+  QA+ +DN+ P++  F +    GE P R   LTF I+   V + +++ IAP+I+ FFLM Y  +N A       + P WRP F+YY+   SL+G +LC+A+MF+ +W+ ALV IA+   ++KY++ +     WG + + F    A +   +L +   H KN+RPQ L+L     T    S P L    SQ+    GL + G V  G L   KS+    K+ L    R+++I+    +  A+++ + ++ L QT+GLG L+ N +++ F   W
Sbjct:  278 FFSVFAVFFPAATGILAGVNISGDLKDAQKAIPKGTLWAILLSTLVYIALAWLAGACI----LRDASGFVETVVNATANVTMATPPSCPGSGCLYGLINDYQAMEKMSAWGPLVTCGIFAATLSSALASLVGAPKTFQALCKDNIFPYIGYFGIGVGPGEEPRRGYILTFIIAVGFVAVGNLNVIAPVISNFFLMSYALINYAVFAASLGRSPGWRPSFRYYNMWVSLVGALLCVAIMFLINWWAALVTIAIIASLHKYVDIKKPEVNWGSSAQAFTYIQALRFAYRLNNTEDHVKNFRPQCLVL-----TGAPSSRPNLTYIVSQITKNVGLMVCGQVNVGSLCQVKSE----KDWL----RERKIRAFHTVCSAASLRDGVQSLLQTAGLGKLKPNTLVIGFKRNW 668          

HSP 2 Score: 139.813 bits (351), Expect = 1.638e-33
Identity = 76/193 (39.38%), Postives = 114/193 (59.07%), Query Frame = 3
Query:  381 KSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVC 959
            K + K G + GV   CL NI+GV+ FLRL W++G SG     VI+ +    T +T LSMSA+ TNG+V  GG+Y++ISRSLGPEFGG++G++F     VA A+Y++G  E +   +    SL     +DE    N+ RV GVI +  +++   IG+++V +   + L  +L SI+   +G F+  P   L V 
Sbjct:   69 KMAPKFGWLKGVMLRCLLNIWGVMLFLRLTWVVGQSGIIWSTVIIILSALVTTVTTLSMSAVCTNGEVKGGGAYYLISRSLGPEFGGSIGLIFSLANAVAVALYVVGFAETVRDILRENGSLI----IDE---VNDIRVIGVISVLALLAVTLIGLEWVVRTQMVLLGILLISIVDAIVGSFIG-PQDKLSVA 253          
BLAST of slc12a-4 vs. Ensembl Nematostella
Match: EDO49361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG55])

HSP 1 Score: 211.846 bits (538), Expect = 2.350e-56
Identity = 156/564 (27.66%), Postives = 269/564 (47.70%), Query Frame = 3
Query: 1287 FTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLI-------------------VAKLAWPNE-------W--VILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRG-EPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWA--------------ND--------------KSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTI---TLKKEVIRFVYDLRINAQVEV 2798
            F  +  IFFP+ TGI+AG N SGDL NP  ++P G++ A   +S VY    I  +  +  T  RD  G  +   ++                   +  L + N+       W  ++  G F ST+ + + S+ GAP+  QA+ +D + P ++ F V    G EP R   L F I+     I  +++IAP+I+ FFL+ Y  +N AT +    + P WRP F++Y+   SL+G +LC+A+MF+ +W+ ALV I +  G+YK+++YR     WG + +     +A +    L     H KN+RPQ L+L     +      P L+   SQL    GL + G V   +  DK SD    ++   + +++ +IK       A ++   ++ +   +GLG ++ N +++ F  +W               ND              K  I++ +   T  +C   +     P+ + + P +K +++ A    +G  +  GT+D+W +  DGGL +LL +LL   R W  C+LR+F +     + I    LK   +   + +++++ V+V
Sbjct:  275 FFSVFAIFFPAATGILAGVNISGDLKNPHTAVPKGTLLAILVSSLVY----IVLAWLIGATYARDATGLVMSVAVVNGSSQSNVTSIPTCDTMKCLFGLYFDNQAMQKASGWGPIVTAGIFASTLSSAIASIVGAPKTFQAVCKDKLFPKIDYFGVGYGPGNEPKRGYVLAFLIACAFTAIGDLNAIAPIISNFFLIVYALINYATFVASLGRSPGWRPSFRFYNMWVSLIGALLCVAIMFLINWWAALVTIMIVVGLYKFVDYRKPNVNWGSSGQANTYMSALRFTTLLDTHEEHVKNFRPQCLVL-----SGRPAERPDLMYIASQLTKNSGLMMYGNVCRQKF-DKISDDEEREDA--KWLKEHKIKAFRATTTAHSLRTGVQAMLHLTGLGKMKPNTLVLGFKNDWQIAPLADLEGYFGVINDAFQMDFGVAILRIGKETIEFDEVSLTDSICNEDEFK--RPEPVAE-PLQKPEQELA---FEG--KQRGTIDVWWLYDDGGLTILLPYLLTLHRLWRSCDLRLFYLDIRSKHAIKADQLKMANLMKKFRIQVSSVVQV 818          

HSP 2 Score: 151.754 bits (382), Expect = 2.469e-37
Identity = 77/184 (41.85%), Postives = 117/184 (63.59%), Query Frame = 3
Query:  381 KSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVA 932
            + + K G I GV+F CL NI+GV+ +LRL W++G +G  L  VI+ +    T +T LSMSAI TNG+V  GG+Y++ISRSLGPEFGG++GI+F   + VA AMY++G  E +   +    +L     +DE    N+ R+ G+I +  +++   +G+K+V +   I LA ++ SIL V IG F+ 
Sbjct:   67 RDAPKFGWIKGVFFGCLLNIWGVMLYLRLSWVVGQAGIGLATVIIMLSAVVTTVTTLSMSAICTNGEVKGGGAYYLISRSLGPEFGGSIGIIFSIASAVAVAMYVVGFAETVRDLLKENGALI----VDE---VNDVRIIGLITIVFILAVALVGLKWVVRTQVILLAVLIISILDVIIGTFIG 243          

HSP 3 Score: 55.0694 bits (131), Expect = 1.759e-7
Identity = 23/69 (33.33%), Postives = 44/69 (63.77%), Query Frame = 3
Query: 3366 RRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            +++   +R+ E++R RS+NA L++++LP P    ++   YM ++E L+  L  VL VRG  + V+T ++
Sbjct:  850 KKVLRTIRIGELVRKRSNNAKLVVISLPVPVAEMTTPLMYMSWLEMLSKDLPPVLLVRGNQRSVLTFYS 918          
BLAST of slc12a-4 vs. Ensembl Nematostella
Match: EDO41917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S304])

HSP 1 Score: 191.045 bits (484), Expect = 2.272e-51
Identity = 129/402 (32.09%), Postives = 210/402 (52.24%), Query Frame = 3
Query: 1188 NYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGG-SVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVI-----PFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKE----TLNRAIRDKQIKGLSEIVVASNVIEAIKIL 2363
            ++ T K +L+ +  K+   D+    +   ++        I F  VTGIMAG+N SGDL +P  +IP G++ AC  T  VY+  VI    T    +L + +    V + + V         +I IG F ST+ A L  L GA R+L AIA+D ++     PF   F    +  EPL A  L++F   + + I +++++APL++MFFL+CYG  N+A  +      P++RP FKY+ W T+ LG + C  +MF  +  YA ++IA+   ++  I  R     WGD ++       +K +L+L  +  H K WRPQ+L+L++        S   LIDF + +K   GL I+G V   ++G+  SDSI  ++    T    +   +IK   E+ +AS++ + ++ L
Sbjct:  207 SFKTAKSNLWPKFTKDYTKDEHSEQTWLQVF-------AILFNGVTGIMAGANMSGDLKSPGKAIPYGTLTACLGTFVVYVILVICTGFTCSRELLVENYNYLQVIDNVRV---------LITIGVFASTLSAALSCLIGASRILHAIAKDQLLGVILKPFAAGFG---RNNEPLNAVLLSWFFVEIILFIGNLNTVAPLVSMFFLLCYGVTNMACFVLKVASAPNFRPTFKYFSWQTAFLGTVFCFVIMFAINPLYATISIAVMFILFIIISLRAPPTPWGDVSQALIYHQVRKYLLRLDVRKEHVKFWRPQVLLLVS-----NPRSSYNLIDFVNDIKK-SGLYILGHV---QVGEFNSDSICQQKNDTGTWLNFVDCAEIKSFVELTIASSIRQGVQHL 580          

HSP 2 Score: 120.553 bits (301), Expect = 4.688e-28
Identity = 69/186 (37.10%), Postives = 106/186 (56.99%), Query Frame = 3
Query:  393 KLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSL 950
            KL    GV  P   ++F V+ FLRL +++G +G  LG  +  V   +  +TVLS+SAIATNG V  GG+Y+MISR+LGPEFGG +GI+F+F    A+A+Y++G +E +L    P+ SL       +   +    +YG  +L + ++   IG    +K S +    V+ S+    + +FV  PS  L
Sbjct:    1 KLSMFFGVIVPVTLSMFSVILFLRLGFVVGQAGLLLGVGLFIVAYLAVSITVLSISAIATNGVVKGGGAYYMISRTLGPEFGGAIGIIFFFANVFASALYVLGFVEALLNNFGPRGSLAHIESFHQGYWYQ--FLYGSAILMLCLAVCMIGAGMFAKTSFVIFLAVMVSVSAALVSLFVDCPSTHL 184          
BLAST of slc12a-4 vs. Ensembl Nematostella
Match: EDO46430 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ45])

HSP 1 Score: 94.7449 bits (234), Expect = 8.146e-20
Identity = 62/200 (31.00%), Postives = 109/200 (54.50%), Query Frame = 3
Query: 1230 KEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACA--TTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRG---EPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLA 1814
            K  +++K  +P        FT+  G+FFPS TG+++G N SGDL +P  +IP G++AA        +Y+   +   A      L   +       +I +K++     + L G ++S++ + L +  GAPR+LQ I+QDNV+P ++   +  +RG   EP  A      I+ L +LI +++++AP++TM FL+ Y  ++ A
Sbjct:  192 KTENMEKNAAPQFGAKQNFFTVF-GVFFPSATGVLSGINMSGDLKDPSSNIPAGTLAALGFRWVGLLYILFAVLLGAVCTREALLTDY-------MIASKVSLVGV-LFLFGLYVSSLSSCLGAQYGAPRVLQVISQDNVVPIIK--PLGKERGANKEPYVASIFVAVIAMLFILIGNLNALAPIVTMPFLVTYASIDYA 380          

HSP 2 Score: 80.8777 bits (198), Expect = 1.994e-15
Identity = 55/177 (31.07%), Postives = 86/177 (48.59%), Query Frame = 3
Query:  396 LGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF 926
             GT  GV+  C+ NIFGV+ FLR  W++G +G  L  +I+ +     +  VLS   +     V +GG YF++S  LG   GG + +L+ FG  V+ +++  G  E          SL      D        RV G++    ++  V  G+K+V K   + LA ++ S+L   IG F
Sbjct:   16 FGTWDGVFTSCMLNIFGVIIFLRTGWVVGNAGVGLSLLIIVITLLVALAPVLSSIGVCERCHVGSGGVYFLLSHVLGQRAGGAISLLYAFGQAVSVSLFCAGLGE----------SLAQTAHWDSAWA---VRVIGLLTALAILLVVLAGVKWVVKLQLLLLAILMLSVLDFVIGTF 179          
BLAST of slc12a-4 vs. Ensembl Medaka
Match: slc12a5a (solute carrier family 12 member 5 [Source:NCBI gene;Acc:101165388])

HSP 1 Score: 916.761 bits (2368), Expect = 0.000e+0
Identity = 498/1167 (42.67%), Postives = 696/1167 (59.64%), Query Frame = 3
Query:  177 ENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGE---------TKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIE-----LDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSL-RVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYIS------FTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFS----------PGA--MHGLK--FDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            +NI KE++P  +     ++  +        L+EEE  T P ++++ + LA Y+   + +            + + K   + +LGT++GVY PC+QNIFGV+ FLR+ W++G+ G    F+IVF+CC +TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VGI FY GTT A AMYI+GAIE++L YIVPKA++F P+E       E  + NN RVYG ILL  M + VF+G+K+V+K + + LACV+ SIL VY G+           VC+LG+R L  S   D  A         +   +++++C   +  LN     YF  NNVT+   IPG    +L +  F  YY  KG L      E   D     + S+ Y+       FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP+G+IAA  TTS VY+S+VI F A +E  VLRDKFG  V   L++  LAWP+ WVI+IGSF ST GAGLQSLTGAPRLLQAIA+D ++P L +F      GEP  +  LT  I   G+LIAS+DS+AP+++MFFLMCY FVNLA AL   L+ P+WRPRFK+YHW  S LG+ LC+ LMF+ SWYYA+VA+ +AG IYKYIE+ GA KEWGD  RG  +SAA+ A+++L + P HTKNWRPQ+L+L++ D     +  P+L+   +QLKAG+GLTIVGT +EG   +    +  A+++L + +  +++KG  ++ V+SN+ +A   L Q SGLG L+HN V+VS+P  W     H  W+  +  +R    + LA+LVPK I  FP    +               G +D+W IVHDGG+L+LL  LL + + W KC++R+F VA   DN+I +KK++  F+Y LRI+A VEVVE+  +DISAY +++T+ +  R ++L+ +NL   + +RE Q+I D    +                            +    P   T +  + E+      +E     + +L   NT      TP S           A P   L    G  +P +  + T++          PGA     +K  F+  P     N+     RRMH+A+RLNE+I  +SS A L+L+N+PG  KN + D NYM+++E LT+GL RVL VRG G+EVIT ++
Sbjct:   20 DNIPKESSPFINSSDAAAEKSQQYDGKNMALFEEEMDTSPMVSSLLSSLANYSNLPQGSKEHEEAENNEAESARKKPVKAPQLGTLMGVYLPCIQNIFGVILFLRMTWLVGIGGVIGTFIIVFMCCTTTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGICFYLGTTYAGAMYILGAIELLLIYIVPKAAIF-PLEGLEGAEAEAALLNNMRVYGTILLTSMATVVFVGVKYVNKLALVFLACVILSILAVYAGVIKTGIEPPFFPVCLLGNRTL-VSKSFDVCAKTLETANGTVTTQMWRIFCD--SPLLNATCDPYFAANNVTQIQGIPGITSGILTENLFGTYYE-KGDLIARTNMESVEDPDDPLTNSNRYVLADITSFFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPVGTIAAITTTSAVYMSSVILFGACIEGVVLRDKFGEGVHGNLVIGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDGLVPALRIFGHGKANGEPTWSLLLTACICESGILIASLDSVAPILSMFFLMCYMFVNLACALQTLLRTPNWRPRFKFYHWALSFLGMSLCLTLMFLCSWYYAIVAMVIAGSIYKYIEFAGAEKEWGDGIRGLSLSAARYALMRLEEGPPHTKNWRPQLLVLVSTDAE-QNVEQPRLLSLTNQLKAGKGLTIVGTALEGTYLENYEQAQRAEQSLRKLMETEKVKGFCQVTVSSNLRDATSHLLQASGLGGLKHNAVLVSWPRNWKQGDDHQNWRNLIELVRETTTARLALLVPKNISAFPSNSERFSE------------GHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQLDDNSIQMKKDLTTFLYHLRIDAMVEVVEMHDSDISAYTYEKTLVMEQRSQMLKQINLTKTEREREIQSITDSSRGS----------------------------IRRKNPAAVTTQLSVTEEPAATSKEEKPEEEV-QLIHDNT------TPASP----------ATPATLLTPGEGAQSPGEQIQMTWTEKCDGEPAKPPGATTTENIKDIFNMKPEWESLNQSNV--RRMHTALRLNEVILKKSSEARLVLLNMPGAPKNRAGDENYMEFLEVLTEGLNRVLLVRGGGREVITIYS 1121          
BLAST of slc12a-4 vs. Ensembl Medaka
Match: slc12a5a (solute carrier family 12 member 5 [Source:NCBI gene;Acc:101165388])

HSP 1 Score: 916.761 bits (2368), Expect = 0.000e+0
Identity = 498/1167 (42.67%), Postives = 696/1167 (59.64%), Query Frame = 3
Query:  177 ENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGE---------TKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIE-----LDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSL-RVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYIS------FTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFS----------PGA--MHGLK--FDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            +NI KE++P  +     ++  +        L+EEE  T P ++++ + LA Y+   + +            + + K   + +LGT++GVY PC+QNIFGV+ FLR+ W++G+ G    F+IVF+CC +TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VGI FY GTT A AMYI+GAIE++L YIVPKA++F P+E       E  + NN RVYG ILL  M + VF+G+K+V+K + + LACV+ SIL VY G+           VC+LG+R L  S   D  A         +   +++++C   +  LN     YF  NNVT+   IPG    +L +  F  YY  KG L      E   D     + S+ Y+       FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP+G+IAA  TTS VY+S+VI F A +E  VLRDKFG  V   L++  LAWP+ WVI+IGSF ST GAGLQSLTGAPRLLQAIA+D ++P L +F      GEP  +  LT  I   G+LIAS+DS+AP+++MFFLMCY FVNLA AL   L+ P+WRPRFK+YHW  S LG+ LC+ LMF+ SWYYA+VA+ +AG IYKYIE+ GA KEWGD  RG  +SAA+ A+++L + P HTKNWRPQ+L+L++ D     +  P+L+   +QLKAG+GLTIVGT +EG   +    +  A+++L + +  +++KG  ++ V+SN+ +A   L Q SGLG L+HN V+VS+P  W     H  W+  +  +R    + LA+LVPK I  FP    +               G +D+W IVHDGG+L+LL  LL + + W KC++R+F VA   DN+I +KK++  F+Y LRI+A VEVVE+  +DISAY +++T+ +  R ++L+ +NL   + +RE Q+I D    +                            +    P   T +  + E+      +E     + +L   NT      TP S           A P   L    G  +P +  + T++          PGA     +K  F+  P     N+     RRMH+A+RLNE+I  +SS A L+L+N+PG  KN + D NYM+++E LT+GL RVL VRG G+EVIT ++
Sbjct:   55 DNIPKESSPFINSSDAAAEKSQQYDGKNMALFEEEMDTSPMVSSLLSSLANYSNLPQGSKEHEEAENNEAESARKKPVKAPQLGTLMGVYLPCIQNIFGVILFLRMTWLVGIGGVIGTFIIVFMCCTTTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGICFYLGTTYAGAMYILGAIELLLIYIVPKAAIF-PLEGLEGAEAEAALLNNMRVYGTILLTSMATVVFVGVKYVNKLALVFLACVILSILAVYAGVIKTGIEPPFFPVCLLGNRTL-VSKSFDVCAKTLETANGTVTTQMWRIFC--DSPLLNATCDPYFAANNVTQIQGIPGITSGILTENLFGTYYE-KGDLIARTNMESVEDPDDPLTNSNRYVLADITSFFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPVGTIAAITTTSAVYMSSVILFGACIEGVVLRDKFGEGVHGNLVIGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDGLVPALRIFGHGKANGEPTWSLLLTACICESGILIASLDSVAPILSMFFLMCYMFVNLACALQTLLRTPNWRPRFKFYHWALSFLGMSLCLTLMFLCSWYYAIVAMVIAGSIYKYIEFAGAEKEWGDGIRGLSLSAARYALMRLEEGPPHTKNWRPQLLVLVSTDAE-QNVEQPRLLSLTNQLKAGKGLTIVGTALEGTYLENYEQAQRAEQSLRKLMETEKVKGFCQVTVSSNLRDATSHLLQASGLGGLKHNAVLVSWPRNWKQGDDHQNWRNLIELVRETTTARLALLVPKNISAFPSNSERFSE------------GHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQLDDNSIQMKKDLTTFLYHLRIDAMVEVVEMHDSDISAYTYEKTLVMEQRSQMLKQINLTKTEREREIQSITDSSRGS----------------------------IRRKNPAAVTTQLSVTEEPAATSKEEKPEEEV-QLIHDNT------TPASP----------ATPATLLTPGEGAQSPGEQIQMTWTEKCDGEPAKPPGATTTENIKDIFNMKPEWESLNQSNV--RRMHTALRLNEVILKKSSEARLVLLNMPGAPKNRAGDENYMEFLEVLTEGLNRVLLVRGGGREVITIYS 1156          
BLAST of slc12a-4 vs. Ensembl Medaka
Match: slc12a5a (solute carrier family 12 member 5 [Source:NCBI gene;Acc:101165388])

HSP 1 Score: 914.45 bits (2362), Expect = 0.000e+0
Identity = 497/1165 (42.66%), Postives = 694/1165 (59.57%), Query Frame = 3
Query:  177 ENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGE---------TKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIE-----LDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSL-RVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYIS------FTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFS----------PGA--MHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            +NI KE++P  +     ++  +        L+EEE  T P ++++ + LA Y+   + +            + + K   + +LGT++GVY PC+QNIFGV+ FLR+ W++G+ G    F+IVF+CC +TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VGI FY GTT A AMYI+GAIE++L YIVPKA++F P+E       E  + NN RVYG ILL  M + VF+G+K+V+K + + LACV+ SIL VY G+           VC+LG+R L  S   D  A         +   +++++C   +  LN     YF  NNVT+   IPG    +L +  F  YY  KG L      E   D     + S+ Y+       FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP+G+IAA  TTS VY+S+VI F A +E  VLRDKFG  V   L++  LAWP+ WVI+IGSF ST GAGLQSLTGAPRLLQAIA+D ++P L +F      GEP  +  LT  I   G+LIAS+DS+AP+++MFFLMCY FVNLA AL   L+ P+WRPRFK+YHW  S LG+ LC+ LMF+ SWYYA+VA+ +AG IYKYIE+ GA KEWGD  RG  +SAA+ A+++L + P HTKNWRPQ+L+L++ D     +  P+L+   +QLKAG+GLTIVGT +EG   +    +  A+++L + +  +++KG  ++ V+SN+ +A   L Q SGLG L+HN V+VS+P  W     H  W+  +  +R    + LA+LVPK I  FP    +               G +D+W IVHDGG+L+LL  LL + + W KC++R+F VA   DN+I +KK++  F+Y LRI+A VEVVE+  +DISAY +++T+ +  R ++L+ +NL   + +RE Q+I D    +                            +    P   T +  + E+      +E     + +L   NT      TP S           A P   L    G  +P +  + T++          PGA     +K  F+      N      RRMH+A+RLNE+I  +SS A L+L+N+PG  KN + D NYM+++E LT+GL RVL VRG G+EVIT ++
Sbjct:   55 DNIPKESSPFINSSDAAAEKSQQYDGKNMALFEEEMDTSPMVSSLLSSLANYSNLPQGSKEHEEAENNEAESARKKPVKAPQLGTLMGVYLPCIQNIFGVILFLRMTWLVGIGGVIGTFIIVFMCCTTTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGICFYLGTTYAGAMYILGAIELLLIYIVPKAAIF-PLEGLEGAEAEAALLNNMRVYGTILLTSMATVVFVGVKYVNKLALVFLACVILSILAVYAGVIKTGIEPPFFPVCLLGNRTL-VSKSFDVCAKTLETANGTVTTQMWRIFC--DSPLLNATCDPYFAANNVTQIQGIPGITSGILTENLFGTYYE-KGDLIARTNMESVEDPDDPLTNSNRYVLADITSFFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPVGTIAAITTTSAVYMSSVILFGACIEGVVLRDKFGEGVHGNLVIGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDGLVPALRIFGHGKANGEPTWSLLLTACICESGILIASLDSVAPILSMFFLMCYMFVNLACALQTLLRTPNWRPRFKFYHWALSFLGMSLCLTLMFLCSWYYAIVAMVIAGSIYKYIEFAGAEKEWGDGIRGLSLSAARYALMRLEEGPPHTKNWRPQLLVLVSTDAE-QNVEQPRLLSLTNQLKAGKGLTIVGTALEGTYLENYEQAQRAEQSLRKLMETEKVKGFCQVTVSSNLRDATSHLLQASGLGGLKHNAVLVSWPRNWKQGDDHQNWRNLIELVRETTTARLALLVPKNISAFPSNSERFSE------------GHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQLDDNSIQMKKDLTTFLYHLRIDAMVEVVEMHDSDISAYTYEKTLVMEQRSQMLKQINLTKTEREREIQSITDSSRGS----------------------------IRRKNPAAVTTQLSVTEEPAATSKEEKPEEEV-QLIHDNT------TPASP----------ATPATLLTPGEGAQSPGEQIQMTWTEKCDGEPAKPPGATTTENIKDIFNMKPNQSNV-----RRMHTALRLNEVILKKSSEARLVLLNMPGAPKNRAGDENYMEFLEVLTEGLNRVLLVRGGGREVITIYS 1151          
BLAST of slc12a-4 vs. Ensembl Medaka
Match: slc12a7b (solute carrier family 12 member 7 [Source:NCBI gene;Acc:101159301])

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 501/1193 (41.99%), Postives = 713/1193 (59.77%), Query Frame = 3
Query:   78 HRTSEVINSENDLSSVAAEKAAHYVVESKVENSENITKEATPL---TDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTG-------GIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGP--IELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF--VANPSRSLRVCMLGDRLLNRSVVLDKEANNTF-RCTKD-------INGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEP------GKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
             + +E    E+D+S +  E A            + + KE +P    TD +   S D      +   L+EEE  + P +A++ NKLA YT          E    E  K K   S ++GT +GVY PCLQNI GV+ FLRL WI+G +G     VIV +CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ F+ GTT A +MYI+G IE++L YIVP A++F     E +   + NN RVYG   L +M   VF+G+K+V+K + + LACV+ SI+ +Y G+   +  P     VCMLG+R L          NN F +C K        +   L+KL+C   + +LN    +YF  NNVT    IPG    ++ +  +  Y   +G L          G +P  D      V+DI   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP+G+I A  TTS +Y+S VI F A +E  +LRDKFG SV   L++  L+WP+ WVI+IGSF S  GAGLQSLTGAPRLLQAIA+D ++PFL+VF      GEP  A  LT  I  +G+LIAS+DS+AP+++MFFLMCY FVNLA A+   L+ P+WRPRFKYYHWT S LG+ LC+ALMF+SSWYYA++A+ +AG IYKYIEYRGA KEWGD  RG  ++AA+ A+++L + P HTKNWRPQ+L+L+NLD     + HP+L+   +QLKAG+GLTIVG V+EG    K++++  A++ +  ++  ++ KG   +VV+SN+ + +  L Q++GLG ++HN V++++P  W        W+ F+ T+R   A+ LA+LV K +D FP  + +               GT+D+W +VHDGG+L+LL  LL + + W KC++R+F VA   DN+I +KK++  F+Y LR+NA+VEVVE+   DISA+ +++T+ +  R ++L+ M+L   + +RE Q+I D+                       S +   N D  E     +   T   ED   DE +   + +++   ++N +       ++ P +   + T      + N  R   A   + +            F+  P     N+     RRMH+AV+LNE++ ++S  A L+L+N+PGP KN   D NYM+++E L +GL RVL VRG G+EVIT ++
Sbjct:   15 RKAAEWNEEEDDISELKEEDAT----------GDGVPKENSPFINSTDHDKNNSYD-----GTNMALFEEEMDSNPMVASLLNKLANYTNLSQGAQEHEEADEDEGPKKKAVKSPQMGTFMGVYLPCLQNILGVILFLRLTWIVGTAGILESLVIVGLCCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFFLGTTFAGSMYILGTIEILLTYIVPAAAIFKAEKKEDEAGALLNNMRVYGTCCLTLMAVVVFVGVKYVNKLALVFLACVILSIIAIYAGVIKTIFEPP-DFPVCMLGNRTLK---------NNDFDKCLKTDIIDNLTVTTALWKLFC--DSPELNATCNEYFSNNNVTLMQGIPGLTSGVISENMWSEY-GPQGMLVENRRVPSFGGSDPSQDIYMPYVVNDITSFFTLLVGIYFPSVTGIMAGSNRSGDLRDAQRSIPIGTILAITTTSIIYVSCVILFGACIEGVLLRDKFGDSVKGNLVIGTLSWPSPWVIVIGSFFSCCGAGLQSLTGAPRLLQAIARDGIVPFLQVFGHGKANGEPTWALLLTAAICEIGILIASLDSVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWTLSFLGMSLCLALMFISSWYYAIIAMVIAGCIYKYIEYRGAEKEWGDGIRGLSLNAARYALIRLEESPPHTKNWRPQMLVLLNLDSD-QAVKHPRLLSLTTQLKAGKGLTIVGYVLEGTYLTKETEAKKAEQNIKSSMSAERTKGFCHVVVSSNLRDGVSHLIQSAGLGGMKHNTVLMAWPGTWKQSNDPQSWRNFIETIRETTAAHLALLVAKNVDSFPTNQERLGE------------GTIDVWWVVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQMDDNSIQMKKDLQMFLYHLRLNAEVEVVEMHDNDISAFTYEKTLVMEQRSQMLKQMHLSRTEREREIQSITDESR---------------------SSIRRKNQDATEGSSLSRQSSTA--EDTQEDEAQLIHDRNMASHAAANDK------AEAGPERVHMTWTKDKLFTERNRNRECNANVAVRDL-----------FNMKPEWESLNQSNV--RRMHTAVKLNEVVVNKSQGAHLVLLNMPGPPKNRGGDENYMEFLEVLLEGLNRVLLVRGGGREVITIYS 1124          
BLAST of slc12a-4 vs. Ensembl Medaka
Match: slc12a7b (solute carrier family 12 member 7 [Source:NCBI gene;Acc:101159301])

HSP 1 Score: 899.042 bits (2322), Expect = 0.000e+0
Identity = 495/1160 (42.67%), Postives = 702/1160 (60.52%), Query Frame = 3
Query:  177 ENITKEATPL---TDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTG-------GIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGP--IELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIF--VANPSRSLRVCMLGDRLLNRSVVLDKEANNTF-RCTKD-------INGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEP------GKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            + + KE +P    TD +   S D      +   L+EEE  + P +A++ NKLA YT          E    E  K K   S ++GT +GVY PCLQNI GV+ FLRL WI+G +G     VIV +CC  TMLT +SMSAIATNG VPAGGSY+MISRSLGPEFGG VG+ F+ GTT A +MYI+G IE++L YIVP A++F     E +   + NN RVYG   L +M   VF+G+K+V+K + + LACV+ SI+ +Y G+   +  P     VCMLG+R L          NN F +C K        +   L+KL+C   + +LN    +YF  NNVT    IPG    ++ +  +  Y   +G L          G +P  D      V+DI   FT+L+GI+FPSVTGIMAGSNRSGDL + Q SIP+G+I A  TTS +Y+S VI F A +E  +LRDKFG SV   L++  L+WP+ WVI+IGSF S  GAGLQSLTGAPRLLQAIA+D ++PFL+VF      GEP  A  LT  I  +G+LIAS+DS+AP+++MFFLMCY FVNLA A+   L+ P+WRPRFKYYHWT S LG+ LC+ALMF+SSWYYA++A+ +AG IYKYIEYRGA KEWGD  RG  ++AA+ A+++L + P HTKNWRPQ+L+L+NLD     + HP+L+   +QLKAG+GLTIVG V+EG    K++++  A++ +  ++  ++ KG   +VV+SN+ + +  L Q++GLG ++HN V++++P  W        W+ F+ T+R   A+ LA+LV K +D FP  + +               GT+D+W +VHDGG+L+LL  LL + + W KC++R+F VA   DN+I +KK++  F+Y LR+NA+VEVVE+   DISA+ +++T+ +  R ++L+ M+L   + +RE Q+I D+                       S +   N D  E     +   T   ED   DE +   + +++   ++N +       ++ P +   + T      + N  R   A   + +            F+  P     N+     RRMH+AV+LNE++ ++S  A L+L+N+PGP KN   D NYM+++E L +GL RVL VRG G+EVIT ++
Sbjct:  123 DGVPKENSPFINSTDHDKNNSYD-----GTNMALFEEEMDSNPMVASLLNKLANYTNLSQGAQEHEEADEDEGPKKKAVKSPQMGTFMGVYLPCLQNILGVILFLRLTWIVGTAGILESLVIVGLCCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFFLGTTFAGSMYILGTIEILLTYIVPAAAIFKAEKKEDEAGALLNNMRVYGTCCLTLMAVVVFVGVKYVNKLALVFLACVILSIIAIYAGVIKTIFEPP-DFPVCMLGNRTLK---------NNDFDKCLKTDIIDNLTVTTALWKLFC--DSPELNATCNEYFSNNNVTLMQGIPGLTSGVISENMWSEY-GPQGMLVENRRVPSFGGSDPSQDIYMPYVVNDITSFFTLLVGIYFPSVTGIMAGSNRSGDLRDAQRSIPIGTILAITTTSIIYVSCVILFGACIEGVLLRDKFGDSVKGNLVIGTLSWPSPWVIVIGSFFSCCGAGLQSLTGAPRLLQAIARDGIVPFLQVFGHGKANGEPTWALLLTAAICEIGILIASLDSVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWTLSFLGMSLCLALMFISSWYYAIIAMVIAGCIYKYIEYRGAEKEWGDGIRGLSLNAARYALIRLEESPPHTKNWRPQMLVLLNLDSD-QAVKHPRLLSLTTQLKAGKGLTIVGYVLEGTYLTKETEAKKAEQNIKSSMSAERTKGFCHVVVSSNLRDGVSHLIQSAGLGGMKHNTVLMAWPGTWKQSNDPQSWRNFIETIRETTAAHLALLVAKNVDSFPTNQERLGE------------GTIDVWWVVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQMDDNSIQMKKDLQMFLYHLRLNAEVEVVEMHDNDISAFTYEKTLVMEQRSQMLKQMHLSRTEREREIQSITDESR---------------------SSIRRKNQDATEGSSLSRQSSTA--EDTQEDEAQLIHDRNMASHAAANDKA------EAGPERVHMTWTKDKLFTERNRNRECNANVAVRDL-----------FNMKPEWESLNQSNV--RRMHTAVKLNEVVVNKSQGAHLVLLNMPGPPKNRGGDENYMEFLEVLLEGLNRVLLVRGGGREVITIYS 1209          
BLAST of slc12a-4 vs. Planmine SMEST
Match: SMESG000019076.1 (SMESG000019076.1)

HSP 1 Score: 2385.91 bits (6182), Expect = 0.000e+0
Identity = 1164/1174 (99.15%), Postives = 1165/1174 (99.23%), Query Frame = 3
Query:   54 MNEARFVVHRTSEVINSENDLSSVAAEKAAHYVVESKVENSENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFAE 3575
            MNEARFVVHRTSEVINSENDL+SVAAEKAAHY         ENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGLLLLLAHLLIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFAE
Sbjct:    1 MNEARFVVHRTSEVINSENDLNSVAAEKAAHY--------GENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGLLLLLAHLLIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFAE 1166          
BLAST of slc12a-4 vs. Planmine SMEST
Match: SMESG000019076.1 (SMESG000019076.1)

HSP 1 Score: 2377.05 bits (6159), Expect = 0.000e+0
Identity = 1161/1174 (98.89%), Postives = 1162/1174 (98.98%), Query Frame = 3
Query:   54 MNEARFVVHRTSEVINSENDLSSVAAEKAAHYVVESKVENSENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFAE 3575
            MNEARFVVHRTSEVINSENDL+SVAAEKAAHYVVESKVENSENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGLLLLLAHLLIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLK            QTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFAE
Sbjct:    1 MNEARFVVHRTSEVINSENDLNSVAAEKAAHYVVESKVENSENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGLLLLLAHLLIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPTEKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQRSVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLK------------QTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFAE 1162          
BLAST of slc12a-4 vs. Planmine SMEST
Match: SMESG000043221.1 (SMESG000043221.1)

HSP 1 Score: 342.043 bits (876), Expect = 1.364e-105
Identity = 201/474 (42.41%), Postives = 271/474 (57.17%), Query Frame = 3
Query:   93 VINSENDLSSVAAEKAAHYVVESKVENSENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLF----GPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVG 1502
            ++N EN   SV+       + + K+   E + K ++ LTD   E  + ++   D    LY+E++       +I N ++ Y   +   + +T    +K + KL  I+GVY P LQ+IFGV+ FLRL WIIG SG   GF +VF+CC  T LT +SMSAIATNGKV +GGSYFMISR+LGP+FG  +GILFY G  +A AMY++G IE++L Y+ P    F    G    D   MFNN R Y   LL ++   V +G+KFV  F+ I+LACV+ SI+CVY+G FV +P RS  VC LG+RLL +S       N T  C K +   L   YC        D+   YFK N V   PA+PG+   ++K   +  Y +    + G  G       G      D+  +F +L+ I+FPSVTGIM GSN SGDL +PQ  IP  +IAA  TTSFVYLS V  F+ T    VL DK+G S+G
Sbjct:   28 LLNDENREHSVSFRDRHSIINDQKIGKLE-VRKVSSGLTDNVEEGHESDDDVKDETMALYQEDY-------SIMNSISGY---LRAMTYQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSF---WTINKTLSCNKTM---LEDYYCNGNLTTFCDD---YFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKG------LGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVFIFAGTTRREVLLDKYGVSMG 475          
BLAST of slc12a-4 vs. Planmine SMEST
Match: SMESG000043220.1 (SMESG000043220.1)

HSP 1 Score: 317.775 bits (813), Expect = 2.088e-96
Identity = 167/388 (43.04%), Postives = 243/388 (62.63%), Query Frame = 3
Query: 1788 MCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLD-ETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDK--KSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWA--NDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGXXXXXXXXXIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQAD-ISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILD 2933
            M Y FVNLA AL   L  P+WRPRF+YYHW  SL+G  L I ++F + WYY LV +AL   IYKY+EYRGA KEWGD  RG +++ AK ++L + ++  HTKNWRPQILIL   + + C K  +PKLI F  QLK GRGL I+ +++EG+  DK  +  +   KE L   +   ++KG  + +V S+V E I  L Q+ GLG L+ N VMV +P  W   +D+   +  +F+  +    ++++ +L+PKG+ ++P                +   GT+D+W I+ DGGLL++L  LL R R W +CE+RVF VA++ DN+I +K  +++++YDLRI A VEVVEL  +D ISAY  Q+T+ +  R+K++E M L   +   E QA +D
Sbjct:    1 MLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNI-EEETHTKNWRPQILILCKTNSDLCIK--YPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMATTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPE-HEFLDAIHRVVSAEICMLIPKGVSEYP---------------SISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARID 369          

HSP 2 Score: 89.3521 bits (220), Expect = 4.964e-18
Identity = 44/105 (41.90%), Postives = 67/105 (63.81%), Query Frame = 3
Query: 3273 NEFTFSPGAMHGLK-----FDFSPSLGHKNRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 3572
            ++FTFSP  +  +K        +      N + +  ++MH+AV LN +I+ +S NA L+++NLPGP KN+ S   Y+ Y+  L++GL RVL VRGTGKEVIT ++
Sbjct:  390 HQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 494          
BLAST of slc12a-4 vs. Planmine SMEST
Match: SMESG000033021.1 (SMESG000033021.1)

HSP 1 Score: 256.914 bits (655), Expect = 1.710e-70
Identity = 194/703 (27.60%), Postives = 335/703 (47.65%), Query Frame = 3
Query:  276 EEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLK-EKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPI-ELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNY---YTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEW--VILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIP-FLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRD-KQIKGLSEIVVASNVIEAIK 2357
            E   T P +   + + ++Y    +PT  ET  L  +++   L T  GV+ P     F  L FLRL +++G +G  L  + + +     +LTVLS+ AI+TNG +  GG YFMISR+LGPE GG++GILF+     ++A+++   +E ++         FGP+  +D +++  N     +   C+ + C+ + +   S F+  +L   +   +C +                        SV++      +F   K    P+ K+                +  +N T+F    G       +  + NY   +TTK                        Y++F  +  I FP VTGIM G+N SG+L  P  SIP G++AA   T   Y+ +    +AT +  +L + +            +   N W   ++IG FL+ + A L +  GA R+L A+AQD++   FL+  K+TTK G P+ +  ++F +  + +LI  ++ IAP++++FFL+ Y  VNLA AL  +    ++RP FKY+ W TSLLG+  C+ + F++S+ Y+L   +L   I   + +R     WG  ++       +K +L +  +  H K WRPQIL+L++        S   L+ F + LK G GL ++G VI+ +    + + +   E     ++D  +IK   ++ +A  + +  +
Sbjct:    5 EVLRTFPSINEEYAQNSRYYH--DPTIIETLTLSSDQTKRNLKTFTGVFCPVALAQFSSLLFLRLGFVLGQTGLLLAILQLIMAYLILLLTVLSICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDD-------FGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNLFIFIIVFVCFF------------------------SVIV------SFLFHKAFQVPIPKI------------NTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKK-----------------------YMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNY----------LFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYIYSLGIFSLFFIIIVILNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLS-----NPRSQASLVQFVNILKKG-GLFVIGHVIKTDFEHIEKNPVHEIEGNFAKMKDFLKIKAFIDVTIAPTIRDGCR 617          
The following BLAST results are available for this feature:
BLAST of slc12a-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC12A50.000e+042.93solute carrier family 12 member 5 [Source:HGNC Sym... [more]
SLC12A50.000e+043.47solute carrier family 12 member 5 [Source:HGNC Sym... [more]
SLC12A60.000e+043.65solute carrier family 12 member 6 [Source:HGNC Sym... [more]
SLC12A60.000e+043.65solute carrier family 12 member 6 [Source:HGNC Sym... [more]
SLC12A60.000e+043.81solute carrier family 12 member 6 [Source:HGNC Sym... [more]
back to top
BLAST of slc12a-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcc-20.000e+040.10K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:... [more]
kcc-20.000e+040.56K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:... [more]
kcc-20.000e+040.07K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:... [more]
kcc-20.000e+040.56K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:... [more]
kcc-20.000e+040.80K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of slc12a-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcc0.000e+043.83gene:FBgn0261794 transcript:FBtr0072139[more]
kcc0.000e+043.85gene:FBgn0261794 transcript:FBtr0343301[more]
kcc0.000e+044.35gene:FBgn0261794 transcript:FBtr0072137[more]
kcc0.000e+044.35gene:FBgn0261794 transcript:FBtr0343300[more]
kcc0.000e+044.35gene:FBgn0261794 transcript:FBtr0343299[more]
back to top
BLAST of slc12a-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc12a5a0.000e+044.63solute carrier family 12 member 5a [Source:ZFIN;Ac... [more]
slc12a7a0.000e+042.57solute carrier family 12 member 7a [Source:ZFIN;Ac... [more]
slc12a40.000e+043.64solute carrier family 12 member 4 [Source:ZFIN;Acc... [more]
slc12a7a0.000e+042.58solute carrier family 12 member 7a [Source:ZFIN;Ac... [more]
slc12a7a0.000e+042.67solute carrier family 12 member 7a [Source:ZFIN;Ac... [more]
back to top
BLAST of slc12a-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc12a50.000e+044.01solute carrier family 12 member 5 [Source:NCBI gen... [more]
slc12a50.000e+044.01solute carrier family 12 member 5 [Source:NCBI gen... [more]
slc12a50.000e+044.01solute carrier family 12 member 5 [Source:NCBI gen... [more]
slc12a50.000e+043.81solute carrier family 12 member 5 [Source:NCBI gen... [more]
slc12a50.000e+043.27solute carrier family 12 member 5 [Source:NCBI gen... [more]
back to top
BLAST of slc12a-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc12a50.000e+043.10solute carrier family 12, member 5 [Source:MGI Sym... [more]
Slc12a50.000e+043.10solute carrier family 12, member 5 [Source:MGI Sym... [more]
Slc12a40.000e+045.45solute carrier family 12, member 4 [Source:MGI Sym... [more]
Slc12a50.000e+043.64solute carrier family 12, member 5 [Source:MGI Sym... [more]
Slc12a40.000e+045.45solute carrier family 12, member 4 [Source:MGI Sym... [more]
back to top
BLAST of slc12a-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91V14|S12A5_MOUSE0.000e+043.10Solute carrier family 12 member 5 OS=Mus musculus ... [more]
sp|Q63633|S12A5_RAT0.000e+043.02Solute carrier family 12 member 5 OS=Rattus norveg... [more]
sp|Q9H2X9|S12A5_HUMAN0.000e+042.93Solute carrier family 12 member 5 OS=Homo sapiens ... [more]
sp|Q63632|S12A4_RAT0.000e+045.49Solute carrier family 12 member 4 OS=Rattus norveg... [more]
sp|Q9JIS8|S12A4_MOUSE0.000e+045.45Solute carrier family 12 member 4 OS=Mus musculus ... [more]
back to top
BLAST of slc12a-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YK510.000e+098.94Slc12a-4 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A5K4F3570.000e+054.06Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A094ZXI20.000e+053.56Solute carrier family 12 member 5 OS=Schistosoma h... [more]
A0A4Z2DI780.000e+054.02Solute carrier family 12 member 5 OS=Schistosoma j... [more]
A0A4V3SEW30.000e+052.86Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of slc12a-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc12a5a0.000e+043.55solute carrier family 12 member 5 [Source:NCBI gen... [more]
slc12a7b0.000e+043.04solute carrier family 12 member 7-like [Source:NCB... [more]
slc12a5a0.000e+043.43solute carrier family 12 member 5 [Source:NCBI gen... [more]
slc12a7b0.000e+043.37solute carrier family 12 member 7-like [Source:NCB... [more]
slc12a5a0.000e+043.46solute carrier family 12 member 5 [Source:NCBI gen... [more]
back to top
BLAST of slc12a-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc12a40.000e+046.85solute carrier family 12 member 4 [Source:ZFIN;Acc... [more]
slc12a40.000e+046.85solute carrier family 12 member 4 [Source:ZFIN;Acc... [more]
slc12a99.230e-7428.17solute carrier family 12 member 9 [Source:NCBI gen... [more]
ENSPMAT00000000732.11.312e-3327.40pep scaffold:Pmarinus_7.0:GL479336:3629:33813:1 ge... [more]
ENSPMAT00000003053.11.278e-3225.64pep scaffold:Pmarinus_7.0:GL478333:5880:33924:-1 g... [more]
back to top
BLAST of slc12a-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VHC13.409e-4326.61Vacuolar membrane cation-chloride cotransporter (C... [more]
back to top
BLAST of slc12a-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354430.000e+040.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413911.882e-5632.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493612.350e-5627.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419172.272e-5132.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464308.146e-2031.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc12a-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc12a5a0.000e+042.67solute carrier family 12 member 5 [Source:NCBI gen... [more]
slc12a5a0.000e+042.67solute carrier family 12 member 5 [Source:NCBI gen... [more]
slc12a5a0.000e+042.66solute carrier family 12 member 5 [Source:NCBI gen... [more]
slc12a7b0.000e+041.99solute carrier family 12 member 7 [Source:NCBI gen... [more]
slc12a7b0.000e+042.67solute carrier family 12 member 7 [Source:NCBI gen... [more]
back to top
BLAST of slc12a-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019076.10.000e+099.15SMESG000019076.1[more]
SMESG000019076.10.000e+098.89SMESG000019076.1[more]
SMESG000043221.11.364e-10542.41SMESG000043221.1[more]
SMESG000043220.12.088e-9643.04SMESG000043220.1[more]
SMESG000033021.11.710e-7027.60SMESG000033021.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30003346
GenBankAKN21478.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003346 ID=SMED30003346|Name=slc12a-4|organism=Schmidtea mediterranea sexual|type=transcript|length=3681bp
CAAAATTTAAAATTTCAATTTTAATGAAATATTTTGATAACTTATAATTT
TAAATGAATGAAGCAAGATTCGTTGTTCACCGGACAAGCGAAGTAATAAA
TTCAGAAAATGATCTGAGTTCTGTTGCTGCTGAAAAAGCAGCTCATTATG
TAGTGGAGTCAAAAGTCGAAAATAGCGAGAACATAACAAAAGAAGCAACT
CCTTTGACAGATGAGGAAATAGAAATGAGTGATGATGAAGAACCAGCAGG
AGACAGCAAATTTGACCTTTACGAGGAAGAATTTCACACCCGACCTCCGA
TGGCTAATATATTCAATAAGCTCGCCCAATACACTGGTGGAATAGAGCCC
ACGTCTGGGGAAACTAAAAAGCTAAAAGAAAAATCGTCGAATAAATTGGG
AACAATTCTCGGTGTTTATTTTCCATGCTTACAAAATATATTTGGAGTTT
TATTTTTCTTGCGGTTGGTATGGATTATAGGAGTTTCAGGAACCGCTTTG
GGATTTGTCATAGTATTCGTCTGCTGTTGTTCGACAATGCTCACAGTTTT
AAGTATGTCTGCAATAGCAACTAATGGCAAAGTACCTGCTGGTGGCTCAT
ATTTTATGATTAGCAGATCTCTCGGTCCAGAATTCGGTGGAACAGTCGGT
ATCCTTTTCTATTTTGGTACCACTGTGGCCGCGGCTATGTATATCATCGG
TGCAATAGAAGTTATGCTTAAATATATTGTTCCCAAAGCAAGTTTATTCG
GTCCAATTGAACTCGACGAAAATATTATGTTTAACAATACAAGGGTTTAT
GGGGTCATCTTACTCTGCATCATGATGAGTTGCGTATTTATCGGGATTAA
ATTCGTCAGTAAATTCTCAACTATTAGTTTAGCTTGTGTTCTCTGCTCAA
TATTATGTGTATATATTGGTATATTTGTTGCCAATCCTTCAAGATCACTT
AGAGTATGCATGCTAGGTGATCGTTTACTAAATAGAAGTGTTGTTTTGGA
TAAAGAAGCAAACAATACCTTCAGATGTACCAAAGATATAAATGGACCTT
TATATAAATTATATTGTCGAAATGGAACCAAAGACCTAAATGATGAGGCT
TGTAAATATTTTAAAGAAAACAATGTGACGGAGTTTCCTGCTATTCCTGG
ATTTTATAGACCACTATTAAAAGATGGATTTTTTCAAAATTATTACACAA
CCAAAGGTAGTCTCTATGGTGAACCGGGAAAAGAGCCCCATTTAGATAAA
GGCCAATCACCCAGTGTTTCTGATATCTATATTTCTTTCACAATTTTAAT
AGGAATATTTTTCCCTTCCGTTACAGGTATTATGGCTGGTTCCAATAGGT
CTGGAGATTTAGCCAATCCACAATTTTCAATTCCTCTTGGATCTATTGCT
GCTTGTGCTACTACCTCATTTGTCTATTTATCTGCTGTCATATTTTTCTC
TGCAACAGTTGAACATACTGTTTTAAGAGATAAATTCGGGGGAAGTGTCG
GTGAAGGGTTGATAGTTGCTAAATTAGCCTGGCCTAACGAATGGGTCATT
CTTATTGGCTCATTCCTTAGCACTGTTGGAGCTGGATTGCAGTCCTTAAC
CGGAGCTCCGAGATTGTTACAAGCAATCGCACAAGACAATGTCATACCGT
TTTTGGAAGTCTTTAAAGTTACTACAAAACGTGGAGAACCATTGCGAGCT
CAGGCTTTAACATTTTTTATTTCTTTCCTAGGAGTTCTCATTGCCAGTAT
TGATTCAATTGCACCATTAATTACCATGTTTTTTTTAATGTGTTACGGAT
TTGTGAATCTCGCTACTGCATTAAACGGATTTCTCCAGGAACCCAGTTGG
AGACCTAGATTCAAATATTATCATTGGACAACATCGTTATTAGGCCTCAT
CCTCTGTATAGCTTTGATGTTCGTATCCAGCTGGTACTATGCGTTGGTGG
CTATTGCTTTAGCTGGCGGCATTTACAAATACATCGAATATCGCGGTGCA
ACAAAGGAATGGGGGGACGCCACCAGAGGGTTTCAAATGTCGGCGGCAAA
GAAAGCAATTTTACAATTAGGTGATAAACCTGTCCATACGAAAAATTGGC
GCCCACAAATTCTTATATTGATCAATCTTGATGAAACTTGCACGAAAATG
TCCCATCCGAAACTCATAGATTTCTGCTCCCAATTGAAAGCCGGACGTGG
CTTAACCATAGTTGGAACTGTTATTGAAGGAGAATTGGGTGATAAAAAGA
GCGATTCTATTATTGCAAAAGAAACTTTAAATCGAGCTATTCGTGATAAA
CAGATTAAAGGATTAAGCGAAATCGTTGTCGCTTCAAATGTTATAGAAGC
TATTAAAATATTATGTCAAACCTCAGGTCTTGGTAATCTAAGACACAATT
GCGTTATGGTTTCATTCCCAGAAGAGTGGGCCAACGATAAGAGCCACATT
AAATGGAAACAGTTTATGGCAACCTTAAGAGTTTGTCAAGCCAGCGATTT
GGCAGTTCTTGTACCGAAGGGAATAGATCAATTTCCATATCGTAAATCTA
AAAAACAGTCAGCAAACGTTCCAAGTGACGGACCCGTAGAAATGACTGGT
ACTGTTGATATGTGGTGTATTGTACATGACGGAGGTCTTCTGTTATTACT
GGCACATTTATTGATAAGAGCGCGTGCTTGGGGAAAATGTGAATTGCGGG
TTTTTGTTGTTGCCAGTGAAAAAGACAACACAATCACCTTGAAAAAGGAA
GTCATCCGGTTTGTTTACGATCTGCGAATAAATGCTCAAGTTGAAGTAGT
TGAATTGGATCAAGCAGATATTTCTGCATACGCTTTCCAACGAACTATGG
ATCTAAATATGCGGAAAAAAATTCTTGAAGACATGAATCTTCGAACTGTC
GACACAAAGCGCGAATTTCAAGCGATTCTCGACAAACACCATGTAGCTGC
CGGAGAGCTCACGATGATGACGAATATTAATGACACTAGCCCCGATCTTC
CATTCTCACCGTTACCGACAATAAATGTTGACGTTCACGAAAATCAACCA
ACTGAGAAAACGGAAGAGACAGTATTAGATGAAGATAATCATCCAGATGA
AAACAAGGAATCTATGAATTCTCATATTTCAAAATTAAAATCGTCCAATA
CTGAACAAACACTGATTCTTACTCCAGATTCCACACCGCTCCAGAACCAG
AGGTCAGTGACTTTTGCCGCTCCGACTCTAGATCTGAATAATGCTCGTGG
CGATATGGCTCCTGAAAAAATCAATGAGTTCACATTTTCACCGGGTGCTA
TGCATGGATTAAAGTTCGATTTCAGCCCTTCTCTTGGCCATAAAAACAGA
CAAACAAAAACCGGCAGAAGGATGCATAGTGCGGTGCGATTAAACGAAAT
GATTCGGAGCCGATCAAGCAATGCCAGCCTAATACTTGTCAATCTCCCAG
GTCCATCCAAAAATGAATCTAGTGATTATAACTATATGCAATACGTTGAA
ACATTGACCGATGGTCTTGCTCGAGTACTTTTTGTCAGAGGAACTGGTAA
AGAGGTGATCACTGCATTTGCTGAATAGACCCAAGCTGTCAAATAGAGAC
GATGATAATTATTATATTATTGCATGCATAGTTGTGTTGATTCACCAAAG
ATGCGTATTATAACAAAATTTTATGAACGAA
back to top

protein sequence of SMED30003346-orf-1

>SMED30003346-orf-1 ID=SMED30003346-orf-1|Name=SMED30003346-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1175bp
MNEARFVVHRTSEVINSENDLSSVAAEKAAHYVVESKVENSENITKEATP
LTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPT
SGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALG
FVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGI
LFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELDENIMFNNTRVYG
VILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLR
VCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEAC
KYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKG
QSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAA
CATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVIL
IGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQ
ALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWR
PRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGAT
KEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLDETCTKMS
HPKLIDFCSQLKAGRGLTIVGTVIEGELGDKKSDSIIAKETLNRAIRDKQ
IKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWANDKSHIK
WKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGT
VDMWCIVHDGGLLLLLAHLLIRARAWGKCELRVFVVASEKDNTITLKKEV
IRFVYDLRINAQVEVVELDQADISAYAFQRTMDLNMRKKILEDMNLRTVD
TKREFQAILDKHHVAAGELTMMTNINDTSPDLPFSPLPTINVDVHENQPT
EKTEETVLDEDNHPDENKESMNSHISKLKSSNTEQTLILTPDSTPLQNQR
SVTFAAPTLDLNNARGDMAPEKINEFTFSPGAMHGLKFDFSPSLGHKNRQ
TKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVET
LTDGLARVLFVRGTGKEVITAFAE*
back to top
Aliases
The feature 'slc12a-4' has the following synonyms
Synonym
slc12a-4
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0015377cation:chloride symporter activity
GO:0015379potassium:chloride symporter activity
GO:0005215transporter activity
Vocabulary: biological process
TermDefinition
GO:0071805potassium ion transmembrane transport
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0071477cellular hypotonic salinity response
GO:1902476chloride transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000047collecting duct
PLANA:0000053distal tubule
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004842SLC12A_fam
IPR030364KCC3
IPR000076KCL_cotranspt
IPR004841AA-permease/SLC12A_dom
IPR018491SLC12_C
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005887integral component of plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000076K/Cl co-transporterPRINTSPR01081KCLTRNSPORTcoord: 294..311
score: 42.86
coord: 532..548
score: 47.06
coord: 558..566
score: 65.08
coord: 260..272
score: 53.85
IPR004841Amino acid permease/ SLC12A domainPFAMPF00324AA_permeasecoord: 120..292
e-value: 2.8E-18
score: 65.8
coord: 410..687
e-value: 7.0E-45
score: 153.5
IPR018491SLC12A transporter, C-terminalPFAMPF03522SLC12coord: 702..830
e-value: 9.8E-14
score: 51.2
coord: 1099..1171
e-value: 2.7E-14
score: 53.1
coord: 848..916
e-value: 1.4E-10
score: 40.8
NoneNo IPR availableGENE3DG3DSA:1.20.1740.10coord: 117..303
e-value: 3.2E-6
score: 28.1
coord: 391..663
e-value: 7.2E-22
score: 79.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 997..1026
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 997..1023
NoneNo IPR availablePANTHERPTHR11827SOLUTE CARRIER FAMILY 12, CATION COTRANSPORTERScoord: 1075..1172
coord: 19..981
NoneNo IPR availableTMHMMTMhelixcoord: 572..594
NoneNo IPR availableTMHMMTMhelixcoord: 547..566
NoneNo IPR availableTMHMMTMhelixcoord: 271..293
NoneNo IPR availableTMHMMTMhelixcoord: 138..157
NoneNo IPR availableTMHMMTMhelixcoord: 445..467
NoneNo IPR availableTMHMMTMhelixcoord: 196..218
NoneNo IPR availableTMHMMTMhelixcoord: 164..186
NoneNo IPR availableTMHMMTMhelixcoord: 115..134
NoneNo IPR availableTMHMMTMhelixcoord: 615..637
NoneNo IPR availableTMHMMTMhelixcoord: 408..430
NoneNo IPR availableTMHMMTMhelixcoord: 248..265
IPR004842SLC12A transporter familyTIGRFAMTIGR00930TIGR00930coord: 62..1172
e-value: 6.2E-294
score: 975.7
IPR030364K/Cl co-transporter 3PANTHERPTHR11827:SF66SOLUTE CARRIER FAMILY 12 MEMBER 6coord: 19..981
IPR030364K/Cl co-transporter 3PANTHERPTHR11827:SF66SOLUTE CARRIER FAMILY 12 MEMBER 6coord: 1075..1172