Peptidyl-prolyl cis-trans isomerase

Overview
NamePeptidyl-prolyl cis-trans isomerase
Smed IDSMED30003343
Length (bp)2157
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidyl-prolyl cis-trans isomerase (SMED30003343) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidyl-prolyl cis-trans isomerase (SMED30003343) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidyl-prolyl cis-trans isomerase (SMED30003343) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidyl-prolyl cis-trans isomerase (SMED30003343) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003343

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30003343SMESG000038766.1 dd_Smed_v4_686_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30003343SMESG000038766.1 dd_Smed_v4_686_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30003343SMESG000038766.1 dd_Smed_v4_686_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003343SMESG000038766.1 dd_Smed_v4_686_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003343SMESG000038766.1 dd_Smed_v4_686_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003343SMESG000038766.1 dd_Smed_v4_686_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30003343SMESG000038766.1 dd_Smed_v4_686_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003343SMESG000038766.1 dd_Smed_v4_686_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30003343SMESG000038766.1 dd_Smed_v4_686_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003343SMESG000038766.1 dd_Smed_v4_686_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003343SMESG000038766.1 Contig51050newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003343SMESG000038766.1 Contig51050uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003343SMESG000038766.1 Contig34401newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003343SMESG000038766.1 Contig34401uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30003343SMESG000038766.1 dd_Smed_v6_686_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003343SMESG000038766.1 dd_Smed_v6_686_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30003343SMESG000038766.1 dd_Smed_v6_686_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIB (peptidylprolyl isomerase B [Source:HGNC Symbol;Acc:HGNC:9255])

HSP 1 Score: 213.386 bits (542), Expect = 6.167e-64
Identity = 125/185 (67.57%), Postives = 150/185 (81.08%), Query Frame = 2
Query: 1313 KKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKE 1867
            KKGPKVT KV+F++ IG ++VG+++ GLFGKTVPKTV NF ++A G K        YK SKFHRVIKDFM+QGGDFTRGDGTGG SIYG+RFPDENFKL HYG GW+SMANAG D+NGSQFFIT   T WL+G+HVVFGKVLEGM +VR++E+TKT   DKP+ DV+I +CG I VE  FA++KE
Sbjct:   37 KKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKG-----FGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE 216          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIC (peptidylprolyl isomerase C [Source:HGNC Symbol;Acc:HGNC:9256])

HSP 1 Score: 189.119 bits (479), Expect = 4.585e-55
Identity = 119/188 (63.30%), Postives = 143/188 (76.06%), Query Frame = 2
Query: 1313 KKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAAD 1876
            K+GP VT KVFF++ IG K+VG+IVIGLFGK VPKTV NF ++A G K        YKGSKFHRVIKDFM+QGGD T GDGTGG SIYG+ FPDENFKL HYG GW+SMANAGPD+NGSQFFIT+    WL+G+HVVFGKV++GM +V  IE   T  +D+P+++  I+N G I V+T F V  E AD
Sbjct:   31 KRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKG-----YGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVV--EIAD 211          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIH (peptidylprolyl isomerase H [Source:HGNC Symbol;Acc:HGNC:14651])

HSP 1 Score: 153.295 bits (386), Expect = 2.063e-42
Identity = 94/169 (55.62%), Postives = 115/169 (68.05%), Query Frame = 2
Query: 1328 VTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            V   VFF++ IGG+ VG++ I LF   VPKT  NF+    G    DG  + YKGS FHRVIKDFM+QGGDF  GDGTG  SIY   F DENFKL H   G LSMAN+GP +NG QFFIT     WL+G+HVVFGK+++G+ ++R+IEN  TG N+KP   VVI  CG +
Sbjct:    9 VNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 177          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIH (peptidylprolyl isomerase H [Source:HGNC Symbol;Acc:HGNC:14651])

HSP 1 Score: 145.591 bits (366), Expect = 3.723e-40
Identity = 81/140 (57.86%), Postives = 96/140 (68.57%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVV 1813
            LF   VPKT  NF+    G    DG  + YKGS FHRVIKDFM+QGGDF  GDGTG  SIY   F DENFKL H   G LSMAN+GP +NG QFFIT     WL+G+HVVFGK+++G+ ++R+IEN  TG N+KP   VV
Sbjct:    5 LFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVV 144          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIA (peptidylprolyl isomerase A [Source:HGNC Symbol;Acc:HGNC:9253])

HSP 1 Score: 138.658 bits (348), Expect = 2.137e-37
Identity = 89/169 (52.66%), Postives = 113/169 (66.86%), Query Frame = 2
Query: 1328 VTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            V   VFF+I + G+ +G++   LF   VPKT  NF++++ G K        YKGS FHR+I  FM QGGDFTR +GTGG SIYG++F DENF L H G G LSMANAGP++NGSQFFI    T WL+G+HVVFGKV EGMNIV  +E   + +N K    + I +CG +
Sbjct:    2 VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKG-----FGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGS-RNGKTSKKITIADCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-6 (Peptidyl-prolyl cis-trans isomerase 6 [Source:UniProtKB/Swiss-Prot;Acc:P52014])

HSP 1 Score: 204.142 bits (518), Expect = 4.080e-61
Identity = 124/188 (65.96%), Postives = 151/188 (80.32%), Query Frame = 2
Query: 1301 LVSSKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSK 1864
            L +  +GP+VTDKVFF++EIGG+ VGKIVIGLFG+ VPKTV NF  +A+    ++G+   Y GSKFHRVI++FM+QGGDFTRGDGTGG SIYG+RF DENFKL HYG GWLSMANAG D+NGSQFFIT   T WL+G+HVVFGK+LEGM++VR+IE T  G  D+P+ DVVI N G IPVE  F V++
Sbjct:   15 LSAEARGPRVTDKVFFDMEIGGRPVGKIVIGLFGEVVPKTVKNFVELAQ---RAEGE--GYVGSKFHRVIENFMIQGGDFTRGDGTGGRSIYGERFEDENFKLQHYGPGWLSMANAGEDTNGSQFFITTAKTSWLDGKHVVFGKILEGMDVVREIEATPKGAGDRPIEDVVIANAGHIPVENPFTVAR 197          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-6 (Peptidyl-prolyl cis-trans isomerase 6 [Source:UniProtKB/Swiss-Prot;Acc:P52014])

HSP 1 Score: 204.142 bits (518), Expect = 4.080e-61
Identity = 124/188 (65.96%), Postives = 151/188 (80.32%), Query Frame = 2
Query: 1301 LVSSKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSK 1864
            L +  +GP+VTDKVFF++EIGG+ VGKIVIGLFG+ VPKTV NF  +A+    ++G+   Y GSKFHRVI++FM+QGGDFTRGDGTGG SIYG+RF DENFKL HYG GWLSMANAG D+NGSQFFIT   T WL+G+HVVFGK+LEGM++VR+IE T  G  D+P+ DVVI N G IPVE  F V++
Sbjct:   15 LSAEARGPRVTDKVFFDMEIGGRPVGKIVIGLFGEVVPKTVKNFVELAQ---RAEGE--GYVGSKFHRVIENFMIQGGDFTRGDGTGGRSIYGERFEDENFKLQHYGPGWLSMANAGEDTNGSQFFITTAKTSWLDGKHVVFGKILEGMDVVREIEATPKGAGDRPIEDVVIANAGHIPVENPFTVAR 197          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-5 (Peptidyl-prolyl cis-trans isomerase 5 [Source:UniProtKB/Swiss-Prot;Acc:P52013])

HSP 1 Score: 202.601 bits (514), Expect = 1.459e-60
Identity = 125/185 (67.57%), Postives = 148/185 (80.00%), Query Frame = 2
Query: 1316 KGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEA 1870
            KGPKVTDKV+F++EIGGK +G+IVIGLFGKTVPKT TNF  +A+  K        Y GSKFHRVI DFM+QGGDFTRGDGTGG SIYG++F DENFKL HYG+GWLSMANAG D+NGSQFFIT   TPWL+GRHVVFGK+LEGM++VR+IE T+    D+P  DV+I   G I V+T F+V +EA
Sbjct:   23 KGPKVTDKVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKGE-----GYPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTEKLPGDRPKQDVIIAASGHIAVDTPFSVEREA 202          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-5 (Peptidyl-prolyl cis-trans isomerase 5 [Source:UniProtKB/Swiss-Prot;Acc:P52013])

HSP 1 Score: 202.601 bits (514), Expect = 1.459e-60
Identity = 125/185 (67.57%), Postives = 148/185 (80.00%), Query Frame = 2
Query: 1316 KGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEA 1870
            KGPKVTDKV+F++EIGGK +G+IVIGLFGKTVPKT TNF  +A+  K        Y GSKFHRVI DFM+QGGDFTRGDGTGG SIYG++F DENFKL HYG+GWLSMANAG D+NGSQFFIT   TPWL+GRHVVFGK+LEGM++VR+IE T+    D+P  DV+I   G I V+T F+V +EA
Sbjct:   23 KGPKVTDKVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKGE-----GYPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTEKLPGDRPKQDVIIAASGHIAVDTPFSVEREA 202          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-3 (Peptidyl-prolyl cis-trans isomerase 3 [Source:UniProtKB/Swiss-Prot;Acc:P52011])

HSP 1 Score: 152.91 bits (385), Expect = 1.017e-42
Identity = 95/168 (56.55%), Postives = 127/168 (75.60%), Query Frame = 2
Query: 1337 KVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKT--SDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            KVFF+I IGGK  G+IV+ L+   VPKT  NF+++  G       GK L +KGSKFHR+I +FM+QGGDFTRG+GTGG SIYG++FPDENFK  H G G LSMANAGP++NGSQFF+    T WL+G+HVVFG+V+EG+++V+ +E+  + Q+ KPV D +I +CG +
Sbjct:    5 KVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGS-QSGKPVKDCMIADCGQL 171          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG2852 (gene:FBgn0034753 transcript:FBtr0071933)

HSP 1 Score: 217.238 bits (552), Expect = 6.907e-66
Identity = 130/191 (68.06%), Postives = 151/191 (79.06%), Query Frame = 2
Query: 1316 KGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIA-----EGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAA 1873
            KGPKVT+KVFF+I IGG+  G+I IGLFGKTVPKTV NFK +A     EGYK          GSKFHR+IKDFM+QGGDFT+GDGTGG SIYG+RF DENFKL HYG+GWLSMANAG D+NGSQFFIT K T WL+GRHVVFGK+L GMN+VRQIEN+ T   D+PV DVVI N G++PV  +F+V+K  A
Sbjct:   23 KGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYK----------GSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLPVSEAFSVAKADA 203          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG2852 (gene:FBgn0034753 transcript:FBtr0345504)

HSP 1 Score: 217.238 bits (552), Expect = 6.907e-66
Identity = 130/191 (68.06%), Postives = 151/191 (79.06%), Query Frame = 2
Query: 1316 KGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIA-----EGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAA 1873
            KGPKVT+KVFF+I IGG+  G+I IGLFGKTVPKTV NFK +A     EGYK          GSKFHR+IKDFM+QGGDFT+GDGTGG SIYG+RF DENFKL HYG+GWLSMANAG D+NGSQFFIT K T WL+GRHVVFGK+L GMN+VRQIEN+ T   D+PV DVVI N G++PV  +F+V+K  A
Sbjct:   23 KGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYK----------GSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLPVSEAFSVAKADA 203          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG17266 (gene:FBgn0033089 transcript:FBtr0307502)

HSP 1 Score: 147.132 bits (370), Expect = 2.079e-40
Identity = 89/165 (53.94%), Postives = 115/165 (69.70%), Query Frame = 2
Query: 1340 VFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            VFF+I +G   +G+++  LF  TVP+T  NF+    G    DG  + YKG+ FHRVIKDFM+QGGDF +GDGTG TSIYG+ F DENF L H   G LSMAN+G ++NG QFFIT     +L+G+HVVFG+VL+G+ I+R+IEN  TG N+KP   V I  CG +
Sbjct:   19 VFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG17266 (gene:FBgn0033089 transcript:FBtr0086144)

HSP 1 Score: 147.132 bits (370), Expect = 2.079e-40
Identity = 89/165 (53.94%), Postives = 115/165 (69.70%), Query Frame = 2
Query: 1340 VFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            VFF+I +G   +G+++  LF  TVP+T  NF+    G    DG  + YKG+ FHRVIKDFM+QGGDF +GDGTG TSIYG+ F DENF L H   G LSMAN+G ++NG QFFIT     +L+G+HVVFG+VL+G+ I+R+IEN  TG N+KP   V I  CG +
Sbjct:   19 VFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: ninaA (gene:FBgn0002936 transcript:FBtr0078023)

HSP 1 Score: 141.739 bits (356), Expect = 8.005e-38
Identity = 91/192 (47.40%), Postives = 116/192 (60.42%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDEN--FKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAAD*IDLGIYEVVQIGIVSSFYFKFECYYKFR 1963
            LFGK  PKTV NF+ I    +  +G   +Y GS+FHRV+  F++QGGD   GDGTG  SIYGD FPDE+    + H   G+L MAN GPD+NG QF++T     WL+G+H VFGKVLEGM+ +  IE+ KT  +D PV  VVI NCG IP E  F    +  D   LG  +   + + SSF      +Y FR
Sbjct:   47 LFGKLAPKTVANFRHIC--LRGINGT--SYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPTE-QFEFYPD--DFNILGWIKAAGLPVTSSFCVLLIFHYFFR 231          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppib (peptidylprolyl isomerase B (cyclophilin B) [Source:ZFIN;Acc:ZDB-GENE-040426-1955])

HSP 1 Score: 213.386 bits (542), Expect = 2.820e-64
Identity = 131/185 (70.81%), Postives = 149/185 (80.54%), Query Frame = 2
Query: 1313 KKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKE 1867
            KKGPKVT KV+F+I+IG ++ G+IVIGLFGKTVPKT  NF  +A G K        YKGSKFHRVIKDFM+QGGDFTRGDGTGG SIYGDRFPDENFKL HYG GWLSMANAG D+NGSQFFIT   TPWL+G+HVVFGK+LEGM++VR+IE TKT   DKP+ DV I + G I VE  FAV+KE
Sbjct:   29 KKGPKVTAKVYFDIKIGDEDAGRIVIGLFGKTVPKTTENFLQLATGEKG-----FGYKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGPGWLSMANAGKDTNGSQFFITTVQTPWLDGKHVVFGKILEGMDVVRKIEATKTDGRDKPLKDVSIHDSGKIDVEKPFAVAKE 208          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppic (peptidylprolyl isomerase C [Source:ZFIN;Acc:ZDB-GENE-170217-1])

HSP 1 Score: 184.111 bits (466), Expect = 5.385e-53
Identity = 115/187 (61.50%), Postives = 138/187 (73.80%), Query Frame = 2
Query: 1310 SKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEA 1870
            ++ GP+VTDKVFF+I +GG  VG+IVIGLFG+  P TV NF S+A G K        YKGSKFHRVIKDFM+QGGDFT GDGTGG SIYG+ F DENF+L H G+GW+SMANAGPD+NGSQFFIT+   PWL+G+HVVFGKVLEGM +V  IE   T + + P ++ VIVN G I V+    V  E 
Sbjct:   63 TRTGPQVTDKVFFDITVGGHEVGRIVIGLFGEVAPLTVQNFVSLATGEKGYG-----YKGSKFHRVIKDFMIQGGDFTAGDGTGGKSIYGNMFADENFRLRHLGAGWVSMANAGPDTNGSQFFITLARAPWLDGKHVVFGKVLEGMAVVHTIELQDTNERNLPYTECVIVNSGKIKVKEPLLVEVEG 244          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppih (peptidylprolyl isomerase H (cyclophilin H) [Source:ZFIN;Acc:ZDB-GENE-040625-127])

HSP 1 Score: 149.443 bits (376), Expect = 3.365e-41
Identity = 90/165 (54.55%), Postives = 114/165 (69.09%), Query Frame = 2
Query: 1340 VFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            VFF++ IGG+ VG++ I LF   VPKT  NF+    G    DG  + YKG  FHRVIKDFM+QGGDF  GDGTG  SIY   F DENF++ H G G LSMAN+GP +NG QFFIT     WL+G+HVVFGKV++G+ ++R+IEN  TG N+KP   +V+  CG +
Sbjct:   13 VFFDVSIGGQEVGRMKIELFADIVPKTAENFRQFCTGEFKKDGVPVGYKGCTFHRVIKDFMIQGGDFVNGDGTGICSIYRGPFADENFRMKHSGPGLLSMANSGPGTNGCQFFITCTKCDWLDGKHVVFGKVVDGLLVMRKIENVPTGPNNKPKLPIVVSQCGEM 177          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppih (peptidylprolyl isomerase H (cyclophilin H) [Source:ZFIN;Acc:ZDB-GENE-040625-127])

HSP 1 Score: 149.443 bits (376), Expect = 3.365e-41
Identity = 90/165 (54.55%), Postives = 114/165 (69.09%), Query Frame = 2
Query: 1340 VFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            VFF++ IGG+ VG++ I LF   VPKT  NF+    G    DG  + YKG  FHRVIKDFM+QGGDF  GDGTG  SIY   F DENF++ H G G LSMAN+GP +NG QFFIT     WL+G+HVVFGKV++G+ ++R+IEN  TG N+KP   +V+  CG +
Sbjct:   13 VFFDVSIGGQEVGRMKIELFADIVPKTAENFRQFCTGEFKKDGVPVGYKGCTFHRVIKDFMIQGGDFVNGDGTGICSIYRGPFADENFRMKHSGPGLLSMANSGPGTNGCQFFITCTKCDWLDGKHVVFGKVVDGLLVMRKIENVPTGPNNKPKLPIVVSQCGEM 177          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppid (peptidylprolyl isomerase D [Source:ZFIN;Acc:ZDB-GENE-040625-34])

HSP 1 Score: 148.288 bits (373), Expect = 1.335e-38
Identity = 94/178 (52.81%), Postives = 121/178 (67.98%), Query Frame = 2
Query: 1307 SSKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYK---TSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGS 1831
             +K G     +VFF++EIG + VG++V  LF   VPKT  NF+++  G K    S GK L +KG  FHR+IK FM+QGGDF+  +GTGG SIYGD+F DENF   H   G LSMANAGP++NGSQFFIT   TP L+G+HVVFG+VL+GM +V+ +E  +T + D PV   VI  CG 
Sbjct:    7 EAKPGNAENPRVFFDVEIGAERVGRVVFELFADVVPKTAENFRALCTGEKGVGKSTGKPLHFKGCPFHRIIKSFMIQGGDFSNQNGTGGESIYGDKFEDENFHYKHDREGLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVLKGMGVVKMLEAMET-KEDNPVKPCVIAECGE 183          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: azin1 (antizyme inhibitor 1 [Source:Xenbase;Acc:XB-GENE-948396])

HSP 1 Score: 203.756 bits (517), Expect = 2.278e-59
Identity = 123/174 (70.69%), Postives = 145/174 (83.33%), Query Frame = 2
Query: 1313 KKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            KKGPKVT KV+F+I+IG ++VG++VIGLFGKTVPKTV NF ++A G K        YKGSKFHRVIKDFM+QGGDFTRGDGTGG SIYGDRFPDENFKL HYG  W+SMANAG D+NGSQFFIT   TPWL+G+HVVFGK+LEG ++V +IE+TKT   DKP+ DVVI +CG+I
Sbjct:   37 KKGPKVTHKVYFDIKIGDEDVGRVVIGLFGKTVPKTVENFVTLATGEKG-----FGYKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLRHYGPNWVSMANAGKDTNGSQFFITTVKTPWLDGKHVVFGKILEGKDVVEKIESTKTDGRDKPLKDVVIADCGTI 205          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: PPIC (peptidylprolyl isomerase C (cyclophilin C) [Source:NCBI gene;Acc:100494684])

HSP 1 Score: 189.504 bits (480), Expect = 2.781e-55
Identity = 118/183 (64.48%), Postives = 138/183 (75.41%), Query Frame = 2
Query: 1313 KKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVS 1861
            K+GP VT KVFF +EIGG + G+IVIGLFGK VPKTV NF ++A G K        YKGS+FHRVIKDFM+QGGD T GDGTGG SIYG+ FPDENFKL HYG GW+SMANAGPD+NGSQFFI+     WLNG+HVVFGKVLEGM +V  IE  +T + D+P+ D VIVN G + V+  F V 
Sbjct:   25 KRGPVVTAKVFFNVEIGGTDAGRIVIGLFGKVVPKTVKNFVALATGEKG-----YGYKGSRFHRVIKDFMIQGGDVTNGDGTGGKSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFISTTRPLWLNGKHVVFGKVLEGMAVVHLIELQQTNERDQPLKDCVIVNSGVVTVKEPFVVE 202          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: ppih (peptidylprolyl isomerase H [Source:NCBI gene;Acc:394997])

HSP 1 Score: 149.828 bits (377), Expect = 2.776e-41
Identity = 93/165 (56.36%), Postives = 113/165 (68.48%), Query Frame = 2
Query: 1340 VFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            VFF+I IGG+ VG++ + LF   VPKT  NF+    G    DG  + YKGS FHRVIKDFM+QGGDF  GDGTG  SIY   F DENFK  H   G LSMAN+GP +NG QFFIT     WL+G+HVVFGKV++G+ ++R+IEN  TG N+KP   VVI  CG +
Sbjct:   13 VFFDISIGGQEVGRMKVELFADIVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKQKHSTPGLLSMANSGPGTNGCQFFITCSKCDWLDGKHVVFGKVIDGLLVMRKIENVPTGPNNKPKLPVVIAQCGEM 177          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: ppia (peptidylprolyl isomerase A (cyclophilin A) [Source:NCBI gene;Acc:394470])

HSP 1 Score: 136.732 bits (343), Expect = 9.443e-37
Identity = 84/166 (50.60%), Postives = 115/166 (69.28%), Query Frame = 2
Query: 1337 KVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            +VFF+I + G  +G+I++ L    VPKT  NF+++      ++ K   YK S FHR+I +FM QGGDFT  +GTGG SIYG++F DENF+L H G G LSMANAG ++NGSQFFI    T WL+G+HVVFG V++GM++VR +E   + Q+ KP   +VI NCG +
Sbjct:    5 RVFFDIAVDGCPMGRIIMELRSDVVPKTAENFRALC-----TNEKGFGYKNSGFHRIIPEFMCQGGDFTNHNGTGGKSIYGNKFADENFQLRHTGPGILSMANAGANTNGSQFFICTAKTSWLDGKHVVFGTVIDGMDVVRNMEKLGS-QSGKPAKKIVIANCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: pnrc2 (proline rich nuclear receptor coactivator 2 [Source:Xenbase;Acc:XB-GENE-490316])

HSP 1 Score: 140.969 bits (354), Expect = 3.895e-36
Identity = 79/150 (52.67%), Postives = 103/150 (68.67%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAEGYK---TSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            LF   VPKT  NF++++ G K    S GK L +KG  FHR+IK FM+Q GDF+  +GTGG SIYG++F DENF   H   G LSMANAGP++NGSQFFIT   T  L+G+HVVFG+VL+G  IV+ +EN +  +++KP    VI  CG +
Sbjct:   36 LFADVVPKTAENFRALSTGEKGIGQSTGKPLHFKGCPFHRIIKKFMIQCGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGPNTNGSQFFITTVPTAHLDGKHVVFGQVLKGYGIVKMLENVEV-KDEKPAKMCVIAECGEL 184          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppib (peptidylprolyl isomerase B [Source:MGI Symbol;Acc:MGI:97750])

HSP 1 Score: 210.69 bits (535), Expect = 3.904e-63
Identity = 126/185 (68.11%), Postives = 152/185 (82.16%), Query Frame = 2
Query: 1313 KKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKE 1867
            KKGPKVT KV+F+++IG ++VG++V GLFGKTVPKTV NF ++A G K        YK SKFHRVIKDFM+QGGDFTRGDGTGG SIYG+RFPDENFKL HYG GW+SMANAG D+NGSQFFIT   T WL+G+HVVFGKVLEGM++VR++E+TKT   DKP+ DV+IV+ G I VE  FA++KE
Sbjct:   37 KKGPKVTVKVYFDLQIGDESVGRVVFGLFGKTVPKTVDNFVALATGEKG-----FGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVESTKTDSRDKPLKDVIIVDSGKIEVEKPFAIAKE 216          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppic (peptidylprolyl isomerase C [Source:MGI Symbol;Acc:MGI:97751])

HSP 1 Score: 189.889 bits (481), Expect = 1.965e-55
Identity = 118/183 (64.48%), Postives = 139/183 (75.96%), Query Frame = 2
Query: 1313 KKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVS 1861
            K+GP VTDKVFF++ IG K+VG+IVIGLFG  VPKTV NF ++A G K        YKGS FHRVIKDFM+QGGDFT  DGTGG SIYG+ FPDENFKL HYG GW+SMANAGPD+NGSQFFIT+    WL+G+HVVFGKVL+GM +V  IE   T  +D+P++D  IVN G I V+T F V 
Sbjct:   31 KRGPSVTDKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKG-----YGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKIDVKTPFVVE 208          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppih (peptidyl prolyl isomerase H [Source:MGI Symbol;Acc:MGI:106499])

HSP 1 Score: 152.91 bits (385), Expect = 1.215e-42
Identity = 84/147 (57.14%), Postives = 100/147 (68.03%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            LF   VPKT  NF+    G    DG  + YKGS FHRVIKDFM+QGGDF  GDGTG  SIY   F DENFKL H   G LSMAN+GP +NG QFFIT     WL+G+HVVFGK+++G+ ++R+IEN  TG N+KP   VVI  CG +
Sbjct:   12 LFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 158          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppih (peptidyl prolyl isomerase H [Source:MGI Symbol;Acc:MGI:106499])

HSP 1 Score: 153.295 bits (386), Expect = 1.416e-42
Identity = 94/169 (55.62%), Postives = 115/169 (68.05%), Query Frame = 2
Query: 1328 VTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            V   VFF++ IGG+ VG++ I LF   VPKT  NF+    G    DG  + YKGS FHRVIKDFM+QGGDF  GDGTG  SIY   F DENFKL H   G LSMAN+GP +NG QFFIT     WL+G+HVVFGK+++G+ ++R+IEN  TG N+KP   VVI  CG +
Sbjct:    9 VNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 177          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppih (peptidyl prolyl isomerase H [Source:MGI Symbol;Acc:MGI:106499])

HSP 1 Score: 153.295 bits (386), Expect = 1.416e-42
Identity = 94/169 (55.62%), Postives = 115/169 (68.05%), Query Frame = 2
Query: 1328 VTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            V   VFF++ IGG+ VG++ I LF   VPKT  NF+    G    DG  + YKGS FHRVIKDFM+QGGDF  GDGTG  SIY   F DENFKL H   G LSMAN+GP +NG QFFIT     WL+G+HVVFGK+++G+ ++R+IEN  TG N+KP   VVI  CG +
Sbjct:    9 VNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 177          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|Q26551|PPIB_SCHMA (Peptidyl-prolyl cis-trans isomerase B OS=Schistosoma mansoni OX=6183 GN=CYP PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 8.865e-67
Identity = 127/189 (67.20%), Postives = 149/189 (78.84%), Query Frame = 2
Query: 1307 SSKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAA 1873
            S   GPKVTDKVFF+IE+ GK + +I+IGLFGKTVPKTV NFK ++ G +  DG+  +YKGS FHRVIK FM+QGGDFT  DGTGG SIYGDRFPDENFKL H G+GWLSMANAGPD+NGSQFFIT   T WL+G+HVVFGKV+EGMNIVRQIE+  T   D+PV  + I +CG IPVE  F+V+   A
Sbjct:   23 SEANGPKVTDKVFFDIEVDGKPLARIIIGLFGKTVPKTVENFKQLSIGTQLKDGRTASYKGSTFHRVIKSFMIQGGDFTNHDGTGGFSIYGDRFPDENFKLRHVGAGWLSMANAGPDTNGSQFFITTVKTSWLDGKHVVFGKVVEGMNIVRQIESETTDSRDRPVKSIKIASCGHIPVEIPFSVTNSDA 211          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P24367|PPIB_CHICK (Peptidyl-prolyl cis-trans isomerase B OS=Gallus gallus OX=9031 GN=PPIB PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 2.921e-66
Identity = 128/185 (69.19%), Postives = 152/185 (82.16%), Query Frame = 2
Query: 1313 KKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKE 1867
            KKGPKVT KVFF++ +G ++ G++VIGLFGKTVPKTV NF ++A G K        +KGSKFHRVIKDFM+QGGDFTRGDGTGG SIYGDRFPDENFKL HYG GW+SMANAG D+NGSQFFIT   T WL+G+HVVFGKVLEGM++VR++ENTKT   DKP+ DV I +CG+I VE  FA++KE
Sbjct:   28 KKGPKVTAKVFFDLRVGEEDAGRVVIGLFGKTVPKTVENFVALATGEKG-----FGFKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMDVVRKVENTKTDSRDKPLKDVTIADCGTIEVEKPFAIAKE 207          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|Q27774|PPIB_SCHJA (Peptidyl-prolyl cis-trans isomerase B OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.240e-65
Identity = 123/191 (64.40%), Postives = 150/191 (78.53%), Query Frame = 2
Query: 1301 LVSSKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAA 1873
            ++S   GPKVT+KVFF+IE+  + +G+I+IGLFGKTVPKTV NFK ++ G    DG+   YKGS FHRVIK FM+QGGDFT  DGTGG SIYG+RFPDENFKL H G+GWLSMANAGP++NG+QFFIT    PWL+G+HVVFGKV+EGM++VRQIEN +T   D+PV  V I NCG IPV+  F+VS   A
Sbjct:   21 VLSEGNGPKVTEKVFFDIEVDEQPLGRIIIGLFGKTVPKTVENFKQLSIGTTLKDGRTAAYKGSTFHRVIKSFMIQGGDFTNHDGTGGFSIYGERFPDENFKLKHVGAGWLSMANAGPNTNGAQFFITTTQNPWLDGKHVVFGKVVEGMSVVRQIENMQTDSRDRPVKSVKIANCGHIPVDVPFSVSNTDA 211          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P24368|PPIB_RAT (Peptidyl-prolyl cis-trans isomerase B OS=Rattus norvegicus OX=10116 GN=Ppib PE=1 SV=3)

HSP 1 Score: 215.698 bits (548), Expect = 3.822e-64
Identity = 127/185 (68.65%), Postives = 150/185 (81.08%), Query Frame = 2
Query: 1313 KKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKE 1867
            KKGPKVT KV+F+ +IG + VG++  GLFGKTVPKTV NF ++A G K        YK SKFHRVIKDFM+QGGDFTRGDGTGG SIYG+RFPDENFKL HYG GW+SMANAG D+NGSQFFIT   T WL+G+HVVFGKVLEGM++VR++ENTKT   DKP+ DV+IV+CG I VE  FA++KE
Sbjct:   37 KKGPKVTVKVYFDFQIGDEPVGRVTFGLFGKTVPKTVDNFVALATGEKG-----FGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVENTKTDSRDKPLKDVIIVDCGKIEVEKPFAIAKE 216          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P23284|PPIB_HUMAN (Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2)

HSP 1 Score: 213.386 bits (542), Expect = 2.962e-63
Identity = 125/185 (67.57%), Postives = 150/185 (81.08%), Query Frame = 2
Query: 1313 KKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKE 1867
            KKGPKVT KV+F++ IG ++VG+++ GLFGKTVPKTV NF ++A G K        YK SKFHRVIKDFM+QGGDFTRGDGTGG SIYG+RFPDENFKL HYG GW+SMANAG D+NGSQFFIT   T WL+G+HVVFGKVLEGM +VR++E+TKT   DKP+ DV+I +CG I VE  FA++KE
Sbjct:   37 KKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKG-----FGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE 216          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A1S3J703 (Peptidyl-prolyl cis-trans isomerase OS=Lingula unguis OX=7574 GN=LOC106170618 PE=3 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 8.217e-73
Identity = 142/191 (74.35%), Postives = 159/191 (83.25%), Query Frame = 2
Query: 1301 LVSSKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAA 1873
            L    KGPKVTDKV+F+IEIGG+  G+I IGLFGKTVPKT  NFK++AEG    DGK LTYKGSKFHRVIKDFM+QGGDFT+GDGTGG SIYGDRF DENFKL HYGSGWLSMANAG D+NGSQFFIT K T WL+GRHVVFG VLEGMN+VR+IENT T QND+P  DVVIV+CG +P++  FAV K  A
Sbjct:   22 LAKDSKGPKVTDKVYFDIEIGGEKQGRITIGLFGKTVPKTAKNFKTLAEGSMEKDGKKLTYKGSKFHRVIKDFMIQGGDFTKGDGTGGASIYGDRFEDENFKLKHYGSGWLSMANAGKDTNGSQFFITTKKTNWLDGRHVVFGIVLEGMNVVRKIENTSTSQNDRPSKDVVIVDCGILPLDKPFAVGKGDA 212          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A2T7PWM5 (Peptidyl-prolyl cis-trans isomerase OS=Pomacea canaliculata OX=400727 GN=C0Q70_00391 PE=3 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 3.588e-71
Identity = 141/192 (73.44%), Postives = 164/192 (85.42%), Query Frame = 2
Query: 1301 LVSSKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAAD 1876
            L S+ KGPKVTDKV+F+IEIGG+  G+IVIGLFGKTVPKTV NFK++A G +   G  LTYKGSKFHR+IKDFM+QGGDFTRGDGTGG SI+G++FPDENFKL HYGSGWLSMANAG D+NGSQFFIT K T WL+GRHVVFGKV+EGMN+VR+IE++KT   DKP  DVVIVN G++ VE  FAV KEAA+
Sbjct:   15 LTSAAKGPKVTDKVYFDIEIGGEPAGRIVIGLFGKTVPKTVENFKALAIGDREDGGTKLTYKGSKFHRIIKDFMIQGGDFTRGDGTGGRSIWGEKFPDENFKLKHYGSGWLSMANAGKDTNGSQFFITTKKTSWLDGRHVVFGKVIEGMNVVRKIESSKTDARDKPEKDVVIVNSGALEVEEPFAVEKEAAE 206          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: T1FMP3 (Peptidyl-prolyl cis-trans isomerase OS=Helobdella robusta OX=6412 GN=20210092 PE=3 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 3.366e-70
Identity = 140/192 (72.92%), Postives = 161/192 (83.85%), Query Frame = 2
Query: 1301 LVSSKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTS-DGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAA 1873
              S++KGPKVTDKVFF+IEIGG+  G+IVIGLFGKTVP+TV NFK+IAEG + + DG  L+YKGSKFHRVIKDFM+QGGDF +GDGTGG SIYG +FPDENFKL HYG+GW+SMANAG D+NGSQFFIT K T WLNGRHVVFG VLEGM +VR IEN K    DKP+ DVVI +CGS+PVE  FAV KE+A
Sbjct:   20 FASAEKGPKVTDKVFFDIEIGGEKQGRIVIGLFGKTVPRTVKNFKTIAEGTEVAKDGTKLSYKGSKFHRVIKDFMIQGGDFNKGDGTGGLSIYGAKFPDENFKLKHYGAGWVSMANAGKDTNGSQFFITTKATDWLNGRHVVFGVVLEGMKVVRLIENVKKDGRDKPLDDVVIADCGSLPVEEPFAVPKESA 211          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A267EC51 (Peptidyl-prolyl cis-trans isomerase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005757g1 PE=3 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 2.562e-68
Identity = 136/190 (71.58%), Postives = 156/190 (82.11%), Query Frame = 2
Query: 1307 SSKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAAD 1876
            +S KGPKVTDKVFF+I IGGK  G+IVIGLFG +VPKTV NFKS+AEG     G  + YKGSKFHRVIK FM+QGGDFT+GDGTGG SIYG++F DENFKL HYG+GW SMANAGPD+NGSQFFITV  T WL+GRHVVFGKVLEGM++VR IE T T QND+P  DVVI +CGS+PV+  FAV K  +D
Sbjct:   41 ASAKGPKVTDKVFFDITIGGKPAGRIVIGLFGGSVPKTVKNFKSLAEGVPQESGGSMGYKGSKFHRVIKGFMIQGGDFTKGDGTGGKSIYGEKFKDENFKLKHYGAGWCSMANAGPDTNGSQFFITVAKTQWLDGRHVVFGKVLEGMSVVRTIETTPTNQNDRPSQDVVIADCGSLPVDQPFAVEKAPSD 230          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A291I6Q3 (Peptidyl-prolyl cis-trans isomerase (Fragment) OS=Conus lividus OX=89426 GN=PPIB PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 3.421e-68
Identity = 136/186 (73.12%), Postives = 158/186 (84.95%), Query Frame = 2
Query: 1316 KGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAA 1873
            KGPKVT+KV+F+IEIGGK  G++VIGLFGKTVPKTV NFK +A G K  DGK LTYKGSKFHRVIKDFM+QGGDFTRGDGTGG SIYG++FPDENFKL HYGSGWLSMAN+G D+NGSQFFIT K T WL+GRHVVFG VLEGM++VR+IE ++T   DKP  DVVI +CG++ V+ SF+V K  A
Sbjct:   23 KGPKVTEKVYFDIEIGGKKAGRVVIGLFGKTVPKTVENFKQLAIGEKEQDGKKLTYKGSKFHRVIKDFMIQGGDFTRGDGTGGRSIYGEKFPDENFKLKHYGSGWLSMANSGKDTNGSQFFITTKKTSWLDGRHVVFGTVLEGMDVVRKIEASETDARDKPKKDVVIADCGALEVKESFSVEKRDA 208          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppic (peptidylprolyl isomerase C [Source:NCBI gene;Acc:103037994])

HSP 1 Score: 184.882 bits (468), Expect = 8.585e-54
Identity = 118/187 (63.10%), Postives = 137/187 (73.26%), Query Frame = 2
Query: 1310 SKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEA 1870
            ++ GPKVTDKVFF+I +GG  VG+IVIGLFG+ VP TV NF ++A G K        YKGSKFHRVIKDFM+QGGDFT GDGTGG SIYG  F DENFKL H G+GW+SMANAGPD+NGSQFFIT    PWL+G+HVVFGKVLEGM +V  IE   T   + P ++ VIVN G I V+  F V  E 
Sbjct:   27 ARIGPKVTDKVFFDITVGGHEVGRIVIGLFGEVVPLTVNNFVALATGEKG-----YGYKGSKFHRVIKDFMIQGGDFTAGDGTGGKSIYGKTFADENFKLKHQGTGWVSMANAGPDTNGSQFFITSARAPWLDGKHVVFGKVLEGMTVVHTIELQDTNDRNMPYTECVIVNSGKIEVKEPFVVEVEG 208          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppid (peptidylprolyl isomerase D [Source:ZFIN;Acc:ZDB-GENE-040625-34])

HSP 1 Score: 145.206 bits (365), Expect = 1.153e-37
Identity = 83/149 (55.70%), Postives = 103/149 (69.13%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAEGYK---TSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGS 1831
            LF   VPKT  NF+++  G K    S GK L +KG  FHR+IK FM+QGGDF+  +GTGG SIYGD+F DENF   H   G LSMANAGP++NGSQFFIT   TP L+G+HVVFG+VL+GM +V+ +E  +T + D PV   VI  CG 
Sbjct:   36 LFADVVPKTAENFRALCTGEKGTGKSTGKPLHFKGCPFHRIIKKFMVQGGDFSNQNGTGGESIYGDKFEDENFHYKHDKEGLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVLKGMGVVKILEGIETNE-DTPVKPCVIAECGE 183          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppiab (peptidylprolyl isomerase Ab (cyclophilin A) [Source:ZFIN;Acc:ZDB-GENE-030131-7459])

HSP 1 Score: 130.568 bits (327), Expect = 7.000e-35
Identity = 74/136 (54.41%), Postives = 96/136 (70.59%), Query Frame = 2
Query: 1427 NFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            NF+++  G K        YKGS FHR+I  FM QGGDFT+ +GTGG SIYG++F DENF L H G G LSMANAGP++NGSQFFI   DT WL+G+HVVFGKV+EG+++V  +E  K   + K  + V+I +CG +
Sbjct:   28 NFRALCTGEKG-----FGYKGSGFHRIIPGFMCQGGDFTKHNGTGGKSIYGEKFADENFTLKHQGLGTLSMANAGPNTNGSQFFICTADTAWLDGKHVVFGKVVEGIDVVEAVEK-KGSSSGKCSAKVLIADCGQL 157          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppifb (peptidyl-prolyl cis-trans isomerase A-like [Source:NCBI gene;Acc:103040813])

HSP 1 Score: 132.109 bits (331), Expect = 7.002e-35
Identity = 86/181 (47.51%), Postives = 114/181 (62.98%), Query Frame = 2
Query: 1298 QLVSSKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIE--NTKTGQNDKPVSDVVIVNCGSI 1834
            +L SS         V+F+I    + +G++   L    VPKT  NF+++  G          YKGS FHRVI  FM QGGDFT  +GTGG SIYG RF DENFKL H G G LSMANAGP++NGSQFFI    T WL+GRHVVFG V +G+++V+Q+E   +++G+  K ++   I +CG +
Sbjct:   21 RLYSSGAQANANPVVYFDIAADNQPLGRVTFELNADVVPKTAENFRALCTGEHG-----YGYKGSIFHRVIPQFMCQGGDFTHHNGTGGKSIYGPRFHDENFKLRHTGPGILSMANAGPNTNGSQFFICTVKTEWLDGRHVVFGSVKDGLDVVKQVEAFGSRSGKTSKRIT---ITDCGEL 193          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppie (peptidylprolyl isomerase E (cyclophilin E) [Source:ZFIN;Acc:ZDB-GENE-050417-167])

HSP 1 Score: 127.872 bits (320), Expect = 2.815e-32
Identity = 76/146 (52.05%), Postives = 97/146 (66.44%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGS 1831
            L    VP T  NF+ +      +  K   +KGS FHRVI  FM QGGDFT  +GTGG SIYG +F DENF L H G G LSMAN+G ++NGSQFFIT   T WL+G+HVVFG+++EGM++VR +E   T ++ KP   V+I +CG 
Sbjct:  157 LRADVVPMTAENFRCLC-----THEKGFGFKGSSFHRVIPQFMCQGGDFTNHNGTGGKSIYGRKFDDENFVLKHTGPGQLSMANSGTNTNGSQFFITCDKTDWLDGKHVVFGELMEGMDVVRAMEAQGT-KDGKPKQKVIISDCGE 296          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010135.1 (pep scaffold:Pmarinus_7.0:GL476417:32947:40880:1 gene:ENSPMAG00000009125.1 transcript:ENSPMAT00000010135.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.117 bits (344), Expect = 7.839e-38
Identity = 84/166 (50.60%), Postives = 115/166 (69.28%), Query Frame = 2
Query: 1337 KVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            +VFF++   G +VG++V+ L G  VPKT  NF+++  G K        YKGS FHRVI DFM QGGDFT+G+GTGG SIYG++F DENF L H G G LSMANAGP++NGSQFFI    T WL+ +HVVFGKV+ G+++++++E+       K    +V+ +CG +
Sbjct:    5 QVFFDLTADGASVGRVVMELRGDVVPKTAENFRALCTGEKG-----FGYKGSTFHRVIPDFMCQGGDFTKGNGTGGKSIYGNKFEDENFTLKHEGPGILSMANAGPNTNGSQFFICTAKTAWLDNKHVVFGKVISGLDVIKKVESYGAASG-KTSKKIVVADCGEL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppig (peptidylprolyl isomerase G (cyclophilin G) [Source:ZFIN;Acc:ZDB-GENE-040426-2822])

HSP 1 Score: 131.339 bits (329), Expect = 4.557e-32
Identity = 74/150 (49.33%), Postives = 100/150 (66.67%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAEGYK---TSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            LF    PKT  NF+ +  G +       K L ++ + FHR++K+FM+QGGDF+ G+G GG SIYG  F DENF+L H     LSMAN G D+NGSQFFIT K  P L+G HVVFG+VL G +++++IEN KT  N  P +D+ +V+CG +
Sbjct:   27 LFFDVCPKTCENFRCLCTGERGIGKITRKPLHFRSTSFHRIVKNFMVQGGDFSEGNGRGGESIYGGFFEDENFQLKHDQEFLLSMANRGKDTNGSQFFITTKPAPHLDGEHVVFGRVLSGQDLLKEIENQKTDANSLPYADIRVVHCGEV 176          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppifb (peptidylprolyl isomerase Fb [Source:ZFIN;Acc:ZDB-GENE-051030-126])

HSP 1 Score: 120.168 bits (300), Expect = 1.327e-31
Identity = 76/147 (51.70%), Postives = 95/147 (64.63%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            L    VPKT  NF+++  G          YKGS FHR+I +FM QGGDFTR +GTGG SIYG  F DENF L H G G LSMANAG ++NGSQFFI  + T WL+G+HVVFG V  GM+IV+++E   + + D     V I +CG +
Sbjct:   34 LRADVVPKTAENFRALCTGEHG-----FGYKGSIFHRIIPNFMCQGGDFTRNNGTGGVSIYGTTFRDENFILKHTGPGILSMANAGKNTNGSQFFICTELTNWLDGKHVVFGHVTSGMDIVKKMEKLGSSKGDVK-GRVEITDCGEV 174          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppil1 (peptidylprolyl isomerase (cyclophilin)-like 1 [Source:ZFIN;Acc:ZDB-GENE-051009-1])

HSP 1 Score: 113.235 bits (282), Expect = 2.827e-29
Identity = 65/144 (45.14%), Postives = 91/144 (63.19%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAE-GYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDE-NFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIV 1819
            L+    P+T  NF  +A  GY         Y G++FHR+I+ FM+QGGD T   G GG SIYG  F DE +  L H G+G +SMAN+GP++NGSQFFIT+  T WL+G+H +F +V  GM+ V +I   +T   D+PV ++ I+
Sbjct:   27 LYWMHAPRTCRNFAELARRGY---------YNGTRFHRIIRGFMIQGGDPTGTAGRGGASIYGKHFEDEIHPDLKHTGAGIISMANSGPNTNGSQFFITLGPTQWLDGKHSIFARVARGMSTVNRIGLVETVAQDRPVEEISII 161          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004654.1 (pep scaffold:Pmarinus_7.0:GL489343:42315:43690:-1 gene:ENSPMAG00000004243.1 transcript:ENSPMAT00000004654.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 9.907e-24
Identity = 64/147 (43.54%), Postives = 89/147 (60.54%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            LF   VP+T  NF+++      +      Y+ S  HRVI  FM QGGDFT  +GTGG SIY   F DE+FK+ H  +G LSMAN+G ++N SQFFIT++ T  L+ +HV FG V  GM+IVR +E   + Q+      +V+ + G +
Sbjct:   76 LFANVVPRTAENFRALC-----THEHGFGYRNSTIHRVIPGFMCQGGDFTNHNGTGGRSIYEKPFEDESFKILHSRAGILSMANSGRNTNTSQFFITLRATSHLDHKHVAFGAVRSGMSIVRAMEELGS-QSGNTTKKIVVTDSGEV 216          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR6 (Peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; plays a role in determining prion variants; binds to Hsp82p and contributes to chaperone activity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004206])

HSP 1 Score: 142.895 bits (359), Expect = 8.943e-38
Identity = 87/164 (53.05%), Postives = 108/164 (65.85%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAEG----YKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQ-NDKPVSDVVIVNCGSIPVETSFAVSKEA 1870
            L+   VPKT  NF  + EG     KT     L+YKGS FHRVIKDFM Q GDFT  +GTGG SIY ++F DENF + H     LSMANAGP++NGSQ FIT   TP L+G+HVVFG+V++G  IVR IEN +  Q N+KP+ DV I +CG +P +     + EA
Sbjct:   24 LYNDIVPKTAENFLKLCEGNAGMAKTKPDVPLSYKGSIFHRVIKDFMCQFGDFTNFNGTGGESIYDEKFEDENFTVKHDKPFLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGEVIQGKRIVRLIENQQCDQENNKPLRDVKIDDCGVLPDDYQVPENAEA 187          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR2 (Peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; potential role in the secretory pathway; seamless-GFP and mCherry fusion proteins localize to the vacuole, while SWAT-GFP fusion localizes to both the endoplasmic reticulum and vacuole; suppresses toxicity of slow-folding human Z-type alpha1-antitrypsin variant associated with liver cirrhosis and emphysema [Source:SGD;Acc:S000001099])

HSP 1 Score: 137.117 bits (344), Expect = 1.898e-37
Identity = 94/175 (53.71%), Postives = 118/175 (67.43%), Query Frame = 2
Query: 1328 VTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFI-TVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETS 1849
            +T KVFF+IE G + VG+IVIGL+GK  PKT  NF  ++    +  G    + GS FHRVI +FM+QGGDFT G G GG SIYGD FPDENF L H   G LSMAN G D+NGSQFFI T ++  WL+G+HVVFG+V++GM++V  I++     NDKP+  V I  CG    E S
Sbjct:   34 ITQKVFFDIEHGEEKVGRIVIGLYGKVCPKTAKNFYKLSTTTNSKKG----FIGSTFHRVIPNFMVQGGDFTDGTGVGGKSIYGDTFPDENFTLKHDRKGRLSMANRGKDTNGSQFFITTTEEASWLDGKHVVFGQVVDGMDVVNYIQHVSRDANDKPLEAVKIAKCGEWTPELS 204          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR5 (Peptidyl-prolyl cis-trans isomerase (cyclophilin) of the ER; catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; transcriptionally induced in response to unfolded proteins in the ER; CPR5 has a paralog, CPR2, that arose from the whole genome duplication [Source:SGD;Acc:S000002712])

HSP 1 Score: 137.887 bits (346), Expect = 2.051e-37
Identity = 93/188 (49.47%), Postives = 125/188 (66.49%), Query Frame = 2
Query: 1310 SKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAA 1873
            + + P++T KV+F+I  G K +G+IV+GL+G T P+TV NF  +      S    + Y  S FHRVI +FM+QGGDFT   G GG SI+G+ F DENF + H   G LSMAN G ++NGSQFFIT    PWL+G+HVVFG+VL+GM++V  IEN KT   + PV +V+IV  G +  ET    +K+AA
Sbjct:   26 TAEDPEITHKVYFDINHGDKQIGRIVMGLYGLTTPQTVENFYQLT----ISRDPKMGYLNSIFHRVIPNFMIQGGDFTHRSGIGGKSIFGNTFKDENFDVKHDKPGRLSMANRGKNTNGSQFFITTVPCPWLDGKHVVFGEVLDGMDVVHYIENVKTDSRNMPVKEVIIVESGEL--ETVPLDNKDAA 207          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR3 (Mitochondrial peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; involved in protein refolding after import into mitochondria [Source:SGD;Acc:S000004543])

HSP 1 Score: 134.806 bits (338), Expect = 6.697e-37
Identity = 83/175 (47.43%), Postives = 111/175 (63.43%), Query Frame = 2
Query: 1310 SKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            S    ++  KVFF+  + G  +G+I   L+   VPKT  NF+++  G K        YKG  FHR+I DFM+QGGD    +G GG SIYG +F DENF   H  +G LSMANAGP++NGSQFFIT    PWL+G+HVVFG+V +GM+IV+ IE+  T    KP +++VI   G +
Sbjct:   14 SNSASRLGKKVFFDPAVNGTKIGRIEFELYDNVVPKTAENFRALCTGEKG-----WGYKGVPFHRIIPDFMIQGGDTDLTNGFGGKSIYGSKFADENFVKKHDKAGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVTKGMDIVKAIESYGTASG-KPRAEIVIEEAGEL 182          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR1 (Cytoplasmic peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; binds the drug cyclosporin A; N-terminally propionylated in vivo; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002562])

HSP 1 Score: 132.109 bits (331), Expect = 3.184e-36
Identity = 75/126 (59.52%), Postives = 94/126 (74.60%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIEN 1771
            L+   VPKT  NF+++  G K        Y GS FHRVI DFMLQGGDFT G+GTGG SIYG +FPDENFK +H   G LSMANAGP++NGSQFFIT    PWL+G+HVVFG+V++G +IV+++E+
Sbjct:   22 LYNDIVPKTAENFRALCTGEKG-----FGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVES 142          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO34613 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SNV5])

HSP 1 Score: 193.356 bits (490), Expect = 1.935e-57
Identity = 118/189 (62.43%), Postives = 144/189 (76.19%), Query Frame = 2
Query: 1307 SSKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAA 1873
            S+ K P VT KVFF+I IGG+  G+I IGLFGK VPKT  NF  +A G K        YK S FHRVI+DFM+QGGDFT+GDGTGG SIYG +F DENFKL HYG+GWLSMANAG D+NGSQFFIT   TPWL+GRHVVFGKVL+GM++VR+IE +KT   D+PV +V + + GS+ V+  F+VS++ A
Sbjct:   18 SAAKDPIVTKKVFFDITIGGEKAGRIEIGLFGKAVPKTAENFFQLATGEKG-----FGYKNSIFHRVIQDFMIQGGDFTKGDGTGGKSIYGQKFADENFKLQHYGAGWLSMANAGKDTNGSQFFITTVKTPWLDGRHVVFGKVLKGMDVVRKIEKSKTDHGDRPVKEVKVADSGSLTVDKPFSVSQDEA 201          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO34629 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SNV4])

HSP 1 Score: 182.956 bits (463), Expect = 1.636e-53
Identity = 112/185 (60.54%), Postives = 137/185 (74.05%), Query Frame = 2
Query: 1310 SKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSK 1864
            + KGP VTDK++F++ IGG  +G+IV G+FGKTVPKT  NFK +A G K        YKGS FHR+IKDFM+QGGDF   DGTGG SIYGDRF DENFKL HYG GWLSMANAG D+NGSQFFIT   T WL+G+HVVFGKVLEGM++VR++EN    +   PV   +I + G++P++  F V K
Sbjct:   28 TNKGPLVTDKIYFDVSIGGDKIGRIVFGIFGKTVPKTAKNFKLLATGEKG-----YGYKGSIFHRIIKDFMIQGGDFINKDGTGGRSIYGDRFDDENFKLKHYGPGWLSMANAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKLENVNV-KGSTPVKTCMIDDSGTLPLDKPFNVEK 206          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO34614 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SNV6])

HSP 1 Score: 167.933 bits (424), Expect = 1.728e-48
Identity = 93/159 (58.49%), Postives = 115/159 (72.33%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEA 1870
            LFG T PKTV NF ++A+  +        YK S FHRVIK+FM+QGGDFT  DGTGG SIYG  F DENF L HYG GWL MANAG ++NGSQF+IT   T WL+G H  FGKVLEGM++VR+IENT+   +DKP+ +V I   GSIP+E+ + V+K+A
Sbjct:   17 LFGDTAPKTVANFVALADKEQG-----FGYKDSIFHRVIKNFMIQGGDFTNKDGTGGYSIYGKYFDDENFNLKHYGPGWLCMANAGKNTNGSQFYITTIKTSWLDGSHTCFGKVLEGMDVVRRIENTRVDTHDKPLDEVKITGIGSIPIESPYEVAKDA 170          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO42412 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7S1Q9])

HSP 1 Score: 144.821 bits (364), Expect = 4.076e-40
Identity = 90/166 (54.22%), Postives = 119/166 (71.69%), Query Frame = 2
Query: 1340 VFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDR-FPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            VFF+I IGG+ VG++ + LF   VPKT  NF+    G    +G  + YKG  FHRVIKDFM+QGGDF +GDGTG  SIYG+  F DE+FKL H G+G+LSMAN+G +SNG QFFIT     +L+G+HVVFGKV++G+ ++R+IEN   G N++P  +VVI  CG +
Sbjct:    9 VFFDITIGGQEVGRMKMELFADAVPKTAENFRQFCTGEYRKNGVPVGYKGCVFHRVIKDFMIQGGDFVKGDGTGVMSIYGESAFADESFKLKHDGAGYLSMANSGINSNGCQFFITCAKCDFLDGKHVVFGKVIDGLLVMRKIENVPVGPNNRPKLNVVISQCGEM 174          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO41747 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3C4])

HSP 1 Score: 149.058 bits (375), Expect = 2.111e-39
Identity = 93/180 (51.67%), Postives = 122/180 (67.78%), Query Frame = 2
Query: 1304 VSSKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYK---TSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            V   K  K   + FF++ IGG+ VG+++  LF   VPKT  NF+++  G K    S GK L YKG  FHR+IKDFM+QGGDF+  +GTGG SIYG++F DE+F   H   G LSMAN+GP++NGSQFFIT   TP L+GRHVVFGKVL+GM++VR++E T    +  P S  +I  CG +
Sbjct:    6 VEDPKSKKPNPRCFFDVTIGGEKVGRVLFELFADKVPKTAENFRALCTGEKGIGPSTGKPLHYKGCPFHRIIKDFMVQGGDFSNKNGTGGESIYGEKFADEDFTYKHDKPGLLSMANSGPNTNGSQFFITTVPTPHLDGRHVVFGKVLKGMDVVRELEATPV-DDSSPKSPCIIEECGEL 184          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppib (peptidylprolyl isomerase B [Source:NCBI gene;Acc:101157771])

HSP 1 Score: 220.32 bits (560), Expect = 7.275e-67
Identity = 133/185 (71.89%), Postives = 154/185 (83.24%), Query Frame = 2
Query: 1313 KKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKE 1867
            KKGPKVT KVFF+I IG ++VG++VIGLFGKTVPKTV NF ++A G K        YKGSKFHRVIK FM+QGGDFTRGDGTGG SIYGDRFPDENFKL HYG+GWLSMANAG D+NGSQFFIT   TPWL+G+HVVFGKVLEGM++V++IE+TKT   DKP+ DV+I +CG I VE  FAV+KE
Sbjct:   37 KKGPKVTAKVFFDIRIGDEDVGRVVIGLFGKTVPKTVDNFVALATGEKG-----FGYKGSKFHRVIKQFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGAGWLSMANAGKDTNGSQFFITTVQTPWLDGKHVVFGKVLEGMDVVQKIESTKTDGRDKPLKDVIIHDCGKIEVEKPFAVAKE 216          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppic (peptidylprolyl isomerase C [Source:NCBI gene;Acc:101172089])

HSP 1 Score: 181.8 bits (460), Expect = 1.285e-52
Identity = 111/185 (60.00%), Postives = 138/185 (74.59%), Query Frame = 2
Query: 1307 SSKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVS 1861
            +S++GP+VT+KVFF++ +GG  VG+IVIGLFG+ VP+TV NF  +A G K        YKG+KFHRVIKDFM+QGGDFT GDGTGG SIYG  F DENFKL H G+ W+SMANAGPD+NGSQFFI     PWL+G+HVVFGKVL+GM++V  IE   T   + P ++ VI+N G IPV+  F V 
Sbjct:   22 ASRRGPRVTEKVFFDVTVGGHEVGRIVIGLFGEVVPQTVNNFVVLATGEKG-----YGYKGTKFHRVIKDFMIQGGDFTAGDGTGGHSIYGTTFADENFKLKHLGASWVSMANAGPDTNGSQFFILAARAPWLDGKHVVFGKVLDGMSVVHTIELQDTNDRNLPYTECVIINSGRIPVKEPFVVE 201          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppih (peptidylprolyl isomerase H [Source:NCBI gene;Acc:101166624])

HSP 1 Score: 146.747 bits (369), Expect = 2.369e-40
Identity = 81/147 (55.10%), Postives = 98/147 (66.67%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            LF   VPKT  NF+    G    DG  + YKG  FHRVIKDFM+QGGDF  GDGTG  SIY   F DENFK  H   G LSMAN+GP +NG QFF+T     WL+G+HVVFGKV++G+ I+R+IEN  TG N+KP   ++I  CG +
Sbjct:   31 LFADVVPKTAENFRQFCTGEFRKDGVPIGYKGCTFHRVIKDFMIQGGDFVNGDGTGVCSIYRGPFADENFKHKHSAPGLLSMANSGPGTNGCQFFLTCTKCDWLDGKHVVFGKVVDGLLIMRKIENVPTGPNNKPKLPILIAQCGEM 177          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppiaa (peptidyl-prolyl cis-trans isomerase [Source:NCBI gene;Acc:101156984])

HSP 1 Score: 143.28 bits (360), Expect = 3.311e-39
Identity = 88/166 (53.01%), Postives = 116/166 (69.88%), Query Frame = 2
Query: 1337 KVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            +VFF+I + G   G+IV+ L    VPKT  NF+++  G K        YKGS FHRVI  FM QGGDFT  +GTGG SIYG++F DENF L H G G LSMANAGP++NGSQFFI  + T WL+G+HVVFG+V+EGM++VR++E+  + Q+ K  + + I NCG +
Sbjct:    5 RVFFDIAVDGSPAGRIVMELRADVVPKTAENFRALCTGEKG-----FGYKGSGFHRVIPRFMCQGGDFTNHNGTGGKSIYGNKFADENFTLTHTGPGILSMANAGPNTNGSQFFICTEKTAWLDGKHVVFGQVVEGMDVVRKMESLGS-QSGKTSAKITIANCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ENSORLT00000001785.2 (peptidyl-prolyl cis-trans isomerase [Source:NCBI gene;Acc:101163424])

HSP 1 Score: 141.354 bits (355), Expect = 1.282e-38
Identity = 90/166 (54.22%), Postives = 115/166 (69.28%), Query Frame = 2
Query: 1337 KVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            KVFF+I I G N G+IV+ L    VPKT  NF+++  G K        +KGS FHR+I  FM QGGDFT  DGTGG SIYG+ FPDENF+L H G G LSMANAGP++NGSQFFI    T WLNG+HVVFG VLEG+++V+ +E   + ++  P + V+I +CG +
Sbjct:    5 KVFFDISIDGANAGRIVMELRADAVPKTAENFRALCTGEKG-----FGFKGSSFHRIIPKFMCQGGDFTNHDGTGGKSIYGETFPDENFQLKHKGMGTLSMANAGPNTNGSQFFICTASTDWLNGKHVVFGSVLEGIDVVKAMEKHGS-KSGTPKAKVIIADCGEL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000038766.1 (SMESG000038766.1)

HSP 1 Score: 326.635 bits (836), Expect = 7.514e-108
Identity = 193/193 (100.00%), Postives = 193/193 (100.00%), Query Frame = 2
Query: 1298 QLVSSKKGPKVTDKVFFXXXXXXXXXXXXXXXLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAAD 1876
            QLVSSKKGPKVTDKVFFEIEIGGKNVGKIVIGLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQGGDFTRGDGTGGTSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAAD
Sbjct:   15 QLVSSKKGPKVTDKVFFEIEIGGKNVGKIVIGLFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQGGDFTRGDGTGGTSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAAD 207          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000052204.1 (SMESG000052204.1)

HSP 1 Score: 139.813 bits (351), Expect = 3.091e-38
Identity = 86/149 (57.72%), Postives = 110/149 (73.83%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIE--NTKTGQNDKPVSDVVIVNCGSI 1834
            L+ K VPKTV NF+++  G K        +KGSKFHRVI +FMLQGGDFTRG+GTGG SIYG++F DENFK+ H   G LSMANAGP++NGSQFFIT   T WL+G+HVVFG+V EGM+IV+++E   + +G+  K VS   I +CG +
Sbjct:   22 LYVKDVPKTVENFRALCTGEKG-----FGFKGSKFHRVIPNFMLQGGDFTRGNGTGGKSIYGEKFEDENFKIKHTKPGLLSMANAGPNTNGSQFFITTVITNWLDGKHVVFGEVAEGMDIVQKVEKLGSASGKTSKTVS---ITDCGQL 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000079924.1 (SMESG000079924.1)

HSP 1 Score: 140.969 bits (354), Expect = 6.893e-38
Identity = 86/174 (49.43%), Postives = 107/174 (61.49%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQI-ENTKTGQNDKPVSDVVIVNCGSIPVETSFAVSKEAAD*IDLGIYEVVQI 1912
            LFG   P TV NF S+ +GYKT   KL  Y+G+K HRV+KDF++Q GD   GDGTGG SIYG +F DENF L+H   GW+SMAN GPDSN SQFFI +    WL+G+HVVFGKV++G N V  I E    G    P   + I +CG   +E  + +        DL   E +QI
Sbjct:   53 LFGDLAPMTVLNFASLTKGYKTKSKKL-HYRGTKIHRVVKDFVIQMGDVLNGDGTGGMSIYGPKFDDENFILSHRNPGWVSMANFGPDSNSSQFFILLTKARWLDGKHVVFGKVIKGFNTVSTIGEAHVFGDTSTPAVTIEITDCGIETLERPYTMKSS-----DLNSTEDIQI 220          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000025182.1 (SMESG000025182.1)

HSP 1 Score: 138.272 bits (347), Expect = 2.287e-37
Identity = 78/148 (52.70%), Postives = 100/148 (67.57%), Query Frame = 2
Query: 1394 LFGKTVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYG-DRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            LF   VPKT  NF+    G    DG  + YK S FHR+IK+FM+QGGDF   DGTG  SIYG   F DENF++ H  +G LSMAN+G DSNG QFFIT     +L+G+HVVFG+V++GM ++++IEN  TG N++    VVI NCG +
Sbjct:   40 LFADIVPKTADNFRQFCTGEYRKDGVPIGYKNSTFHRIIKEFMVQGGDFINNDGTGVFSIYGGSMFSDENFEMKHDSAGKLSMANSGKDSNGCQFFITCAPCEFLDGKHVVFGQVVDGMLVLKKIENVPTGPNNRAKIQVVITNCGEM 187          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000006567.1 (SMESG000006567.1)

HSP 1 Score: 135.961 bits (341), Expect = 7.429e-37
Identity = 82/142 (57.75%), Postives = 101/142 (71.13%), Query Frame = 2
Query: 1409 VPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQXXXXXXXXXXXXXSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWLNGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSI 1834
            +PKT  NF+++  G K        YKGSKFHR+I  FMLQGGDFTRG+GTGG SIYG++F DE+FK  H   G LSMANAGP++NGSQFFIT   T WL+G+HVVFG+V EGM IV+ IE   +  + KP   VVI +CG +
Sbjct:   26 IPKTADNFRALCTGEKG-----FGYKGSKFHRIISSFMLQGGDFTRGNGTGGKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGS-DSGKPSKSVVIDDCGQL 161          
The following BLAST results are available for this feature:
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPIB6.167e-6467.57peptidylprolyl isomerase B [Source:HGNC Symbol;Acc... [more]
PPIC4.585e-5563.30peptidylprolyl isomerase C [Source:HGNC Symbol;Acc... [more]
PPIH2.063e-4255.62peptidylprolyl isomerase H [Source:HGNC Symbol;Acc... [more]
PPIH3.723e-4057.86peptidylprolyl isomerase H [Source:HGNC Symbol;Acc... [more]
PPIA2.137e-3752.66peptidylprolyl isomerase A [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyn-64.080e-6165.96Peptidyl-prolyl cis-trans isomerase 6 [Source:Uni... [more]
cyn-64.080e-6165.96Peptidyl-prolyl cis-trans isomerase 6 [Source:Uni... [more]
cyn-51.459e-6067.57Peptidyl-prolyl cis-trans isomerase 5 [Source:Uni... [more]
cyn-51.459e-6067.57Peptidyl-prolyl cis-trans isomerase 5 [Source:Uni... [more]
cyn-31.017e-4256.55Peptidyl-prolyl cis-trans isomerase 3 [Source:Uni... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG28526.907e-6668.06gene:FBgn0034753 transcript:FBtr0071933[more]
CG28526.907e-6668.06gene:FBgn0034753 transcript:FBtr0345504[more]
CG172662.079e-4053.94gene:FBgn0033089 transcript:FBtr0307502[more]
CG172662.079e-4053.94gene:FBgn0033089 transcript:FBtr0086144[more]
ninaA8.005e-3847.40gene:FBgn0002936 transcript:FBtr0078023[more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppib2.820e-6470.81peptidylprolyl isomerase B (cyclophilin B) [Source... [more]
ppic5.385e-5361.50peptidylprolyl isomerase C [Source:ZFIN;Acc:ZDB-GE... [more]
ppih3.365e-4154.55peptidylprolyl isomerase H (cyclophilin H) [Source... [more]
ppih3.365e-4154.55peptidylprolyl isomerase H (cyclophilin H) [Source... [more]
ppid1.335e-3852.81peptidylprolyl isomerase D [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
azin12.278e-5970.69antizyme inhibitor 1 [Source:Xenbase;Acc:XB-GENE-9... [more]
PPIC2.781e-5564.48peptidylprolyl isomerase C (cyclophilin C) [Source... [more]
ppih2.776e-4156.36peptidylprolyl isomerase H [Source:NCBI gene;Acc:3... [more]
ppia9.443e-3750.60peptidylprolyl isomerase A (cyclophilin A) [Source... [more]
pnrc23.895e-3652.67proline rich nuclear receptor coactivator 2 [Sourc... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppib3.904e-6368.11peptidylprolyl isomerase B [Source:MGI Symbol;Acc:... [more]
Ppic1.965e-5564.48peptidylprolyl isomerase C [Source:MGI Symbol;Acc:... [more]
Ppih1.215e-4257.14peptidyl prolyl isomerase H [Source:MGI Symbol;Acc... [more]
Ppih1.416e-4255.62peptidyl prolyl isomerase H [Source:MGI Symbol;Acc... [more]
Ppih1.416e-4255.62peptidyl prolyl isomerase H [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q26551|PPIB_SCHMA8.865e-6767.20Peptidyl-prolyl cis-trans isomerase B OS=Schistoso... [more]
sp|P24367|PPIB_CHICK2.921e-6669.19Peptidyl-prolyl cis-trans isomerase B OS=Gallus ga... [more]
sp|Q27774|PPIB_SCHJA1.240e-6564.40Peptidyl-prolyl cis-trans isomerase B OS=Schistoso... [more]
sp|P24368|PPIB_RAT3.822e-6468.65Peptidyl-prolyl cis-trans isomerase B OS=Rattus no... [more]
sp|P23284|PPIB_HUMAN2.962e-6367.57Peptidyl-prolyl cis-trans isomerase B OS=Homo sapi... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J7038.217e-7374.35Peptidyl-prolyl cis-trans isomerase OS=Lingula ung... [more]
A0A2T7PWM53.588e-7173.44Peptidyl-prolyl cis-trans isomerase OS=Pomacea can... [more]
T1FMP33.366e-7072.92Peptidyl-prolyl cis-trans isomerase OS=Helobdella ... [more]
A0A267EC512.562e-6871.58Peptidyl-prolyl cis-trans isomerase OS=Macrostomum... [more]
A0A291I6Q33.421e-6873.12Peptidyl-prolyl cis-trans isomerase (Fragment) OS=... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppic8.585e-5463.10peptidylprolyl isomerase C [Source:NCBI gene;Acc:1... [more]
ppid1.153e-3755.70peptidylprolyl isomerase D [Source:ZFIN;Acc:ZDB-GE... [more]
ppiab7.000e-3554.41peptidylprolyl isomerase Ab (cyclophilin A) [Sourc... [more]
ppifb7.002e-3547.51peptidyl-prolyl cis-trans isomerase A-like [Source... [more]
ppie2.815e-3252.05peptidylprolyl isomerase E (cyclophilin E) [Source... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010135.17.839e-3850.60pep scaffold:Pmarinus_7.0:GL476417:32947:40880:1 g... [more]
ppig4.557e-3249.33peptidylprolyl isomerase G (cyclophilin G) [Source... [more]
ppifb1.327e-3151.70peptidylprolyl isomerase Fb [Source:ZFIN;Acc:ZDB-G... [more]
ppil12.827e-2945.14peptidylprolyl isomerase (cyclophilin)-like 1 [Sou... [more]
ENSPMAT00000004654.19.907e-2443.54pep scaffold:Pmarinus_7.0:GL489343:42315:43690:-1 ... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CPR68.943e-3853.05Peptidyl-prolyl cis-trans isomerase (cyclophilin);... [more]
CPR21.898e-3753.71Peptidyl-prolyl cis-trans isomerase (cyclophilin);... [more]
CPR52.051e-3749.47Peptidyl-prolyl cis-trans isomerase (cyclophilin) ... [more]
CPR36.697e-3747.43Mitochondrial peptidyl-prolyl cis-trans isomerase ... [more]
CPR13.184e-3659.52Cytoplasmic peptidyl-prolyl cis-trans isomerase (c... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO346131.935e-5762.43Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO346291.636e-5360.54Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO346141.728e-4858.49Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO424124.076e-4054.22Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO417472.111e-3951.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppib7.275e-6771.89peptidylprolyl isomerase B [Source:NCBI gene;Acc:1... [more]
ppic1.285e-5260.00peptidylprolyl isomerase C [Source:NCBI gene;Acc:1... [more]
ppih2.369e-4055.10peptidylprolyl isomerase H [Source:NCBI gene;Acc:1... [more]
ppiaa3.311e-3953.01peptidyl-prolyl cis-trans isomerase [Source:NCBI g... [more]
ENSORLT00000001785.21.282e-3854.22peptidyl-prolyl cis-trans isomerase [Source:NCBI g... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038766.17.514e-108100.00SMESG000038766.1[more]
SMESG000052204.13.091e-3857.72SMESG000052204.1[more]
SMESG000079924.16.893e-3849.43SMESG000079924.1[more]
SMESG000025182.12.287e-3752.70SMESG000025182.1[more]
SMESG000006567.17.429e-3757.75SMESG000006567.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003343 ID=SMED30003343|Name=Peptidyl-prolyl cis-trans isomerase|organism=Schmidtea mediterranea sexual|type=transcript|length=2157bp
CTTACCATTACCAAAGTTGAATTTCAGATGCTGCTGAACCTGAAATAAAG
GGGAAATCCAAACAATCTACCATGACGTACTCGTCACATACAAGCTTTCG
AGCGAGATAACAGTCGTCCTATCTTCCTTCAGACTGGAATAGGTTTAGTG
TCTGGTTCTTGACGACCACAATCCAGTGGCTAAAGATCAAAAGTTCACCG
AAGCCATCTAGAGTGTTTTATTAGCAAAAAATATATCCTGCTGTTAGAAA
ATTTCTTCTGGGCAAATGGATCCATGATTAAATTATGTAAGACCTTGGAT
TATATGTCTGCTGAATTACGTATTATTTCATAAGTATTCCTAATGTAAAC
AATAAGTAGTTCAGCGATGAATAAATGCATTTGAAAATTGATCATCGGTC
AAATCCTGCAACACTGTATTGGTTCATTACCAGTAGTGCGCTGGAGCTGG
TGAATTTCTAAGTCTAAGTATTCCATCTCAACCGAGACTTTGTGAAAATT
TATAATTAAAAATAAGCCGAGAAAAAATATTCGATGAAACGCATCATGGA
AGTCGGTTGAGAAAATAGTGACGCTGACAGAATTAGTCAGTCACTTCATG
ACTCATGAACACTGTCCGATGAAATAATTCTGAACTAATATTTTATCGTC
TCATGTATTTTCATAGAAGGGCAAAACTGGTTTCCAGAGGAGGTAAAATT
GAAATTTTATGATTTTTGATTAAGGGTGATGAATGGCCTGGACAGGAATG
TAAACTCTACTTATGCAGCCTGAATAGATCATCCAAAATGGTGGTTGTTG
TCACCTCCAGCATGACATACAAGCGCAAGGAATAAATATCTGGTTATATT
TGTACAAATTCAACGCATTTTGAATAAAATACAGTATAACATACTGCATT
ACATTAACATTTAAATATAACCATTTGAATAGAATACACTTGTCATTTGA
TTATTTAATTGTAAATATTTAATTTTTTTTGCTTTTTAACTTTCTGACTA
TTTTTGAATAAAATTTTTAGATCTTATTTAATAAAATAATTTAACGCTAT
AAATTAAGAACAATTTCAAAGTATAATTTTATTTTTTCATTGACACTACA
TGTGCAATTGATTTTTGAAAATCACATTCGTTTAAATTGATCAAATTTAA
TTTTTAGGTGGCATTTATTTTTACTTTATACGTAACATTACATTTATTTG
CTATATATATATCAATTAACCTACAATATCTAAATTACTTAATTTCAAAC
TAGTCATGAAGATAGCCTTTCTATTTTCAATTGCATTTTTAATTTTCCAG
TTGGTTTCTAGTAAAAAAGGTCCAAAAGTAACTGACAAAGTTTTCTTTGA
AATCGAAATTGGTGGTAAAAATGTTGGTAAAATTGTTATTGGTCTATTCG
GCAAAACTGTTCCAAAAACTGTTACCAATTTTAAATCAATAGCTGAAGGA
TATAAAACAAGTGATGGGAAATTATTGACTTATAAAGGCAGCAAATTCCA
CCGTGTAATTAAAGACTTCATGCTACAAGGAGGTGATTTTACTCGTGGTG
ATGGAACCGGAGGGACTAGCATTTATGGAGATAGATTTCCCGATGAAAAT
TTCAAATTAAATCACTATGGATCCGGATGGTTATCAATGGCAAATGCAGG
ACCCGATTCAAATGGCAGTCAATTTTTTATCACCGTTAAAGATACGCCGT
GGTTGAATGGTAGACATGTTGTGTTTGGAAAAGTTTTGGAGGGAATGAAT
ATAGTGAGACAGATTGAAAATACAAAAACTGGTCAAAATGATAAACCAGT
TAGCGATGTAGTTATAGTAAATTGTGGCTCAATTCCAGTAGAAACATCTT
TTGCTGTATCAAAAGAAGCAGCCGATTAAATTGATTTGGGAATATACGAA
GTTGTACAGATTGGAATCGTTTCTAGTTTTTATTTCAAATTTGAGTGTTA
TTATAAATTTCGTAATTATATTGATTTATTTCCTATATAATTAAAAAAAT
CAAACAAAATGCTTTAAATTGTATGGTAGCCAGATAAAAAATTGTATTGT
TAAAGACTTGATTAGAAAAAATGATGAAATTACCTTATGTAACCTGGGGA
ACTATTTGCATAAAGATAGTACCTGATGGGAGTAATCTTTGCGACATAAA
TCAGCTA
back to top

protein sequence of SMED30003343-orf-1

>SMED30003343-orf-1 ID=SMED30003343-orf-1|Name=SMED30003343-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=208bp
MKIAFLFSIAFLIFQLVSSKKGPKVTDKVFFEIEIGGKNVGKIVIGLFGK
TVPKTVTNFKSIAEGYKTSDGKLLTYKGSKFHRVIKDFMLQGGDFTRGDG
TGGTSIYGDRFPDENFKLNHYGSGWLSMANAGPDSNGSQFFITVKDTPWL
NGRHVVFGKVLEGMNIVRQIENTKTGQNDKPVSDVVIVNCGSIPVETSFA
VSKEAAD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000101muscle cell
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR024936Cyclophilin-type_PPIase
IPR002130Cyclophilin-type_PPIase_dom
IPR029000Cyclophilin-like_dom_sf
IPR020892Cyclophilin-type_PPIase_CS
Vocabulary: biological process
TermDefinition
GO:0000413protein peptidyl-prolyl isomerization
GO:0006457protein folding
Vocabulary: molecular function
TermDefinition
GO:0003755peptidyl-prolyl cis-trans isomerase activity
GO:0016853isomerase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002130Cyclophilin-type peptidyl-prolyl cis-trans isomerase domainPRINTSPR00153CSAPPISMRASEcoord: 81..93
score: 77.1
coord: 124..139
score: 75.73
coord: 152..167
score: 62.06
coord: 47..62
score: 48.16
coord: 139..151
score: 56.05
IPR002130Cyclophilin-type peptidyl-prolyl cis-trans isomerase domainPFAMPF00160Pro_isomerasecoord: 31..191
e-value: 2.2E-48
score: 164.5
IPR002130Cyclophilin-type peptidyl-prolyl cis-trans isomerase domainPROSITEPS50072CSA_PPIASE_2coord: 30..192
score: 44.268
IPR024936Cyclophilin-type peptidyl-prolyl cis-trans isomerasePIRSFPIRSF001467Peptidylpro_ismrsecoord: 13..198
e-value: 2.8E-79
score: 262.5
IPR029000Cyclophilin-like domain superfamilyGENE3DG3DSA:2.40.100.10coord: 15..204
e-value: 1.3E-81
score: 274.6
IPR029000Cyclophilin-like domain superfamilySUPERFAMILYSSF50891Cyclophilin-likecoord: 23..193
NoneNo IPR availablePANTHERPTHR11071:SF293PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 6coord: 8..204
NoneNo IPR availablePANTHERPTHR11071PEPTIDYL-PROLYL CIS-TRANS ISOMERASEcoord: 8..204
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.867
IPR020892Cyclophilin-type peptidyl-prolyl cis-trans isomerase, conserved sitePROSITEPS00170CSA_PPIASE_1coord: 76..93