Ankyrin repeat-containing, putative

Overview
NameAnkyrin repeat-containing, putative
Smed IDSMED30003330
Length (bp)1693
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ankyrin repeat-containing, putative (SMED30003330) t-SNE clustered cells

Violin plots show distribution of expression levels for Ankyrin repeat-containing, putative (SMED30003330) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ankyrin repeat-containing, putative (SMED30003330) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ankyrin repeat-containing, putative (SMED30003330) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003330

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30003330SMESG000034407.1 SmedASXL_014344SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30003330SMESG000034407.1 Contig34143newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003330SMESG000034407.1 Contig34143uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30003330SMESG000034407.1 dd_Smed_v6_17293_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30003330SMESG000034407.1 dd_Smed_v4_17293_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 126.331 bits (316), Expect = 1.227e-29
Identity = 91/292 (31.16%), Postives = 140/292 (47.95%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ SF G+  I+  L+Q G   N S   +   PLH AA +     ++ L+    +++AK     TPLH AA  G  N++ LLL+N AN +       TPL  A R G +  V  LL    +     K   T LH AA+ G   +  +LL+ DA  +A  + GLTPL  AV ++   +V++L+      +   +  G T LH+A ++N V +   LL+ G      +    G + +H A      E+V L L    N +     L + +  +P  LV + GH+ +A VL
Sbjct:  438 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKV-ETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAW-NGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQ--GVTPLHLAAQEGHAEMVALLLSKQANGN-----LGNKSGLTPLHLVAQEGHVPVADVL 720          

HSP 2 Score: 108.612 bits (270), Expect = 7.440e-24
Identity = 80/256 (31.25%), Postives = 122/256 (47.66%), Query Frame = 3
Query:  525 PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            PLH AA    L+ +QLL+N G  ++     G TPLH A+  G   ++ LLL  GA  +++     TPL  A R+G +   + LL  G  +  K KN  + +H AA+    D + +LL+YDA ID      LTPL  A       V ++L+        R    G T LH+A +KN+V ++E+LLK G           G + +H A +     +V+  L    + +    K+     ++P  +    GH E+AK L
Sbjct:  242 PLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRAL-NGFTPLHIACKKNHVRVMELLLKTGASI--DAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKV-----ETPLHMAARAGHTEVAKYL 489          

HSP 3 Score: 108.227 bits (269), Expect = 9.039e-24
Identity = 86/295 (29.15%), Postives = 137/295 (46.44%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR---SKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +  G+  +   L+  G   N      F  PLH A   + +   +LL+  G  IDA    G TPLH A+  G   ++  LLQ GA+ +  ++  +TPL  A R+G     K LL     VN K K++ T LH AAR G  +++ +LL+ +A  +     G TPL  A        V  L+    S+  + K+ +    T LHVA +   V + E+LL+          N  G + +H AV +N  ++V+L L    +   PA         +P  +  ++  +E+A+ L
Sbjct:  372 LTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGF-TPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGF----TPLHVAAKYGKVRVAELLLERDAHPNAAGKN--GLTPLHVAVHHNNLDIVKLLLPRGGSPHSPA-----WNGYTPLHIAAKQNQVEVARSL 654          

HSP 4 Score: 92.4337 bits (228), Expect = 9.423e-19
Identity = 80/296 (27.03%), Postives = 129/296 (43.58%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNF-NNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVC 1304
             P+H+ + +G+   +  L++        T   F  PLH AA   ++  ++LL+      +A    G TPLH A      +++ LLL  G +  S      TPL  A +  ++   + LL  G + N +     T LH AA++G A+++ +LL   A  +  N+ GLTPL          V  +LI+    +     R G T LHVA     + LV+ LL   +   + N     G S +H A      ++V L L    N   P +  + GT  +P  +    G++ +  VL  V 
Sbjct:  538 TPLHIAAREGHVETVLALLEKEASQACMTKKGF-TPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGV-MVDATTRMGYTPLHVASHYGNIKLVKFLL---QHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLL---KNGASPNEVSSDGT--TPLAIAKRLGYISVTDVLKVVT 823          

HSP 5 Score: 92.0485 bits (227), Expect = 1.359e-18
Identity = 83/334 (24.85%), Postives = 142/334 (42.51%), Query Frame = 3
Query:  390 EVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGEN---------------------------------NLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            ++      +L P+H  +  G+  I   L+  G  + Q+ T     P+H AA    L C +LL+    +ID       TPLH AA  G +                                  ++ LLL+ GA+ D+   +  TPL  A+  G +  VK LL  G + NV +   +T LH AAR G  ++   LL+  A+++A+ +   TPL  A      ++V++L+ +  +        G T LH+A R+ +V  V  LL+  K   +      G + +H A  Y +  +  L L  + + +   K        +P  + +   +L++ K+L
Sbjct:  297 QIETKTKDELTPLHCAARNGHVRISEILLDHGAPI-QAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNAN-PNLATTAGHTPLHIAAREGHVETVLALLE--KEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKN-----GLTPLHVAVHHNNLDIVKLL 621          

HSP 6 Score: 90.1225 bits (222), Expect = 4.847e-18
Identity = 59/219 (26.94%), Postives = 106/219 (48.40%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEML 1073
            L P+H+        I+  L+  G   +      +  PLH AA  +Q+  ++ L+  GG  +A+   G TPLH AA++G   ++ LLL   AN +  + +  TPL    + G +     L+  G  V+   +   T LH A+  G+  L+  LL++ A ++A+ + G +PL +A       +V +L+++     +     G T L +A R  Y+ + ++L
Sbjct:  603 LTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGY-TPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVS-SDGTTPLAIAKRLGYISVTDVL 819          

HSP 7 Score: 67.0106 bits (162), Expect = 8.714e-11
Identity = 67/255 (26.27%), Postives = 99/255 (38.82%), Query Frame = 3
Query:  615 GNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNV-----------------------------KDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            GNT LH AA  G++ ++  L+  GAN ++Q     TPL  A +   +  VK LL  G N NV                             K K    ALH AAR        +LL+ D   D  ++ G TPL  A  Y   +V Q+L+     +     + G T LH+A R+  V +V +LL  G        +    + +H A       +  + L H        K        SP  +  +  HL+  ++L
Sbjct:  111 GNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASV-NFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDEL--TPLHCAARNGHVRISEILLDHGAPIQAKTKN-----GLSPIHMAAQGDHLDCVRLL 357          

HSP 8 Score: 51.2174 bits (121), Expect = 6.519e-6
Identity = 39/137 (28.47%), Postives = 68/137 (49.64%), Query Frame = 3
Query:  675 LQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            L+NG + ++ +      L  A++ G +  V  LL     +    K  +TALH AA  G  +++  L+ Y A ++AQ+Q G TPL  A   +   VV+ L+ +  +        G T L VA+++ + ++V  L+  G
Sbjct:   65 LRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGAN-QNVATEDGFTPLAVALQQGHENVVAHLINYG 200          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 125.946 bits (315), Expect = 1.647e-29
Identity = 91/292 (31.16%), Postives = 140/292 (47.95%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ SF G+  I+  L+Q G   N S   +   PLH AA +     ++ L+    +++AK     TPLH AA  G  N++ LLL+N AN +       TPL  A R G +  V  LL    +     K   T LH AA+ G   +  +LL+ DA  +A  + GLTPL  AV ++   +V++L+      +   +  G T LH+A ++N V +   LL+ G      +    G + +H A      E+V L L    N +     L + +  +P  LV + GH+ +A VL
Sbjct:  405 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKV-ETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAW-NGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQ--GVTPLHLAAQEGHAEMVALLLSKQANGN-----LGNKSGLTPLHLVAQEGHVPVADVL 687          

HSP 2 Score: 108.227 bits (269), Expect = 8.938e-24
Identity = 80/256 (31.25%), Postives = 122/256 (47.66%), Query Frame = 3
Query:  525 PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            PLH AA    L+ +QLL+N G  ++     G TPLH A+  G   ++ LLL  GA  +++     TPL  A R+G +   + LL  G  +  K KN  + +H AA+    D + +LL+YDA ID      LTPL  A       V ++L+        R    G T LH+A +KN+V ++E+LLK G           G + +H A +     +V+  L    + +    K+     ++P  +    GH E+AK L
Sbjct:  209 PLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRAL-NGFTPLHIACKKNHVRVMELLLKTGASI--DAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKV-----ETPLHMAARAGHTEVAKYL 456          

HSP 3 Score: 107.842 bits (268), Expect = 1.176e-23
Identity = 86/295 (29.15%), Postives = 137/295 (46.44%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR---SKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +  G+  +   L+  G   N      F  PLH A   + +   +LL+  G  IDA    G TPLH A+  G   ++  LLQ GA+ +  ++  +TPL  A R+G     K LL     VN K K++ T LH AAR G  +++ +LL+ +A  +     G TPL  A        V  L+    S+  + K+ +    T LHVA +   V + E+LL+          N  G + +H AV +N  ++V+L L    +   PA         +P  +  ++  +E+A+ L
Sbjct:  339 LTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGF-TPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGF----TPLHVAAKYGKVRVAELLLERDAHPNAAGKN--GLTPLHVAVHHNNLDIVKLLLPRGGSPHSPA-----WNGYTPLHIAAKQNQVEVARSL 621          

HSP 4 Score: 92.4337 bits (228), Expect = 9.321e-19
Identity = 95/365 (26.03%), Postives = 151/365 (41.37%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNF-NNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWS----------KNSNTVKRI------EFQELEEVKSLRQWCRKVIRRQLGFHIYEKLQKINLPPAL 1463
             P+H+ + +G+   +  L++        T   F  PLH AA   ++  ++LL+      +A    G TPLH A      +++ LLL  G +  S      TPL  A +  ++   + LL  G + N +     T LH AA++G A+++ +LL   A  +  N+ GLTPL          V  +LI+    +     R G T LHVA     + LV+ LL   +   + N     G S +H A      ++V L L    N   P +  + GT  +P  +    G++ +  VL  V    S              TV  I      E +EL   K+ R+  R V   +       KL ++   PA+
Sbjct:  505 TPLHIAAREGHVETVLALLEKEASQACMTKKGF-TPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGV-MVDATTRMGYTPLHVASHYGNIKLVKFLL---QHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLL---KNGASPNEVSSDGT--TPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESPAI 859          

HSP 5 Score: 91.6633 bits (226), Expect = 1.643e-18
Identity = 83/334 (24.85%), Postives = 142/334 (42.51%), Query Frame = 3
Query:  390 EVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGEN---------------------------------NLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            ++      +L P+H  +  G+  I   L+  G  + Q+ T     P+H AA    L C +LL+    +ID       TPLH AA  G +                                  ++ LLL+ GA+ D+   +  TPL  A+  G +  VK LL  G + NV +   +T LH AAR G  ++   LL+  A+++A+ +   TPL  A      ++V++L+ +  +        G T LH+A R+ +V  V  LL+  K   +      G + +H A  Y +  +  L L  + + +   K        +P  + +   +L++ K+L
Sbjct:  264 QIETKTKDELTPLHCAARNGHVRISEILLDHGAPI-QAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNAN-PNLATTAGHTPLHIAAREGHVETVLALLE--KEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKN-----GLTPLHVAVHHNNLDIVKLL 588          

HSP 6 Score: 89.7373 bits (221), Expect = 6.226e-18
Identity = 59/219 (26.94%), Postives = 106/219 (48.40%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEML 1073
            L P+H+        I+  L+  G   +      +  PLH AA  +Q+  ++ L+  GG  +A+   G TPLH AA++G   ++ LLL   AN +  + +  TPL    + G +     L+  G  V+   +   T LH A+  G+  L+  LL++ A ++A+ + G +PL +A       +V +L+++     +     G T L +A R  Y+ + ++L
Sbjct:  570 LTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGY-TPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVS-SDGTTPLAIAKRLGYISVTDVL 786          

HSP 7 Score: 66.6254 bits (161), Expect = 1.024e-10
Identity = 67/255 (26.27%), Postives = 99/255 (38.82%), Query Frame = 3
Query:  615 GNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNV-----------------------------KDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            GNT LH AA  G++ ++  L+  GAN ++Q     TPL  A +   +  VK LL  G N NV                             K K    ALH AAR        +LL+ D   D  ++ G TPL  A  Y   +V Q+L+     +     + G T LH+A R+  V +V +LL  G        +    + +H A       +  + L H        K        SP  +  +  HL+  ++L
Sbjct:   78 GNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASV-NFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDEL--TPLHCAARNGHVRISEILLDHGAPIQAKTKN-----GLSPIHMAAQGDHLDCVRLL 324          

HSP 8 Score: 50.8322 bits (120), Expect = 7.215e-6
Identity = 39/137 (28.47%), Postives = 68/137 (49.64%), Query Frame = 3
Query:  675 LQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            L+NG + ++ +      L  A++ G +  V  LL     +    K  +TALH AA  G  +++  L+ Y A ++AQ+Q G TPL  A   +   VV+ L+ +  +        G T L VA+++ + ++V  L+  G
Sbjct:   32 LRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGAN-QNVATEDGFTPLAVALQQGHENVVAHLINYG 167          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 125.946 bits (315), Expect = 1.738e-29
Identity = 91/292 (31.16%), Postives = 140/292 (47.95%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ SF G+  I+  L+Q G   N S   +   PLH AA +     ++ L+    +++AK     TPLH AA  G  N++ LLL+N AN +       TPL  A R G +  V  LL    +     K   T LH AA+ G   +  +LL+ DA  +A  + GLTPL  AV ++   +V++L+      +   +  G T LH+A ++N V +   LL+ G      +    G + +H A      E+V L L    N +     L + +  +P  LV + GH+ +A VL
Sbjct:  405 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKV-ETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAW-NGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQ--GVTPLHLAAQEGHAEMVALLLSKQANGN-----LGNKSGLTPLHLVAQEGHVPVADVL 687          

HSP 2 Score: 108.227 bits (269), Expect = 8.860e-24
Identity = 80/256 (31.25%), Postives = 122/256 (47.66%), Query Frame = 3
Query:  525 PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            PLH AA    L+ +QLL+N G  ++     G TPLH A+  G   ++ LLL  GA  +++     TPL  A R+G +   + LL  G  +  K KN  + +H AA+    D + +LL+YDA ID      LTPL  A       V ++L+        R    G T LH+A +KN+V ++E+LLK G           G + +H A +     +V+  L    + +    K+     ++P  +    GH E+AK L
Sbjct:  209 PLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRAL-NGFTPLHIACKKNHVRVMELLLKTGASI--DAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKV-----ETPLHMAARAGHTEVAKYL 456          

HSP 3 Score: 107.842 bits (268), Expect = 1.262e-23
Identity = 86/295 (29.15%), Postives = 137/295 (46.44%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR---SKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +  G+  +   L+  G   N      F  PLH A   + +   +LL+  G  IDA    G TPLH A+  G   ++  LLQ GA+ +  ++  +TPL  A R+G     K LL     VN K K++ T LH AAR G  +++ +LL+ +A  +     G TPL  A        V  L+    S+  + K+ +    T LHVA +   V + E+LL+          N  G + +H AV +N  ++V+L L    +   PA         +P  +  ++  +E+A+ L
Sbjct:  339 LTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGF-TPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGF----TPLHVAAKYGKVRVAELLLERDAHPNAAGKN--GLTPLHVAVHHNNLDIVKLLLPRGGSPHSPA-----WNGYTPLHIAAKQNQVEVARSL 621          

HSP 4 Score: 92.4337 bits (228), Expect = 8.619e-19
Identity = 95/365 (26.03%), Postives = 151/365 (41.37%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNF-NNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWS----------KNSNTVKRI------EFQELEEVKSLRQWCRKVIRRQLGFHIYEKLQKINLPPAL 1463
             P+H+ + +G+   +  L++        T   F  PLH AA   ++  ++LL+      +A    G TPLH A      +++ LLL  G +  S      TPL  A +  ++   + LL  G + N +     T LH AA++G A+++ +LL   A  +  N+ GLTPL          V  +LI+    +     R G T LHVA     + LV+ LL   +   + N     G S +H A      ++V L L    N   P +  + GT  +P  +    G++ +  VL  V    S              TV  I      E +EL   K+ R+  R V   +       KL ++   PA+
Sbjct:  505 TPLHIAAREGHVETVLALLEKEASQACMTKKGF-TPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGV-MVDATTRMGYTPLHVASHYGNIKLVKFLL---QHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLL---KNGASPNEVSSDGT--TPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESPAI 859          

HSP 5 Score: 91.6633 bits (226), Expect = 1.731e-18
Identity = 83/334 (24.85%), Postives = 142/334 (42.51%), Query Frame = 3
Query:  390 EVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGEN---------------------------------NLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            ++      +L P+H  +  G+  I   L+  G  + Q+ T     P+H AA    L C +LL+    +ID       TPLH AA  G +                                  ++ LLL+ GA+ D+   +  TPL  A+  G +  VK LL  G + NV +   +T LH AAR G  ++   LL+  A+++A+ +   TPL  A      ++V++L+ +  +        G T LH+A R+ +V  V  LL+  K   +      G + +H A  Y +  +  L L  + + +   K        +P  + +   +L++ K+L
Sbjct:  264 QIETKTKDELTPLHCAARNGHVRISEILLDHGAPI-QAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNAN-PNLATTAGHTPLHIAAREGHVETVLALLE--KEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKN-----GLTPLHVAVHHNNLDIVKLL 588          

HSP 6 Score: 89.7373 bits (221), Expect = 5.910e-18
Identity = 59/219 (26.94%), Postives = 106/219 (48.40%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEML 1073
            L P+H+        I+  L+  G   +      +  PLH AA  +Q+  ++ L+  GG  +A+   G TPLH AA++G   ++ LLL   AN +  + +  TPL    + G +     L+  G  V+   +   T LH A+  G+  L+  LL++ A ++A+ + G +PL +A       +V +L+++     +     G T L +A R  Y+ + ++L
Sbjct:  570 LTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGY-TPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVS-SDGTTPLAIAKRLGYISVTDVL 786          

HSP 7 Score: 66.6254 bits (161), Expect = 1.060e-10
Identity = 67/255 (26.27%), Postives = 99/255 (38.82%), Query Frame = 3
Query:  615 GNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNV-----------------------------KDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            GNT LH AA  G++ ++  L+  GAN ++Q     TPL  A +   +  VK LL  G N NV                             K K    ALH AAR        +LL+ D   D  ++ G TPL  A  Y   +V Q+L+     +     + G T LH+A R+  V +V +LL  G        +    + +H A       +  + L H        K        SP  +  +  HL+  ++L
Sbjct:   78 GNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASV-NFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDEL--TPLHCAARNGHVRISEILLDHGAPIQAKTKN-----GLSPIHMAAQGDHLDCVRLL 324          

HSP 8 Score: 51.2174 bits (121), Expect = 6.457e-6
Identity = 39/137 (28.47%), Postives = 68/137 (49.64%), Query Frame = 3
Query:  675 LQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            L+NG + ++ +      L  A++ G +  V  LL     +    K  +TALH AA  G  +++  L+ Y A ++AQ+Q G TPL  A   +   VV+ L+ +  +        G T L VA+++ + ++V  L+  G
Sbjct:   32 LRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGAN-QNVATEDGFTPLAVALQQGHENVVAHLINYG 167          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 124.02 bits (310), Expect = 8.125e-29
Identity = 88/293 (30.03%), Postives = 142/293 (48.46%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +F G+ +I+  L+  G   N +T       LH AA S Q    + L+  G Q++AK     TPLH +A  G+ +++  LLQ GA+ ++   +  TPL  + R G       LL  G ++++  K   T LH AA+ G  ++  +LL+  A  DA  + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +KN + +   LL+ G    + N     G + VH A      ++V L L  N N +     L++ +  +P  L  +   + +A+VL
Sbjct:  417 LTPIHVAAFMGHVNIVSQLMHHGASPN-TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAA-AKNGYTPLHIAAKKNQMDIATTLLEYGA---DANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVN-----LSNKSGLTPLHLAAQEDRVNVAEVL 699          

HSP 2 Score: 102.834 bits (255), Expect = 4.896e-22
Identity = 80/308 (25.97%), Postives = 140/308 (45.45%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKR 1340
            L  +H+ +  G++ +   L+    + N      F  PLH A   +++   +LL+  G  I A    G TP+H AA  G  N+++ L+ +GA+ ++ ++  +T L  A RSG+   V+ L+  G  V  K K++ T LH +AR G AD++  LL+  A  +A    G TPL  +     + V   L+     L     + G T LHVA +   + +  +LL+  K          G + +H A  Y+  ++  L L    +    AK        +P  +  ++  +++A  L      +  ++N V R
Sbjct:  351 LTALHVAAHCGHYKVAKVLLDKKANPNAKALNGF-TPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASL-SITTKKGFTPLHVAAKYGKLEVANLLLQ--KSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK-----NGYTPLHIAAKKNQMDIATTL----LEYGADANAVTR 645          

HSP 3 Score: 96.6709 bits (239), Expect = 3.738e-20
Identity = 68/257 (26.46%), Postives = 118/257 (45.91%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHN 1190
             P+HL + +G+  +  +L+  G  ++ +T   F  PLH AA   +L  + LL+      DA    G TPLH AA      +  LLL  GA+  +      TPL  A +  ++     LL  G + N   +    ++H AA++G  D++ +LL  +A ++  N+ GLTPL  A    + +V ++L+     +  +  + G T LHV      + +V  LL+          N +  + +H A       ++ + L +N
Sbjct:  517 TPLHLSAREGHEDVAAFLLDHGASLSITTKKGF-TPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQ-TKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGY--TPLHQAAQQGHTHIINVLLQNN 769          

HSP 4 Score: 90.5077 bits (223), Expect = 3.208e-18
Identity = 80/258 (31.01%), Postives = 114/258 (44.19%), Query Frame = 3
Query:  453 FSILHYLIQSGVD------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRS--KCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNF 1199
            F+ L   +Q G D      +   T    R P LH AA       + LL+      D +   G TPLH AA  G  N+ TLLL   A  D     + TPL  A++ G    VK LL  G  ++ K ++  T LH  AR G   ++ MLL   A I ++ + GL+PL  A      + VQ+L++     D    DY    TALHVA    +  + ++LL           N F  + +H A   NR +++ L L H  + 
Sbjct:  157 FTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYL---TALHVAAHCGHYKVAKVLLDKKANPNAKALNGF--TPLHIACKKNRIKVMELLLKHGASI 409          

HSP 5 Score: 85.5001 bits (210), Expect = 1.494e-16
Identity = 56/219 (25.57%), Postives = 109/219 (49.77%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEML 1073
            L P+H+ +      +   L+  G   + +    +  PLH AA  +Q+  +  L+  G   +A    G   +H AA++G  ++++LLL   AN +  + +  TPL  A +  R+   + L+  G +V+ + K   T LH     G+  ++  LL++ A+++A+ + G TPL +A       ++ +L+++     +     G+TAL +A R  Y+ +V+ L
Sbjct:  582 LTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGY-TPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTV-NGNTALGIARRLGYISVVDTL 798          

HSP 6 Score: 82.4185 bits (202), Expect = 1.175e-15
Identity = 72/299 (24.08%), Postives = 124/299 (41.47%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQID---------------------------------AKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAK 1214
            L P+H  +  G+  ++  L+     +   T      PLH A     L+C QLL+     +D                                 AK   G TPLH A +     ++ LLL++GA+  +   +  TP+  A   G +  V +L+  G + N  +   +TALH AAR G A+++  L++  A+++A+ +   TPL  +    +  +VQ L++           +G T LH++ R+ +  +   LL  G          F  + +H A  Y + E+  L L  + + D   K
Sbjct:  285 LTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGL-SPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS-PNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGF--TPLHVAAKYGKLEVANLLLQKSASPDAAGK 579          

HSP 7 Score: 75.0998 bits (183), Expect = 2.640e-13
Identity = 91/371 (24.53%), Postives = 134/371 (36.12%), Query Frame = 3
Query:  363 KFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNV-----------------------------NVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRD------------------------------YRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            K D NA +    R+ H +               L Y I++GVD+N          LH A+    +     L+     +DA    GNT LH A+  G+  ++ +L+ NGAN ++Q     TPL  A +   +  VK LL  G +                              + K K    ALH AAR+       +LL+ D   D +++ G TPL  A  Y   +V  +L+   +  D   R+                               R G T LH   R  +  +VEMLL      +    N  G S +H A   +    V+L L HN   D       +        +    GH ++AKVL
Sbjct:   21 KSDANASYLRAARAGHLE-------------KALDY-IKNGVDINICNQNGLNA-LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKN--GLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTA-----LHVAAHCGHYKVAKVL 369          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 123.635 bits (309), Expect = 1.101e-28
Identity = 88/293 (30.03%), Postives = 142/293 (48.46%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +F G+ +I+  L+  G   N +T       LH AA S Q    + L+  G Q++AK     TPLH +A  G+ +++  LLQ GA+ ++   +  TPL  + R G       LL  G ++++  K   T LH AA+ G  ++  +LL+  A  DA  + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +KN + +   LL+ G    + N     G + VH A      ++V L L  N N +     L++ +  +P  L  +   + +A+VL
Sbjct:  428 LTPIHVAAFMGHVNIVSQLMHHGASPN-TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAA-AKNGYTPLHIAAKKNQMDIATTLLEYGA---DANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVN-----LSNKSGLTPLHLAAQEDRVNVAEVL 710          

HSP 2 Score: 102.449 bits (254), Expect = 5.388e-22
Identity = 80/308 (25.97%), Postives = 140/308 (45.45%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKR 1340
            L  +H+ +  G++ +   L+    + N      F  PLH A   +++   +LL+  G  I A    G TP+H AA  G  N+++ L+ +GA+ ++ ++  +T L  A RSG+   V+ L+  G  V  K K++ T LH +AR G AD++  LL+  A  +A    G TPL  +     + V   L+     L     + G T LHVA +   + +  +LL+  K          G + +H A  Y+  ++  L L    +    AK        +P  +  ++  +++A  L      +  ++N V R
Sbjct:  362 LTALHVAAHCGHYKVAKVLLDKKANPNAKALNGF-TPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASL-SITTKKGFTPLHVAAKYGKLEVANLLLQ--KSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-----GYTPLHIAAKKNQMDIATTL----LEYGADANAVTR 656          

HSP 3 Score: 96.6709 bits (239), Expect = 4.371e-20
Identity = 68/257 (26.46%), Postives = 118/257 (45.91%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHN 1190
             P+HL + +G+  +  +L+  G  ++ +T   F  PLH AA   +L  + LL+      DA    G TPLH AA      +  LLL  GA+  +      TPL  A +  ++     LL  G + N   +    ++H AA++G  D++ +LL  +A ++  N+ GLTPL  A    + +V ++L+     +  +  + G T LHV      + +V  LL+          N +  + +H A       ++ + L +N
Sbjct:  528 TPLHLSAREGHEDVAAFLLDHGASLSITTKKGF-TPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQ-TKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGY--TPLHQAAQQGHTHIINVLLQNN 780          

HSP 4 Score: 90.5077 bits (223), Expect = 3.815e-18
Identity = 80/258 (31.01%), Postives = 114/258 (44.19%), Query Frame = 3
Query:  453 FSILHYLIQSGVD------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRS--KCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNF 1199
            F+ L   +Q G D      +   T    R P LH AA       + LL+      D +   G TPLH AA  G  N+ TLLL   A  D     + TPL  A++ G    VK LL  G  ++ K ++  T LH  AR G   ++ MLL   A I ++ + GL+PL  A      + VQ+L++     D    DY    TALHVA    +  + ++LL           N F  + +H A   NR +++ L L H  + 
Sbjct:  168 FTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYL---TALHVAAHCGHYKVAKVLLDKKANPNAKALNGF--TPLHIACKKNRIKVMELLLKHGASI 420          

HSP 5 Score: 84.7297 bits (208), Expect = 2.168e-16
Identity = 56/219 (25.57%), Postives = 109/219 (49.77%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEML 1073
            L P+H+ +      +   L+  G   + +    +  PLH AA  +Q+  +  L+  G   +A    G   +H AA++G  ++++LLL   AN +  + +  TPL  A +  R+   + L+  G +V+ + K   T LH     G+  ++  LL++ A+++A+ + G TPL +A       ++ +L+++     +     G+TAL +A R  Y+ +V+ L
Sbjct:  593 LTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGY-TPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTV-NGNTALGIARRLGYISVVDTL 809          

HSP 6 Score: 82.0333 bits (201), Expect = 1.549e-15
Identity = 72/299 (24.08%), Postives = 124/299 (41.47%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQID---------------------------------AKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAK 1214
            L P+H  +  G+  ++  L+     +   T      PLH A     L+C QLL+     +D                                 AK   G TPLH A +     ++ LLL++GA+  +   +  TP+  A   G +  V +L+  G + N  +   +TALH AAR G A+++  L++  A+++A+ +   TPL  +    +  +VQ L++           +G T LH++ R+ +  +   LL  G          F  + +H A  Y + E+  L L  + + D   K
Sbjct:  296 LTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGL-SPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS-PNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGF--TPLHVAAKYGKLEVANLLLQKSASPDAAGK 590          

HSP 7 Score: 74.7146 bits (182), Expect = 3.081e-13
Identity = 91/371 (24.53%), Postives = 137/371 (36.93%), Query Frame = 3
Query:  363 KFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKN----------------------EDT-------ALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRD------------------------------YRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            K D NA +    R+ H +               L Y I++GVD+N          LH A+    +     L+     +DA    GNT LH A+  G+  ++ +L+ NGAN ++Q     TPL  A +   +  VK LL  G + ++  ++                       DT       ALH AAR+       +LL+ D   D +++ G TPL  A  Y   +V  +L+   +  D   R+                               R G T LH   R  +  +VEMLL      +    N  G S +H A   +    V+L L HN   D       +        +    GH ++AKVL
Sbjct:   32 KSDANASYLRAARAGHLE-------------KALDY-IKNGVDINICNQNGLNA-LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKN--GLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTA-----LHVAAHCGHYKVAKVL 380          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 114.39 bits (285), Expect = 3.964e-26
Identity = 88/317 (27.76%), Postives = 146/317 (46.06%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCD---LYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKRIEFQEL 1358
            L P+H+ +  G+  +   L+    D N      F  PLH A   +++   +LL+     I+A    G TPLH AA  G  N++  LLQ GAN D + +  +TPL  A R+ +   V+ L+  G  V+ + +   T LH A+R G+ D++I+LL+  A  +A  +   +PL  A    Q+ V  IL+    D   L K+ +    T LH+A +   + +V +LL+ G        N    + +H A  YN  ++  L L +       + K A+    +P  +  ++  +E+A  L      +  + N   R  F  L
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGF-TPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF----TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQV--TPLHVAAHYNNDKVAMLLLENGA-----SAKAAAKNGYTPLHIAAKKNQMEIASTL----LQFKADPNAKSRAGFTPL 660          

HSP 2 Score: 110.153 bits (274), Expect = 8.781e-25
Identity = 69/229 (30.13%), Postives = 119/229 (51.97%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK 1079
            +  +    L P+H+ +F G  +I+ YL+Q G + +  T      PLH AA ++Q    ++LI  G ++DA+     TPLH A+  G  +++ LLLQ GANS++    N +PL  A + G+      LL    +  +  K   T LH A++ G+ +++ +LL+    +D + +  +TPL  A  Y+   V  +L+ +     K   + G T LH+A +KN + +   LL+
Sbjct:  418 IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR-GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGAS-AKAAAKNGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 3 Score: 105.531 bits (262), Expect = 2.213e-23
Identity = 89/300 (29.67%), Postives = 142/300 (47.33%), Query Frame = 3
Query:  402 SNHKDL-CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            S  KDL  P+H  +  G+  ++  L+  G  ++  T      PLH AA    +  ++ L+     +D       TPLH AA  G   +  LLL   A+ +S+ +   TPL  A +  RI  V+ LL     +    ++  T LH AA  G+ +++I LL+  A  D +   G TPL  A   +Q  VV++LIR  +K D   R+ +   T LH+A R     +V +LL+AG        +N+  S +H A    + E+  + L HN +     K L +    +P  L  + G+LE+ ++L
Sbjct:  288 SRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGL-APLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ---TPLHIASRLGNTDIVILLLQAGANSNATTRDNY--SPLHIAAKEGQEEVAGILLDHNAD-----KTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 4 Score: 90.1225 bits (222), Expect = 1.909e-18
Identity = 80/258 (31.01%), Postives = 114/258 (44.19%), Query Frame = 3
Query:  435 VSFKGYFSILHYLIQSGVD-------VNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILI--RSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFL 1181
            +S +  F+ L   +Q G D        N S   +    LH AA     + + LL+      D     G TPLH AA  G  N+  LLL+ GAN + Q   N +PL  AT+ GR      LL  G  ++ + K+  T LH AAR G   ++ +L+   A I A+ + GL PL  A         + L+  R+  D    DY    T LHVA    +V + ++LL           N F  + +H A   NR ++V L L
Sbjct:  160 LSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL---TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGF--TPLHIACKKNRIKVVELLL 412          

HSP 5 Score: 89.7373 bits (221), Expect = 2.082e-18
Identity = 82/287 (28.57%), Postives = 136/287 (47.39%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLI--NAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNF-NNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGH 1271
             P+H+ S  G   I+  L+Q+G + N +T   +  PLH AA   Q   + +L+  NA   +  K  F  TPLH A++ G   ++ LLL+ G   D +     TPL  A           LL  G +     KN  T LH AA++   ++   LL++ A  +A+++ G TPL  +     + +  +LI +  D+  +    G TA+H+  ++++V + ++L   G    E N   N G + +H A  + +  +V+ FL+ N   D   K  AS T   P     ++GH
Sbjct:  493 TPLHIASRLGNTDIVILLLQAGANSNATTRDNY-SPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF--TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAK-ANNGLTAMHLCAQEDHVPVAQILYNNGA---EINSKTNAGYTPLHVACHFGQLNMVK-FLVEN-GADVGEKTRASYT---PLHQAAQQGH 767          

HSP 6 Score: 84.3445 bits (207), Expect = 1.132e-16
Identity = 66/230 (28.70%), Postives = 108/230 (46.96%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDV-----NQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            K   P+HL S  G   ++  L++ G  V     NQ T      PLH AA  +    + LL+  G    A    G TPLH AA+  +  + + LLQ  A+ +++     TPL  + + G       L+  G +V  K  N  TA+H  A++    +  +L    A I+++   G TPL  A  + Q ++V+ L+ +  D+ ++  R   T LH A ++ + + V  LL+ G
Sbjct:  556 KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVT------PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEK-TRASYTPLHQAAQQGHNNCVRYLLENG 778          

HSP 7 Score: 79.337 bits (194), Expect = 4.477e-15
Identity = 60/184 (32.61%), Postives = 85/184 (46.20%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
             P+H+ + K    I   L+Q   D N  +   F  PLH +A       S LLI  G  + AK   G T +H  A++    +  +L  NGA  +S+     TPL  A   G++  VK L+  G +V  K +   T LH AA+QG  + +  LL+  A  + Q   G TPL  A      SVV+ L
Sbjct:  625 TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGF-TPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 8 Score: 77.7962 bits (190), Expect = 1.148e-14
Identity = 84/340 (24.71%), Postives = 134/340 (39.41%), Query Frame = 3
Query:  471 LIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDAR-----------------------------IDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCD--------------------------LYKR----DYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMH-----NYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L+++G D+N S        LH A+        + LI    Q+DA    GNT LH A+  G++ ++T+L++NGAN + Q +   TPL  A +      VK LL  G N  +  ++  T L  A +QG   ++ +LL+ D++                              D  ++ G TPL  A  Y  ++V Q+L+    +                          L  R    D RT D  T LH A R  +  +V++L+  G        N  G + +H A   +  +  R  L H     +   DY           +P  +    GH+ +AK+L
Sbjct:   52 LLRAGTDINTSNANGLNS-LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKN--GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY----------LTPLHVAAHCGHVRVAKLL 378          

HSP 9 Score: 52.7582 bits (125), Expect = 8.065e-7
Identity = 55/231 (23.81%), Postives = 104/231 (45.02%), Query Frame = 3
Query:  615 GNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCD--LYKRDYRTGDTALHVAVRKNYVHLVEMLLK---AGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            G+     AA  G+   +  LL+ G + ++ +      L  A++ G    V+ L+     V+   +  +TALH A+  G + ++ +L++  A ++ Q+  G TPL  A   + + VV+ L++   +  L   D   G T L VA+++ +  +V +LL+    GK  +           +H A   +      L L + +N D  +K   SG   +P  +    GH  + ++L
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTED---GFTPLAVALQQGHDRVVAVLLENDSKGKVRL---------PALHIAAKKDDTTAATLLLQNEHNPDVTSK---SGF--TPLHIAAHYGHENVGQLL 246          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 114.39 bits (285), Expect = 3.964e-26
Identity = 88/317 (27.76%), Postives = 146/317 (46.06%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCD---LYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKRIEFQEL 1358
            L P+H+ +  G+  +   L+    D N      F  PLH A   +++   +LL+     I+A    G TPLH AA  G  N++  LLQ GAN D + +  +TPL  A R+ +   V+ L+  G  V+ + +   T LH A+R G+ D++I+LL+  A  +A  +   +PL  A    Q+ V  IL+    D   L K+ +    T LH+A +   + +V +LL+ G        N    + +H A  YN  ++  L L +       + K A+    +P  +  ++  +E+A  L      +  + N   R  F  L
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGF-TPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF----TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQV--TPLHVAAHYNNDKVAMLLLENGA-----SAKAAAKNGYTPLHIAAKKNQMEIASTL----LQFKADPNAKSRAGFTPL 660          

HSP 2 Score: 110.153 bits (274), Expect = 8.781e-25
Identity = 69/229 (30.13%), Postives = 119/229 (51.97%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK 1079
            +  +    L P+H+ +F G  +I+ YL+Q G + +  T      PLH AA ++Q    ++LI  G ++DA+     TPLH A+  G  +++ LLLQ GANS++    N +PL  A + G+      LL    +  +  K   T LH A++ G+ +++ +LL+    +D + +  +TPL  A  Y+   V  +L+ +     K   + G T LH+A +KN + +   LL+
Sbjct:  418 IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR-GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGAS-AKAAAKNGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 3 Score: 105.531 bits (262), Expect = 2.213e-23
Identity = 89/300 (29.67%), Postives = 142/300 (47.33%), Query Frame = 3
Query:  402 SNHKDL-CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            S  KDL  P+H  +  G+  ++  L+  G  ++  T      PLH AA    +  ++ L+     +D       TPLH AA  G   +  LLL   A+ +S+ +   TPL  A +  RI  V+ LL     +    ++  T LH AA  G+ +++I LL+  A  D +   G TPL  A   +Q  VV++LIR  +K D   R+ +   T LH+A R     +V +LL+AG        +N+  S +H A    + E+  + L HN +     K L +    +P  L  + G+LE+ ++L
Sbjct:  288 SRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGL-APLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ---TPLHIASRLGNTDIVILLLQAGANSNATTRDNY--SPLHIAAKEGQEEVAGILLDHNAD-----KTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 4 Score: 90.1225 bits (222), Expect = 1.909e-18
Identity = 80/258 (31.01%), Postives = 114/258 (44.19%), Query Frame = 3
Query:  435 VSFKGYFSILHYLIQSGVD-------VNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILI--RSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFL 1181
            +S +  F+ L   +Q G D        N S   +    LH AA     + + LL+      D     G TPLH AA  G  N+  LLL+ GAN + Q   N +PL  AT+ GR      LL  G  ++ + K+  T LH AAR G   ++ +L+   A I A+ + GL PL  A         + L+  R+  D    DY    T LHVA    +V + ++LL           N F  + +H A   NR ++V L L
Sbjct:  160 LSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL---TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGF--TPLHIACKKNRIKVVELLL 412          

HSP 5 Score: 89.7373 bits (221), Expect = 2.082e-18
Identity = 82/287 (28.57%), Postives = 136/287 (47.39%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLI--NAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNF-NNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGH 1271
             P+H+ S  G   I+  L+Q+G + N +T   +  PLH AA   Q   + +L+  NA   +  K  F  TPLH A++ G   ++ LLL+ G   D +     TPL  A           LL  G +     KN  T LH AA++   ++   LL++ A  +A+++ G TPL  +     + +  +LI +  D+  +    G TA+H+  ++++V + ++L   G    E N   N G + +H A  + +  +V+ FL+ N   D   K  AS T   P     ++GH
Sbjct:  493 TPLHIASRLGNTDIVILLLQAGANSNATTRDNY-SPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF--TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAK-ANNGLTAMHLCAQEDHVPVAQILYNNGA---EINSKTNAGYTPLHVACHFGQLNMVK-FLVEN-GADVGEKTRASYT---PLHQAAQQGH 767          

HSP 6 Score: 84.3445 bits (207), Expect = 1.132e-16
Identity = 66/230 (28.70%), Postives = 108/230 (46.96%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDV-----NQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            K   P+HL S  G   ++  L++ G  V     NQ T      PLH AA  +    + LL+  G    A    G TPLH AA+  +  + + LLQ  A+ +++     TPL  + + G       L+  G +V  K  N  TA+H  A++    +  +L    A I+++   G TPL  A  + Q ++V+ L+ +  D+ ++  R   T LH A ++ + + V  LL+ G
Sbjct:  556 KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVT------PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEK-TRASYTPLHQAAQQGHNNCVRYLLENG 778          

HSP 7 Score: 79.337 bits (194), Expect = 4.477e-15
Identity = 60/184 (32.61%), Postives = 85/184 (46.20%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
             P+H+ + K    I   L+Q   D N  +   F  PLH +A       S LLI  G  + AK   G T +H  A++    +  +L  NGA  +S+     TPL  A   G++  VK L+  G +V  K +   T LH AA+QG  + +  LL+  A  + Q   G TPL  A      SVV+ L
Sbjct:  625 TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGF-TPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 8 Score: 77.7962 bits (190), Expect = 1.148e-14
Identity = 84/340 (24.71%), Postives = 134/340 (39.41%), Query Frame = 3
Query:  471 LIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDAR-----------------------------IDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCD--------------------------LYKR----DYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMH-----NYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L+++G D+N S        LH A+        + LI    Q+DA    GNT LH A+  G++ ++T+L++NGAN + Q +   TPL  A +      VK LL  G N  +  ++  T L  A +QG   ++ +LL+ D++                              D  ++ G TPL  A  Y  ++V Q+L+    +                          L  R    D RT D  T LH A R  +  +V++L+  G        N  G + +H A   +  +  R  L H     +   DY           +P  +    GH+ +AK+L
Sbjct:   52 LLRAGTDINTSNANGLNS-LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKN--GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY----------LTPLHVAAHCGHVRVAKLL 378          

HSP 9 Score: 52.7582 bits (125), Expect = 8.065e-7
Identity = 55/231 (23.81%), Postives = 104/231 (45.02%), Query Frame = 3
Query:  615 GNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCD--LYKRDYRTGDTALHVAVRKNYVHLVEMLLK---AGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            G+     AA  G+   +  LL+ G + ++ +      L  A++ G    V+ L+     V+   +  +TALH A+  G + ++ +L++  A ++ Q+  G TPL  A   + + VV+ L++   +  L   D   G T L VA+++ +  +V +LL+    GK  +           +H A   +      L L + +N D  +K   SG   +P  +    GH  + ++L
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTED---GFTPLAVALQQGHDRVVAVLLENDSKGKVRL---------PALHIAAKKDDTTAATLLLQNEHNPDVTSK---SGF--TPLHIAAHYGHENVGQLL 246          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 114.39 bits (285), Expect = 4.141e-26
Identity = 88/317 (27.76%), Postives = 146/317 (46.06%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCD---LYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKRIEFQEL 1358
            L P+H+ +  G+  +   L+    D N      F  PLH A   +++   +LL+     I+A    G TPLH AA  G  N++  LLQ GAN D + +  +TPL  A R+ +   V+ L+  G  V+ + +   T LH A+R G+ D++I+LL+  A  +A  +   +PL  A    Q+ V  IL+    D   L K+ +    T LH+A +   + +V +LL+ G        N    + +H A  YN  ++  L L +       + K A+    +P  +  ++  +E+A  L      +  + N   R  F  L
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGF-TPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF----TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQV--TPLHVAAHYNNDKVAMLLLENGA-----SAKAAAKNGYTPLHIAAKKNQMEIASTL----LQFKADPNAKSRAGFTPL 660          

HSP 2 Score: 109.768 bits (273), Expect = 9.755e-25
Identity = 69/229 (30.13%), Postives = 119/229 (51.97%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK 1079
            +  +    L P+H+ +F G  +I+ YL+Q G + +  T      PLH AA ++Q    ++LI  G ++DA+     TPLH A+  G  +++ LLLQ GANS++    N +PL  A + G+      LL    +  +  K   T LH A++ G+ +++ +LL+    +D + +  +TPL  A  Y+   V  +L+ +     K   + G T LH+A +KN + +   LL+
Sbjct:  418 IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR-GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGAS-AKAAAKNGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 3 Score: 105.531 bits (262), Expect = 2.501e-23
Identity = 89/300 (29.67%), Postives = 142/300 (47.33%), Query Frame = 3
Query:  402 SNHKDL-CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            S  KDL  P+H  +  G+  ++  L+  G  ++  T      PLH AA    +  ++ L+     +D       TPLH AA  G   +  LLL   A+ +S+ +   TPL  A +  RI  V+ LL     +    ++  T LH AA  G+ +++I LL+  A  D +   G TPL  A   +Q  VV++LIR  +K D   R+ +   T LH+A R     +V +LL+AG        +N+  S +H A    + E+  + L HN +     K L +    +P  L  + G+LE+ ++L
Sbjct:  288 SRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGL-APLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ---TPLHIASRLGNTDIVILLLQAGANSNATTRDNY--SPLHIAAKEGQEEVAGILLDHNAD-----KTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 4 Score: 89.7373 bits (221), Expect = 2.132e-18
Identity = 78/262 (29.77%), Postives = 116/262 (44.27%), Query Frame = 3
Query:  402 SNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILI--RSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFL 1181
            S      P+ +   +G+  ++  L++     N S   +    LH AA     + + LL+      D     G TPLH AA  G  N+  LLL+ GAN + Q   N +PL  AT+ GR      LL  G  ++ + K+  T LH AAR G   ++ +L+   A I A+ + GL PL  A         + L+  R+  D    DY    T LHVA    +V + ++LL           N F  + +H A   NR ++V L L
Sbjct:  161 STEDGFTPLAVALQQGHDRVVAVLLE-----NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL---TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGF--TPLHIACKKNRIKVVELLL 412          

HSP 5 Score: 89.7373 bits (221), Expect = 2.306e-18
Identity = 82/287 (28.57%), Postives = 136/287 (47.39%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLI--NAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNF-NNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGH 1271
             P+H+ S  G   I+  L+Q+G + N +T   +  PLH AA   Q   + +L+  NA   +  K  F  TPLH A++ G   ++ LLL+ G   D +     TPL  A           LL  G +     KN  T LH AA++   ++   LL++ A  +A+++ G TPL  +     + +  +LI +  D+  +    G TA+H+  ++++V + ++L   G    E N   N G + +H A  + +  +V+ FL+ N   D   K  AS T   P     ++GH
Sbjct:  493 TPLHIASRLGNTDIVILLLQAGANSNATTRDNY-SPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF--TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAK-ANNGLTAMHLCAQEDHVPVAQILYNNGA---EINSKTNAGYTPLHVACHFGQLNMVK-FLVEN-GADVGEKTRASYT---PLHQAAQQGH 767          

HSP 6 Score: 84.3445 bits (207), Expect = 1.242e-16
Identity = 66/230 (28.70%), Postives = 108/230 (46.96%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDV-----NQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            K   P+HL S  G   ++  L++ G  V     NQ T      PLH AA  +    + LL+  G    A    G TPLH AA+  +  + + LLQ  A+ +++     TPL  + + G       L+  G +V  K  N  TA+H  A++    +  +L    A I+++   G TPL  A  + Q ++V+ L+ +  D+ ++  R   T LH A ++ + + V  LL+ G
Sbjct:  556 KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVT------PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEK-TRASYTPLHQAAQQGHNNCVRYLLENG 778          

HSP 7 Score: 78.9518 bits (193), Expect = 4.994e-15
Identity = 60/184 (32.61%), Postives = 85/184 (46.20%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
             P+H+ + K    I   L+Q   D N  +   F  PLH +A       S LLI  G  + AK   G T +H  A++    +  +L  NGA  +S+     TPL  A   G++  VK L+  G +V  K +   T LH AA+QG  + +  LL+  A  + Q   G TPL  A      SVV+ L
Sbjct:  625 TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGF-TPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 8 Score: 77.7962 bits (190), Expect = 1.194e-14
Identity = 84/340 (24.71%), Postives = 134/340 (39.41%), Query Frame = 3
Query:  471 LIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDAR-----------------------------IDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCD--------------------------LYKR----DYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMH-----NYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L+++G D+N S        LH A+        + LI    Q+DA    GNT LH A+  G++ ++T+L++NGAN + Q +   TPL  A +      VK LL  G N  +  ++  T L  A +QG   ++ +LL+ D++                              D  ++ G TPL  A  Y  ++V Q+L+    +                          L  R    D RT D  T LH A R  +  +V++L+  G        N  G + +H A   +  +  R  L H     +   DY           +P  +    GH+ +AK+L
Sbjct:   52 LLRAGTDINTSNANGLNS-LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKN--GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY----------LTPLHVAAHCGHVRVAKLL 378          

HSP 9 Score: 52.373 bits (124), Expect = 8.518e-7
Identity = 55/231 (23.81%), Postives = 104/231 (45.02%), Query Frame = 3
Query:  615 GNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCD--LYKRDYRTGDTALHVAVRKNYVHLVEMLLK---AGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            G+     AA  G+   +  LL+ G + ++ +      L  A++ G    V+ L+     V+   +  +TALH A+  G + ++ +L++  A ++ Q+  G TPL  A   + + VV+ L++   +  L   D   G T L VA+++ +  +V +LL+    GK  +           +H A   +      L L + +N D  +K   SG   +P  +    GH  + ++L
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTED---GFTPLAVALQQGHDRVVAVLLENDSKGKVRL---------PALHIAAKKDDTTAATLLLQNEHNPDVTSK---SGF--TPLHIAAHYGHENVGQLL 246          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 114.39 bits (285), Expect = 4.141e-26
Identity = 88/317 (27.76%), Postives = 146/317 (46.06%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCD---LYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKRIEFQEL 1358
            L P+H+ +  G+  +   L+    D N      F  PLH A   +++   +LL+     I+A    G TPLH AA  G  N++  LLQ GAN D + +  +TPL  A R+ +   V+ L+  G  V+ + +   T LH A+R G+ D++I+LL+  A  +A  +   +PL  A    Q+ V  IL+    D   L K+ +    T LH+A +   + +V +LL+ G        N    + +H A  YN  ++  L L +       + K A+    +P  +  ++  +E+A  L      +  + N   R  F  L
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGF-TPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF----TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQV--TPLHVAAHYNNDKVAMLLLENGA-----SAKAAAKNGYTPLHIAAKKNQMEIASTL----LQFKADPNAKSRAGFTPL 660          

HSP 2 Score: 109.768 bits (273), Expect = 9.755e-25
Identity = 69/229 (30.13%), Postives = 119/229 (51.97%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK 1079
            +  +    L P+H+ +F G  +I+ YL+Q G + +  T      PLH AA ++Q    ++LI  G ++DA+     TPLH A+  G  +++ LLLQ GANS++    N +PL  A + G+      LL    +  +  K   T LH A++ G+ +++ +LL+    +D + +  +TPL  A  Y+   V  +L+ +     K   + G T LH+A +KN + +   LL+
Sbjct:  418 IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR-GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGAS-AKAAAKNGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 3 Score: 105.531 bits (262), Expect = 2.501e-23
Identity = 89/300 (29.67%), Postives = 142/300 (47.33%), Query Frame = 3
Query:  402 SNHKDL-CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            S  KDL  P+H  +  G+  ++  L+  G  ++  T      PLH AA    +  ++ L+     +D       TPLH AA  G   +  LLL   A+ +S+ +   TPL  A +  RI  V+ LL     +    ++  T LH AA  G+ +++I LL+  A  D +   G TPL  A   +Q  VV++LIR  +K D   R+ +   T LH+A R     +V +LL+AG        +N+  S +H A    + E+  + L HN +     K L +    +P  L  + G+LE+ ++L
Sbjct:  288 SRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGL-APLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ---TPLHIASRLGNTDIVILLLQAGANSNATTRDNY--SPLHIAAKEGQEEVAGILLDHNAD-----KTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 4 Score: 89.7373 bits (221), Expect = 2.132e-18
Identity = 78/262 (29.77%), Postives = 116/262 (44.27%), Query Frame = 3
Query:  402 SNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILI--RSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFL 1181
            S      P+ +   +G+  ++  L++     N S   +    LH AA     + + LL+      D     G TPLH AA  G  N+  LLL+ GAN + Q   N +PL  AT+ GR      LL  G  ++ + K+  T LH AAR G   ++ +L+   A I A+ + GL PL  A         + L+  R+  D    DY    T LHVA    +V + ++LL           N F  + +H A   NR ++V L L
Sbjct:  161 STEDGFTPLAVALQQGHDRVVAVLLE-----NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL---TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGF--TPLHIACKKNRIKVVELLL 412          

HSP 5 Score: 89.7373 bits (221), Expect = 2.306e-18
Identity = 82/287 (28.57%), Postives = 136/287 (47.39%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLI--NAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNF-NNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGH 1271
             P+H+ S  G   I+  L+Q+G + N +T   +  PLH AA   Q   + +L+  NA   +  K  F  TPLH A++ G   ++ LLL+ G   D +     TPL  A           LL  G +     KN  T LH AA++   ++   LL++ A  +A+++ G TPL  +     + +  +LI +  D+  +    G TA+H+  ++++V + ++L   G    E N   N G + +H A  + +  +V+ FL+ N   D   K  AS T   P     ++GH
Sbjct:  493 TPLHIASRLGNTDIVILLLQAGANSNATTRDNY-SPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF--TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAK-ANNGLTAMHLCAQEDHVPVAQILYNNGA---EINSKTNAGYTPLHVACHFGQLNMVK-FLVEN-GADVGEKTRASYT---PLHQAAQQGH 767          

HSP 6 Score: 84.3445 bits (207), Expect = 1.242e-16
Identity = 66/230 (28.70%), Postives = 108/230 (46.96%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDV-----NQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            K   P+HL S  G   ++  L++ G  V     NQ T      PLH AA  +    + LL+  G    A    G TPLH AA+  +  + + LLQ  A+ +++     TPL  + + G       L+  G +V  K  N  TA+H  A++    +  +L    A I+++   G TPL  A  + Q ++V+ L+ +  D+ ++  R   T LH A ++ + + V  LL+ G
Sbjct:  556 KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVT------PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEK-TRASYTPLHQAAQQGHNNCVRYLLENG 778          

HSP 7 Score: 78.9518 bits (193), Expect = 4.994e-15
Identity = 60/184 (32.61%), Postives = 85/184 (46.20%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
             P+H+ + K    I   L+Q   D N  +   F  PLH +A       S LLI  G  + AK   G T +H  A++    +  +L  NGA  +S+     TPL  A   G++  VK L+  G +V  K +   T LH AA+QG  + +  LL+  A  + Q   G TPL  A      SVV+ L
Sbjct:  625 TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGF-TPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 8 Score: 77.7962 bits (190), Expect = 1.194e-14
Identity = 84/340 (24.71%), Postives = 134/340 (39.41%), Query Frame = 3
Query:  471 LIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDAR-----------------------------IDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCD--------------------------LYKR----DYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMH-----NYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L+++G D+N S        LH A+        + LI    Q+DA    GNT LH A+  G++ ++T+L++NGAN + Q +   TPL  A +      VK LL  G N  +  ++  T L  A +QG   ++ +LL+ D++                              D  ++ G TPL  A  Y  ++V Q+L+    +                          L  R    D RT D  T LH A R  +  +V++L+  G        N  G + +H A   +  +  R  L H     +   DY           +P  +    GH+ +AK+L
Sbjct:   52 LLRAGTDINTSNANGLNS-LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKN--GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY----------LTPLHVAAHCGHVRVAKLL 378          

HSP 9 Score: 52.373 bits (124), Expect = 8.518e-7
Identity = 55/231 (23.81%), Postives = 104/231 (45.02%), Query Frame = 3
Query:  615 GNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCD--LYKRDYRTGDTALHVAVRKNYVHLVEMLLK---AGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            G+     AA  G+   +  LL+ G + ++ +      L  A++ G    V+ L+     V+   +  +TALH A+  G + ++ +L++  A ++ Q+  G TPL  A   + + VV+ L++   +  L   D   G T L VA+++ +  +V +LL+    GK  +           +H A   +      L L + +N D  +K   SG   +P  +    GH  + ++L
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTED---GFTPLAVALQQGHDRVVAVLLENDSKGKVRL---------PALHIAAKKDDTTAATLLLQNEHNPDVTSK---SGF--TPLHIAAHYGHENVGQLL 246          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 114.005 bits (284), Expect = 4.798e-26
Identity = 88/317 (27.76%), Postives = 146/317 (46.06%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCD---LYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKRIEFQEL 1358
            L P+H+ +  G+  +   L+    D N      F  PLH A   +++   +LL+     I+A    G TPLH AA  G  N++  LLQ GAN D + +  +TPL  A R+ +   V+ L+  G  V+ + +   T LH A+R G+ D++I+LL+  A  +A  +   +PL  A    Q+ V  IL+    D   L K+ +    T LH+A +   + +V +LL+ G        N    + +H A  YN  ++  L L +       + K A+    +P  +  ++  +E+A  L      +  + N   R  F  L
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGF-TPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF----TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQV--TPLHVAAHYNNDKVAMLLLENGA-----SAKAAAKNGYTPLHIAAKKNQMEIASTL----LQFKADPNAKSRAGFTPL 660          

HSP 2 Score: 110.153 bits (274), Expect = 9.297e-25
Identity = 69/229 (30.13%), Postives = 119/229 (51.97%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK 1079
            +  +    L P+H+ +F G  +I+ YL+Q G + +  T      PLH AA ++Q    ++LI  G ++DA+     TPLH A+  G  +++ LLLQ GANS++    N +PL  A + G+      LL    +  +  K   T LH A++ G+ +++ +LL+    +D + +  +TPL  A  Y+   V  +L+ +     K   + G T LH+A +KN + +   LL+
Sbjct:  418 IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR-GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGAS-AKAAAKNGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 3 Score: 105.531 bits (262), Expect = 2.514e-23
Identity = 89/300 (29.67%), Postives = 142/300 (47.33%), Query Frame = 3
Query:  402 SNHKDL-CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            S  KDL  P+H  +  G+  ++  L+  G  ++  T      PLH AA    +  ++ L+     +D       TPLH AA  G   +  LLL   A+ +S+ +   TPL  A +  RI  V+ LL     +    ++  T LH AA  G+ +++I LL+  A  D +   G TPL  A   +Q  VV++LIR  +K D   R+ +   T LH+A R     +V +LL+AG        +N+  S +H A    + E+  + L HN +     K L +    +P  L  + G+LE+ ++L
Sbjct:  288 SRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGL-APLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ---TPLHIASRLGNTDIVILLLQAGANSNATTRDNY--SPLHIAAKEGQEEVAGILLDHNAD-----KTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 4 Score: 89.7373 bits (221), Expect = 2.220e-18
Identity = 78/262 (29.77%), Postives = 116/262 (44.27%), Query Frame = 3
Query:  402 SNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILI--RSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFL 1181
            S      P+ +   +G+  ++  L++     N S   +    LH AA     + + LL+      D     G TPLH AA  G  N+  LLL+ GAN + Q   N +PL  AT+ GR      LL  G  ++ + K+  T LH AAR G   ++ +L+   A I A+ + GL PL  A         + L+  R+  D    DY    T LHVA    +V + ++LL           N F  + +H A   NR ++V L L
Sbjct:  161 STEDGFTPLAVALQQGHDRVVAVLLE-----NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL---TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGF--TPLHIACKKNRIKVVELLL 412          

HSP 5 Score: 89.7373 bits (221), Expect = 2.279e-18
Identity = 82/287 (28.57%), Postives = 136/287 (47.39%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLI--NAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNF-NNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGH 1271
             P+H+ S  G   I+  L+Q+G + N +T   +  PLH AA   Q   + +L+  NA   +  K  F  TPLH A++ G   ++ LLL+ G   D +     TPL  A           LL  G +     KN  T LH AA++   ++   LL++ A  +A+++ G TPL  +     + +  +LI +  D+  +    G TA+H+  ++++V + ++L   G    E N   N G + +H A  + +  +V+ FL+ N   D   K  AS T   P     ++GH
Sbjct:  493 TPLHIASRLGNTDIVILLLQAGANSNATTRDNY-SPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF--TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAK-ANNGLTAMHLCAQEDHVPVAQILYNNGA---EINSKTNAGYTPLHVACHFGQLNMVK-FLVEN-GADVGEKTRASYT---PLHQAAQQGH 767          

HSP 6 Score: 84.3445 bits (207), Expect = 1.327e-16
Identity = 66/230 (28.70%), Postives = 108/230 (46.96%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDV-----NQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            K   P+HL S  G   ++  L++ G  V     NQ T      PLH AA  +    + LL+  G    A    G TPLH AA+  +  + + LLQ  A+ +++     TPL  + + G       L+  G +V  K  N  TA+H  A++    +  +L    A I+++   G TPL  A  + Q ++V+ L+ +  D+ ++  R   T LH A ++ + + V  LL+ G
Sbjct:  556 KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVT------PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEK-TRASYTPLHQAAQQGHNNCVRYLLENG 778          

HSP 7 Score: 78.9518 bits (193), Expect = 5.429e-15
Identity = 60/184 (32.61%), Postives = 85/184 (46.20%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
             P+H+ + K    I   L+Q   D N  +   F  PLH +A       S LLI  G  + AK   G T +H  A++    +  +L  NGA  +S+     TPL  A   G++  VK L+  G +V  K +   T LH AA+QG  + +  LL+  A  + Q   G TPL  A      SVV+ L
Sbjct:  625 TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGF-TPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 8 Score: 77.7962 bits (190), Expect = 1.265e-14
Identity = 84/340 (24.71%), Postives = 134/340 (39.41%), Query Frame = 3
Query:  471 LIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDAR-----------------------------IDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCD--------------------------LYKR----DYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMH-----NYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L+++G D+N S        LH A+        + LI    Q+DA    GNT LH A+  G++ ++T+L++NGAN + Q +   TPL  A +      VK LL  G N  +  ++  T L  A +QG   ++ +LL+ D++                              D  ++ G TPL  A  Y  ++V Q+L+    +                          L  R    D RT D  T LH A R  +  +V++L+  G        N  G + +H A   +  +  R  L H     +   DY           +P  +    GH+ +AK+L
Sbjct:   52 LLRAGTDINTSNANGLNS-LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKN--GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY----------LTPLHVAAHCGHVRVAKLL 378          

HSP 9 Score: 52.373 bits (124), Expect = 8.724e-7
Identity = 55/231 (23.81%), Postives = 104/231 (45.02%), Query Frame = 3
Query:  615 GNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCD--LYKRDYRTGDTALHVAVRKNYVHLVEMLLK---AGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            G+     AA  G+   +  LL+ G + ++ +      L  A++ G    V+ L+     V+   +  +TALH A+  G + ++ +L++  A ++ Q+  G TPL  A   + + VV+ L++   +  L   D   G T L VA+++ +  +V +LL+    GK  +           +H A   +      L L + +N D  +K   SG   +P  +    GH  + ++L
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTED---GFTPLAVALQQGHDRVVAVLLENDSKGKVRL---------PALHIAAKKDDTTAATLLLQNEHNPDVTSK---SGF--TPLHIAAHYGHENVGQLL 246          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 120.168 bits (300), Expect = 4.890e-28
Identity = 85/303 (28.05%), Postives = 147/303 (48.51%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQ-PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            +  +    L P+H+ +F G  +I+ YL+Q   D +    T+  + PLH AA ++Q    ++L+  G Q+DA+     TPLH A+  G  +++ LLLQ+GA  D+      T L  A + G+      L+  G  ++   K   T LH  A+ G   +  +LL+ +A +DAQ + G+TPL  A  Y+ Q V  +L+      +    + G T LH+A RKN + +   LL+ G      +   F  + +H +      E+  L + H    ++PAK        +P  L  +  ++ +A++L +
Sbjct:  396 ISATTESGLTPLHVAAFMGCMNIVIYLLQH--DASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHA-TAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGF--TPLHLSSQEGHAEISNLLIEHKAAVNHPAKN-----GLTPMHLCAQEDNVNVAEILEK 688          

HSP 2 Score: 109.383 bits (272), Expect = 1.338e-24
Identity = 84/291 (28.87%), Postives = 134/291 (46.05%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
             P+H+ S  G   I+  L+Q G  V+ +T  ++   LH AA   Q   + +LI  G  +DA    G TPLH  A+ G   +  LLLQ  A+ D+Q     TPL  A           LL  G + +   KN  T LH AAR+   D+   LL+Y A  +A+++ G TPL  +       +  +LI  K  +     + G T +H+  +++ V++ E+L K G   I+      G + +H A  + +  +VR  L +  N D      A+    +P     ++GH  +  +L
Sbjct:  471 TPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTA-LHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAV-NHPAKNGLTPMHLCAQEDNVNVAEILEKNGA-NIDM-ATKAGYTPLHVASHFGQANMVRFLLQNGANVDA-----ATSIGYTPLHQTAQQGHCHIVNLL 752          

HSP 3 Score: 107.842 bits (268), Expect = 5.010e-24
Identity = 79/292 (27.05%), Postives = 139/292 (47.60%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L  +H+ +  G+  +   L+    D N      F  PLH A   ++L   +LL+  G  I A    G TPLH AA  G  N++  LLQ+ A+ D   +  +TPL  A R+ +   ++ LL  G  V+ + + + T LH A+R G+ D++++LL++ A++DA  +   T L  A    Q  V  +LI +   L     + G T LH+  +  ++ + ++LL+  +  ++    N G + +H A  YN  ++  L L    +    AK        +P  +   +  +++A  L
Sbjct:  338 LTALHVAAHCGHVRVAKLLLDRNADANARALNGF-TPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAAL-DAATKKGFTPLHLTAKYGHIKVAQLLLQK-EADVDAQGKN-GVTPLHVACHYNNQQVALLLLEKGASPHATAKN-----GHTPLHIAARKNQMDIATTL 620          

HSP 4 Score: 103.99 bits (258), Expect = 8.558e-23
Identity = 78/292 (26.71%), Postives = 140/292 (47.95%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H  +  G+  ++  L++ G  ++  T      PLH AA    +  +++L+     +D       T LH AA  G   +  LLL   A+++++ +   TPL  A +  R+  V+ LL  G +++   ++  T LH AA  G  +++I LL++DA  D     G TPL  A   +Q  +++IL+R+   +  R  R   T LH+A R   V +V +LL+ G        + +  + +H A    + E+  + + +    D   KK       +P  L  + GH+++A++L
Sbjct:  272 LTPLHCAARSGHEQVVDMLLERGAPISAKTKNGL-APLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDAR-AREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMY--TALHIAAKEGQDEVAAVLIENGAALDAATKK-----GFTPLHLTAKYGHIKVAQLL 554          

HSP 5 Score: 99.7525 bits (247), Expect = 1.820e-21
Identity = 81/264 (30.68%), Postives = 121/264 (45.83%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILI--RSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNF 1199
              P+ +   +G+  ++  L++S       T    R P LH AA    +  + LL++     D     G TPLH A+  G  N+  LL+Q GA+ +     N +PL  A + G+   V  LL  G N+  K ++  T LH AAR G   ++ MLL+  A I A+ + GL PL  A         +IL+  R+  D    DY    TALHVA    +V + ++LL           N F  + +H A   NR ++V L L H  + 
Sbjct:  144 FTPLAVAMQQGHDKVVAVLLES------DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYL---TALHVAAHCGHVRVAKLLLDRNADANARALNGF--TPLHIACKKNRLKVVELLLRHGASI 396          

HSP 6 Score: 81.2629 bits (199), Expect = 1.357e-15
Identity = 61/253 (24.11%), Postives = 107/253 (42.29%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDV------------------NQSTTTLFRQ--------------PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEML 1073
            K   P+HL +  G+  +   L+Q   DV                  NQ    L  +              PLH AA  +Q+  +  L+  G   +A+   G TPLH ++++G   +  LL+++ A  +       TP+    +   +   + L   G N+++  K   T LH A+  G A+++  LL+  A +DA    G TPL +        +V +L+  K +   +    G T LH+A +  Y+ +++ L
Sbjct:  534 KGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTV-NGQTPLHIARKLGYISVLDSL 785          

HSP 7 Score: 70.8626 bits (172), Expect = 2.076e-12
Identity = 72/303 (23.76%), Postives = 130/303 (42.90%), Query Frame = 3
Query:  474 IQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDAR-----------------------------IDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDL-YKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +++ +D+N S        LH A+    +     L+  G  +D+    GNT LH A+  G+  ++ LLL++ A+ + Q     TPL  A +      V+ LL  G N ++  ++  T L  A +QG   ++ +LL+ D R                              D  ++ G TPL  A  Y  Q++  +LI+   D+ Y   +    + LHVA +    ++V +LL+ G   IE    + G + +H A      ++V + L         + K  +G   +P  +  +  H++ A++L
Sbjct:   31 LKNNIDINTSNANGLNA-LHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNI--SPLHVAAKWGKTNMVSLLLEKG-GNIEAKTRD-GLTPLHCAARSGHEQVVDMLLERGAPI---SAKTKNGL--APLHMAAQGEHVDAARIL 323          

HSP 8 Score: 63.5438 bits (153), Expect = 4.141e-10
Identity = 62/231 (26.84%), Postives = 111/231 (48.05%), Query Frame = 3
Query:  615 GNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCD--LYKRDYRTGDTALHVAVRKNYVHLVEMLLKA---GKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            GNT    AA  G    +   L+N  + ++ +      L  A++ G I  V  LL  G  V+   K  +TALH A+  G  +++ +LL+++A ++ Q+Q G TPL  A   +  +VV++L+ +  +  L   D   G T L VA+++ +  +V +LL++   GK  +           +H A   +  +   L L +++N D  +K   SG   +P  +    G+  +A +L
Sbjct:   11 GNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATED---GFTPLAVAMQQGHDKVVAVLLESDTRGKVRL---------PALHIAAKKDDVKAATLLLDNDHNPDVTSK---SGF--TPLHIASHYGNQNIANLL 224          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089172)

HSP 1 Score: 120.553 bits (301), Expect = 4.964e-28
Identity = 95/319 (29.78%), Postives = 160/319 (50.16%), Query Frame = 3
Query:  345 KMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            KMVE+    L      +  +    L P+H+ SF G  +I+ YL+Q     +  T      PLH AA ++Q    ++L+ +  ++DA    G TPLH A+  G  N++ LLLQ+GA  ++Q     + L  A + G+   V+ LL  G   N   K   T LH A + G  +++ +LL+  A ID Q +  +TPL  A  Y+  S+V++L++  S  +L  R+   G  A+H+A +KNY+ +   LL+ G    + N  +  G S +H A      ++V+L L      +Y     A+    +P  +  + GH+ ++++L
Sbjct:  413 KMVEL----LIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIR-GETPLHLAARANQADIIRILLRSA-KVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARN---GQCAIHIACKKNYLEIAMQLLQHGA---DVNIISKSGFSPLHLAAQGGNVDMVQLLL------EYGVISAAAKNGLTPLHVAAQEGHVLVSQIL 713          

HSP 2 Score: 117.087 bits (292), Expect = 6.445e-27
Identity = 83/292 (28.42%), Postives = 151/292 (51.71%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            P+H+ S  G  +I+  L+Q G ++N  +   +   LH AA   Q +  Q+L+  G + +A    G TPLH A + G+ N++ +LLQNGA+ D Q   + TPL  AT       V+ LL  G + N+  +N   A+H A ++   ++ + LL++ A ++  ++ G +PL  A       +VQ+L+  +  +     + G T LHVA ++ +V + ++LL+ G    E   N  G + +H A  Y   +LV+ F+ ++ + +     ++S    +P     ++GH+ +  +L R
Sbjct:  500 PLHVASRLGNINIIMLLLQHGAEINAQSNDKY-SALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLL--EYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRN--GYTPLHMAAHYGHLDLVKFFIENDADIE-----MSSNIGYTPLHQAAQQGHIMIINLLLR 781          

HSP 3 Score: 97.4413 bits (241), Expect = 1.079e-20
Identity = 69/224 (30.80%), Postives = 110/224 (49.11%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRS-KCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            L P+H  S  G+  ++ +L+Q    +   T       LH AA       + LL++    +D       T LH AA  G   +  LLL   AN +++ +   TPL  A +  RI  V+ L+  G N+    ++  T LH A+  G  +++I LL+++A  D     G TPL  A   +Q  +++IL+RS K D   R+   G T LHVA R   ++++ +LL+ G
Sbjct:  301 LTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGL-SALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIARE---GQTPLHVASRLGNINIIMLLLQHG 520          

HSP 4 Score: 90.1225 bits (222), Expect = 2.187e-18
Identity = 64/220 (29.09%), Postives = 109/220 (49.55%), Query Frame = 3
Query:  414 DLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEML 1073
            D+ P+H+ +     SI+  L+++G   N       +  +H A   + L  +  L+  G  ++     G +PLH AA+ G  +++ LLL+ G  S +      TPL  A + G +   + LL  G N++ + +N  T LH AA  G  DL+   ++ DA I+  +  G TPL +A       ++ +L+R K +      + G+TALH+A    YV ++E L
Sbjct:  596 DVTPLHVATHYNNPSIVELLLKNGSSPNLCARN-GQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAK-NGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNAL-TKDGNTALHIASNLGYVTVMESL 812          

HSP 5 Score: 88.9669 bits (219), Expect = 4.705e-18
Identity = 84/297 (28.28%), Postives = 132/297 (44.44%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESF---VHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            L  +H+ + K   +    L+Q   + +  + + F  PLH AA    +  + LL+N    ++       TPLH A + G+ +L TLLL  GA  D+      TPL  A+RSG +  +K LL     +  K KN  +ALH AA+    +   +LL   A +D      LT L  A       V ++L+  K +   R    G T LH+A +KN + +VE+L+K G      N     ES    +H A +     +V   L H  + D P  +      ++P  L       ++ ++L R
Sbjct:  202 LPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGF-TPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALN-GFTPLHIACKKNRIKMVELLIKHGA-----NIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIR-----GETPLHLAARANQADIIRILLR 486          

HSP 6 Score: 82.0333 bits (201), Expect = 6.869e-16
Identity = 70/262 (26.72%), Postives = 118/262 (45.04%), Query Frame = 3
Query:  303 FYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDL-YKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            F  A  + DI K+   ++        +  ++   N   L  +HL +  GY  I   L++ G+ ++ +T       LH A+++ Q      LI     ++ +   G TPL+ AA++  +N    LL NGAN         TPL  A + G      +++ V    +V+ K    ALH AA++   +   +LL++D   D  ++ G TPL  A  Y    +  +L+ +K D+ Y   +    T LHVA +   + L  +LL  G
Sbjct:   42 FLRAARSGDIKKVMDFLDC------GEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKK-GNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGH----DKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNI--TPLHVACKWGKLSLCTLLLCRG 290          

HSP 7 Score: 79.337 bits (194), Expect = 5.115e-15
Identity = 76/291 (26.12%), Postives = 127/291 (43.64%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILI--RSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +H+ S  G   +++ LI    +VN  +   F  PL+ AA  +  +C + L+  G         G TPL  A + G + ++ +LL+N    D +       L  A +   + A K LL    N ++  K+  T LH AA  G+ D+  +LL   A ++   +  +TPL  A  + + S+  +L+   +K D   RD   G T LH A R  +V +++ LL+     +    N  G S +H A      E   L L +    D       +        +    GH+++AK+L
Sbjct:  110 LHIASLAGQHDVINQLILYNANVNVQSLNGF-TPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRD---GLTPLHCASRSGHVEVIKHLLQQNAPILTKTKN--GLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTA-----LHVAAHCGHVKVAKLL 385          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0300497)

HSP 1 Score: 120.553 bits (301), Expect = 4.964e-28
Identity = 95/319 (29.78%), Postives = 160/319 (50.16%), Query Frame = 3
Query:  345 KMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            KMVE+    L      +  +    L P+H+ SF G  +I+ YL+Q     +  T      PLH AA ++Q    ++L+ +  ++DA    G TPLH A+  G  N++ LLLQ+GA  ++Q     + L  A + G+   V+ LL  G   N   K   T LH A + G  +++ +LL+  A ID Q +  +TPL  A  Y+  S+V++L++  S  +L  R+   G  A+H+A +KNY+ +   LL+ G    + N  +  G S +H A      ++V+L L      +Y     A+    +P  +  + GH+ ++++L
Sbjct:  413 KMVEL----LIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIR-GETPLHLAARANQADIIRILLRSA-KVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARN---GQCAIHIACKKNYLEIAMQLLQHGA---DVNIISKSGFSPLHLAAQGGNVDMVQLLL------EYGVISAAAKNGLTPLHVAAQEGHVLVSQIL 713          

HSP 2 Score: 117.087 bits (292), Expect = 6.445e-27
Identity = 83/292 (28.42%), Postives = 151/292 (51.71%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            P+H+ S  G  +I+  L+Q G ++N  +   +   LH AA   Q +  Q+L+  G + +A    G TPLH A + G+ N++ +LLQNGA+ D Q   + TPL  AT       V+ LL  G + N+  +N   A+H A ++   ++ + LL++ A ++  ++ G +PL  A       +VQ+L+  +  +     + G T LHVA ++ +V + ++LL+ G    E   N  G + +H A  Y   +LV+ F+ ++ + +     ++S    +P     ++GH+ +  +L R
Sbjct:  500 PLHVASRLGNINIIMLLLQHGAEINAQSNDKY-SALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLL--EYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRN--GYTPLHMAAHYGHLDLVKFFIENDADIE-----MSSNIGYTPLHQAAQQGHIMIINLLLR 781          

HSP 3 Score: 97.4413 bits (241), Expect = 1.079e-20
Identity = 69/224 (30.80%), Postives = 110/224 (49.11%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRS-KCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            L P+H  S  G+  ++ +L+Q    +   T       LH AA       + LL++    +D       T LH AA  G   +  LLL   AN +++ +   TPL  A +  RI  V+ L+  G N+    ++  T LH A+  G  +++I LL+++A  D     G TPL  A   +Q  +++IL+RS K D   R+   G T LHVA R   ++++ +LL+ G
Sbjct:  301 LTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGL-SALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIARE---GQTPLHVASRLGNINIIMLLLQHG 520          

HSP 4 Score: 90.1225 bits (222), Expect = 2.187e-18
Identity = 64/220 (29.09%), Postives = 109/220 (49.55%), Query Frame = 3
Query:  414 DLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEML 1073
            D+ P+H+ +     SI+  L+++G   N       +  +H A   + L  +  L+  G  ++     G +PLH AA+ G  +++ LLL+ G  S +      TPL  A + G +   + LL  G N++ + +N  T LH AA  G  DL+   ++ DA I+  +  G TPL +A       ++ +L+R K +      + G+TALH+A    YV ++E L
Sbjct:  596 DVTPLHVATHYNNPSIVELLLKNGSSPNLCARN-GQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAK-NGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNAL-TKDGNTALHIASNLGYVTVMESL 812          

HSP 5 Score: 88.9669 bits (219), Expect = 4.705e-18
Identity = 84/297 (28.28%), Postives = 132/297 (44.44%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESF---VHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            L  +H+ + K   +    L+Q   + +  + + F  PLH AA    +  + LL+N    ++       TPLH A + G+ +L TLLL  GA  D+      TPL  A+RSG +  +K LL     +  K KN  +ALH AA+    +   +LL   A +D      LT L  A       V ++L+  K +   R    G T LH+A +KN + +VE+L+K G      N     ES    +H A +     +V   L H  + D P  +      ++P  L       ++ ++L R
Sbjct:  202 LPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGF-TPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALN-GFTPLHIACKKNRIKMVELLIKHGA-----NIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIR-----GETPLHLAARANQADIIRILLR 486          

HSP 6 Score: 82.0333 bits (201), Expect = 6.869e-16
Identity = 70/262 (26.72%), Postives = 118/262 (45.04%), Query Frame = 3
Query:  303 FYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDL-YKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            F  A  + DI K+   ++        +  ++   N   L  +HL +  GY  I   L++ G+ ++ +T       LH A+++ Q      LI     ++ +   G TPL+ AA++  +N    LL NGAN         TPL  A + G      +++ V    +V+ K    ALH AA++   +   +LL++D   D  ++ G TPL  A  Y    +  +L+ +K D+ Y   +    T LHVA +   + L  +LL  G
Sbjct:   42 FLRAARSGDIKKVMDFLDC------GEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKK-GNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGH----DKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNI--TPLHVACKWGKLSLCTLLLCRG 290          

HSP 7 Score: 79.337 bits (194), Expect = 5.115e-15
Identity = 76/291 (26.12%), Postives = 127/291 (43.64%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILI--RSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +H+ S  G   +++ LI    +VN  +   F  PL+ AA  +  +C + L+  G         G TPL  A + G + ++ +LL+N    D +       L  A +   + A K LL    N ++  K+  T LH AA  G+ D+  +LL   A ++   +  +TPL  A  + + S+  +L+   +K D   RD   G T LH A R  +V +++ LL+     +    N  G S +H A      E   L L +    D       +        +    GH+++AK+L
Sbjct:  110 LHIASLAGQHDVINQLILYNANVNVQSLNGF-TPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRD---GLTPLHCASRSGHVEVIKHLLQQNAPILTKTKN--GLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTA-----LHVAAHCGHVKVAKLL 385          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089171)

HSP 1 Score: 120.553 bits (301), Expect = 4.964e-28
Identity = 95/319 (29.78%), Postives = 160/319 (50.16%), Query Frame = 3
Query:  345 KMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            KMVE+    L      +  +    L P+H+ SF G  +I+ YL+Q     +  T      PLH AA ++Q    ++L+ +  ++DA    G TPLH A+  G  N++ LLLQ+GA  ++Q     + L  A + G+   V+ LL  G   N   K   T LH A + G  +++ +LL+  A ID Q +  +TPL  A  Y+  S+V++L++  S  +L  R+   G  A+H+A +KNY+ +   LL+ G    + N  +  G S +H A      ++V+L L      +Y     A+    +P  +  + GH+ ++++L
Sbjct:  413 KMVEL----LIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIR-GETPLHLAARANQADIIRILLRSA-KVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARN---GQCAIHIACKKNYLEIAMQLLQHGA---DVNIISKSGFSPLHLAAQGGNVDMVQLLL------EYGVISAAAKNGLTPLHVAAQEGHVLVSQIL 713          

HSP 2 Score: 117.087 bits (292), Expect = 6.445e-27
Identity = 83/292 (28.42%), Postives = 151/292 (51.71%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            P+H+ S  G  +I+  L+Q G ++N  +   +   LH AA   Q +  Q+L+  G + +A    G TPLH A + G+ N++ +LLQNGA+ D Q   + TPL  AT       V+ LL  G + N+  +N   A+H A ++   ++ + LL++ A ++  ++ G +PL  A       +VQ+L+  +  +     + G T LHVA ++ +V + ++LL+ G    E   N  G + +H A  Y   +LV+ F+ ++ + +     ++S    +P     ++GH+ +  +L R
Sbjct:  500 PLHVASRLGNINIIMLLLQHGAEINAQSNDKY-SALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLL--EYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRN--GYTPLHMAAHYGHLDLVKFFIENDADIE-----MSSNIGYTPLHQAAQQGHIMIINLLLR 781          

HSP 3 Score: 97.4413 bits (241), Expect = 1.079e-20
Identity = 69/224 (30.80%), Postives = 110/224 (49.11%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRS-KCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            L P+H  S  G+  ++ +L+Q    +   T       LH AA       + LL++    +D       T LH AA  G   +  LLL   AN +++ +   TPL  A +  RI  V+ L+  G N+    ++  T LH A+  G  +++I LL+++A  D     G TPL  A   +Q  +++IL+RS K D   R+   G T LHVA R   ++++ +LL+ G
Sbjct:  301 LTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGL-SALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIARE---GQTPLHVASRLGNINIIMLLLQHG 520          

HSP 4 Score: 90.1225 bits (222), Expect = 2.187e-18
Identity = 64/220 (29.09%), Postives = 109/220 (49.55%), Query Frame = 3
Query:  414 DLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEML 1073
            D+ P+H+ +     SI+  L+++G   N       +  +H A   + L  +  L+  G  ++     G +PLH AA+ G  +++ LLL+ G  S +      TPL  A + G +   + LL  G N++ + +N  T LH AA  G  DL+   ++ DA I+  +  G TPL +A       ++ +L+R K +      + G+TALH+A    YV ++E L
Sbjct:  596 DVTPLHVATHYNNPSIVELLLKNGSSPNLCARN-GQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAK-NGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNAL-TKDGNTALHIASNLGYVTVMESL 812          

HSP 5 Score: 88.9669 bits (219), Expect = 4.705e-18
Identity = 84/297 (28.28%), Postives = 132/297 (44.44%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESF---VHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            L  +H+ + K   +    L+Q   + +  + + F  PLH AA    +  + LL+N    ++       TPLH A + G+ +L TLLL  GA  D+      TPL  A+RSG +  +K LL     +  K KN  +ALH AA+    +   +LL   A +D      LT L  A       V ++L+  K +   R    G T LH+A +KN + +VE+L+K G      N     ES    +H A +     +V   L H  + D P  +      ++P  L       ++ ++L R
Sbjct:  202 LPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGF-TPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALN-GFTPLHIACKKNRIKMVELLIKHGA-----NIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIR-----GETPLHLAARANQADIIRILLR 486          

HSP 6 Score: 82.0333 bits (201), Expect = 6.869e-16
Identity = 70/262 (26.72%), Postives = 118/262 (45.04%), Query Frame = 3
Query:  303 FYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDL-YKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            F  A  + DI K+   ++        +  ++   N   L  +HL +  GY  I   L++ G+ ++ +T       LH A+++ Q      LI     ++ +   G TPL+ AA++  +N    LL NGAN         TPL  A + G      +++ V    +V+ K    ALH AA++   +   +LL++D   D  ++ G TPL  A  Y    +  +L+ +K D+ Y   +    T LHVA +   + L  +LL  G
Sbjct:   42 FLRAARSGDIKKVMDFLDC------GEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKK-GNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGH----DKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNI--TPLHVACKWGKLSLCTLLLCRG 290          

HSP 7 Score: 79.337 bits (194), Expect = 5.115e-15
Identity = 76/291 (26.12%), Postives = 127/291 (43.64%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILI--RSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +H+ S  G   +++ LI    +VN  +   F  PL+ AA  +  +C + L+  G         G TPL  A + G + ++ +LL+N    D +       L  A +   + A K LL    N ++  K+  T LH AA  G+ D+  +LL   A ++   +  +TPL  A  + + S+  +L+   +K D   RD   G T LH A R  +V +++ LL+     +    N  G S +H A      E   L L +    D       +        +    GH+++AK+L
Sbjct:  110 LHIASLAGQHDVINQLILYNANVNVQSLNGF-TPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRD---GLTPLHCASRSGHVEVIKHLLQQNAPILTKTKN--GLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTA-----LHVAAHCGHVKVAKLL 385          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089173)

HSP 1 Score: 120.553 bits (301), Expect = 4.964e-28
Identity = 95/319 (29.78%), Postives = 160/319 (50.16%), Query Frame = 3
Query:  345 KMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            KMVE+    L      +  +    L P+H+ SF G  +I+ YL+Q     +  T      PLH AA ++Q    ++L+ +  ++DA    G TPLH A+  G  N++ LLLQ+GA  ++Q     + L  A + G+   V+ LL  G   N   K   T LH A + G  +++ +LL+  A ID Q +  +TPL  A  Y+  S+V++L++  S  +L  R+   G  A+H+A +KNY+ +   LL+ G    + N  +  G S +H A      ++V+L L      +Y     A+    +P  +  + GH+ ++++L
Sbjct:  413 KMVEL----LIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIR-GETPLHLAARANQADIIRILLRSA-KVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARN---GQCAIHIACKKNYLEIAMQLLQHGA---DVNIISKSGFSPLHLAAQGGNVDMVQLLL------EYGVISAAAKNGLTPLHVAAQEGHVLVSQIL 713          

HSP 2 Score: 117.087 bits (292), Expect = 6.445e-27
Identity = 83/292 (28.42%), Postives = 151/292 (51.71%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            P+H+ S  G  +I+  L+Q G ++N  +   +   LH AA   Q +  Q+L+  G + +A    G TPLH A + G+ N++ +LLQNGA+ D Q   + TPL  AT       V+ LL  G + N+  +N   A+H A ++   ++ + LL++ A ++  ++ G +PL  A       +VQ+L+  +  +     + G T LHVA ++ +V + ++LL+ G    E   N  G + +H A  Y   +LV+ F+ ++ + +     ++S    +P     ++GH+ +  +L R
Sbjct:  500 PLHVASRLGNINIIMLLLQHGAEINAQSNDKY-SALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLL--EYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRN--GYTPLHMAAHYGHLDLVKFFIENDADIE-----MSSNIGYTPLHQAAQQGHIMIINLLLR 781          

HSP 3 Score: 97.4413 bits (241), Expect = 1.079e-20
Identity = 69/224 (30.80%), Postives = 110/224 (49.11%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRS-KCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            L P+H  S  G+  ++ +L+Q    +   T       LH AA       + LL++    +D       T LH AA  G   +  LLL   AN +++ +   TPL  A +  RI  V+ L+  G N+    ++  T LH A+  G  +++I LL+++A  D     G TPL  A   +Q  +++IL+RS K D   R+   G T LHVA R   ++++ +LL+ G
Sbjct:  301 LTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGL-SALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIARE---GQTPLHVASRLGNINIIMLLLQHG 520          

HSP 4 Score: 90.1225 bits (222), Expect = 2.187e-18
Identity = 64/220 (29.09%), Postives = 109/220 (49.55%), Query Frame = 3
Query:  414 DLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEML 1073
            D+ P+H+ +     SI+  L+++G   N       +  +H A   + L  +  L+  G  ++     G +PLH AA+ G  +++ LLL+ G  S +      TPL  A + G +   + LL  G N++ + +N  T LH AA  G  DL+   ++ DA I+  +  G TPL +A       ++ +L+R K +      + G+TALH+A    YV ++E L
Sbjct:  596 DVTPLHVATHYNNPSIVELLLKNGSSPNLCARN-GQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAK-NGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNAL-TKDGNTALHIASNLGYVTVMESL 812          

HSP 5 Score: 88.9669 bits (219), Expect = 4.705e-18
Identity = 84/297 (28.28%), Postives = 132/297 (44.44%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESF---VHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            L  +H+ + K   +    L+Q   + +  + + F  PLH AA    +  + LL+N    ++       TPLH A + G+ +L TLLL  GA  D+      TPL  A+RSG +  +K LL     +  K KN  +ALH AA+    +   +LL   A +D      LT L  A       V ++L+  K +   R    G T LH+A +KN + +VE+L+K G      N     ES    +H A +     +V   L H  + D P  +      ++P  L       ++ ++L R
Sbjct:  202 LPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGF-TPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALN-GFTPLHIACKKNRIKMVELLIKHGA-----NIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIR-----GETPLHLAARANQADIIRILLR 486          

HSP 6 Score: 82.0333 bits (201), Expect = 6.869e-16
Identity = 70/262 (26.72%), Postives = 118/262 (45.04%), Query Frame = 3
Query:  303 FYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDL-YKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            F  A  + DI K+   ++        +  ++   N   L  +HL +  GY  I   L++ G+ ++ +T       LH A+++ Q      LI     ++ +   G TPL+ AA++  +N    LL NGAN         TPL  A + G      +++ V    +V+ K    ALH AA++   +   +LL++D   D  ++ G TPL  A  Y    +  +L+ +K D+ Y   +    T LHVA +   + L  +LL  G
Sbjct:   42 FLRAARSGDIKKVMDFLDC------GEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKK-GNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGH----DKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNI--TPLHVACKWGKLSLCTLLLCRG 290          

HSP 7 Score: 79.337 bits (194), Expect = 5.115e-15
Identity = 76/291 (26.12%), Postives = 127/291 (43.64%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILI--RSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +H+ S  G   +++ LI    +VN  +   F  PL+ AA  +  +C + L+  G         G TPL  A + G + ++ +LL+N    D +       L  A +   + A K LL    N ++  K+  T LH AA  G+ D+  +LL   A ++   +  +TPL  A  + + S+  +L+   +K D   RD   G T LH A R  +V +++ LL+     +    N  G S +H A      E   L L +    D       +        +    GH+++AK+L
Sbjct:  110 LHIASLAGQHDVINQLILYNANVNVQSLNGF-TPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRD---GLTPLHCASRSGHVEVIKHLLQQNAPILTKTKN--GLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTA-----LHVAAHCGHVKVAKLL 385          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 132.494 bits (332), Expect = 8.639e-32
Identity = 92/292 (31.51%), Postives = 141/292 (48.29%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +F G+ +I+  L+Q G   N S   +   PLH AA +     +Q L+    Q+DAK     TPLH AA  G   L+ LL+++ AN DS      TPL  A R G     + LL          K   T LH A + G  D++ +LL+  A  +A  + GLTPL  AV ++   VV++L+ SK        R G TALH+A ++N + +   LL+ G      +    G + +H A    + ++V L +    N +     L +    +P  LV + GH+ +A +L
Sbjct:  408 LTPLHVAAFMGHLNIVKSLLQRGASPNASNVKV-ETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV-SKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQ--GITPLHLASQEGQPDMVALLISKQANVN-----LGNKNGLTPLHLVAQEGHVGIADML 690          

HSP 2 Score: 113.62 bits (283), Expect = 9.693e-26
Identity = 79/255 (30.98%), Postives = 125/255 (49.02%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFL 1181
            L P+H+ +  G+  ++  L+  G   N      F  PLH A   + +    LL+     ++A    G TPLH AA  G  N++  LLQ GA+ ++ ++  +TPL  A R+G     + LL     V+ K K++ T LH AAR G  +L+ +L+++ A  D+    G TPL  A         +IL+       K   + G T LHVA +   V +VE+LL+ G        N  G + +H AV +N  ++V+L +
Sbjct:  342 LTPLHVAAHCGHHRMVKVLLDKGAKANARALNGF-TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKM-TKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKN--GLTPLHVAVHHNNLDVVKLLV 592          

HSP 3 Score: 107.842 bits (268), Expect = 7.670e-24
Identity = 72/235 (30.64%), Postives = 118/235 (50.21%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNN 1115
            K   P+H+    G   ++  L++ G + N +       PLH A   + L   +LL++ GG   +    G T LH AA+  +  + + LLQ GAN++S+ +   TPL  A++ G+   V  L+    NVN+ +KN  T LH  A++G   +  ML+K  A + A ++ G TPL  A  Y    +V+ L++ +  +  +  R G T LH A ++ +  +V +LLK G    E   N 
Sbjct:  538 KGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGL-TPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSK-TRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNG 770          

HSP 4 Score: 107.071 bits (266), Expect = 1.363e-23
Identity = 86/287 (29.97%), Postives = 126/287 (43.90%), Query Frame = 3
Query:  525 PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK---------------------AGKWYIEYNFNNFG----------ESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            PLH AA    LS +QLL+N G  ++     G TPLH A+  G   ++ LLL  GA  D++     TPL  A R+G +  V+ LL  G  +  K KN  + +H AA+    D +  LL+Y+A ID      LTPL  A       +V++L+        R    G T LH+A +KN++  +++LLK                      G   I  +    G          E+ +H A     CE+ +  L +N   D  AK      +++P       GH EL K+L
Sbjct:  212 PLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARAL-NGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKD-----DQTPLHCAARMGHKELVKLL 492          

HSP 5 Score: 96.2857 bits (238), Expect = 3.597e-20
Identity = 102/376 (27.13%), Postives = 158/376 (42.02%), Query Frame = 3
Query:  261 SSPCNNAPTSPALLFYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDL------------------------------YKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            SSP  +A TS    F  A  + +++K    ++    D+N        +N   L  +HL S +G+  ++  L+ +G+D+ ++TT      LH AA++ Q      LIN G  ++A+   G +PL+ AA++    ++  LL++GAN         TPL  A + G    V  L+    N   K K    ALH AAR        +LL+ D   D  ++ G TPL  A  Y   SV Q+L+    ++                               + D +T D  T LH A R  +V +VE+LL  G        N  G S +H A   +  + VR  L +N   D       +    +P  +    GH  + KVL
Sbjct:    9 SSPQADATTS----FLRAARSGNLEKALDHIK-NGIDINI-------ANQNGLNGLHLASKEGHVKMVLELLHNGIDL-ETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKN--GLSPIHMAAQGDHMDCVRQLLQYNAEIDD-----ITLDHLTPLHVAAHCGHHRMVKVL 360          

HSP 6 Score: 95.9005 bits (237), Expect = 5.015e-20
Identity = 78/326 (23.93%), Postives = 138/326 (42.33%), Query Frame = 3
Query:  414 DLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRS---------------------------------GRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +L P+H  +  G+  ++  L+  G  + Q+ T     P+H AA    + C + L+    +ID       TPLH AA  G + ++ +LL  GA ++++ +   TPL  A +                                  G +  VK LL  G + N  +   +T LH AAR G  ++   LL+ +A++DA+ +   TPL  A     + +V++L+  K +        G T LH+A R+ +     +LL       +     F  + +H A  Y + ++V L L    N +   K        +P  + +   +L++ K+L
Sbjct:  275 ELTPLHCAARNGHVRVVEILLDQGAPL-QAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKAN-PDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGF--TPLHVACKYGKVDVVELLLERGANPNAAGKN-----GLTPLHVAVHHNNLDVVKLL 591          

HSP 7 Score: 88.9669 bits (219), Expect = 6.635e-18
Identity = 89/345 (25.80%), Postives = 146/345 (42.32%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVD---------------------------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVK 1337
            V   + K   P+++ + + +  ++ YL++ G +                           +N  T    R P LH AA +     + +L+      D     G TPLH AA     ++  LLL  GAN +       TPL  A+R G +  V+ LL  G  ++ K K+E T LH AAR G   ++ +LL   A + A+ + GL+P+  A        V+ L++   ++   D  T D  T LHVA    +  +V++LL  G        N F  + +H A   N    + L L H+ + +       + +  +P  +    GHL + K L +     S N++ VK
Sbjct:  107 VNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGF--TPLHIACKKNHMRSMDLLLKHSASLEA-----VTESGLTPLHVAAFMGHLNIVKSLLQRGA--SPNASNVK 439          

HSP 8 Score: 75.8702 bits (185), Expect = 7.724e-14
Identity = 55/182 (30.22%), Postives = 87/182 (47.80%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
            +H+ + +    +   L+Q G + N  +      PLH A+   Q     LLI+    ++  +  G TPLH  A++G   +  +L++ GA+  +      TPL  A   G I  VK LL    +VN K +   T LH AA+QG  D++ +LLK+ A  +     G +PL  A      SV+ +L
Sbjct:  609 LHIAAKQNQLEVASSLLQYGANANSESLQGI-TPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 789          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Zebrafish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 132.109 bits (331), Expect = 1.007e-31
Identity = 90/292 (30.82%), Postives = 142/292 (48.63%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ SF G+ +I+  L+Q G   N S   +   PLH A+ +     ++ L+     +DAK     TPLH A+  G N ++ LLL++ ANS+S      TPL  A R G       LL +   +    K   T LH AA+ G  D+ ++LL+  A  +A  + GLTPL  AV ++   VV +L+ SK        R G T LH+A ++N   +   LL+ G      +    G + +H A    + ++V L +    N +     L + +  +P  LV + GH+ +A +L
Sbjct:  405 LTPLHVSSFMGHLNIVKILMQKGASPNASNVKV-ETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLL-SKGGSPHSAARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQ--GVTPLHLASQEGQPDMVLLLISKQANVN-----LGNKSGLTPLHLVAQEGHVGIADIL 687          

HSP 2 Score: 105.145 bits (261), Expect = 5.765e-23
Identity = 75/258 (29.07%), Postives = 125/258 (48.45%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGE---SFVHDAVWYNRCELVRLFL 1181
            L P+H+ +  G+  +   L+  G   N      F  PLH A   + +    LL+     ++A    G TPLH ++  G  N++ +L+Q GA+ ++ ++  +TPL  A+R+G     + LL     V+ K K++ T LH A+R G  +++ +LL++ A  ++    G TPL  A          IL+     L K   + G T LHVA +   V +  +LL+ G      N N  G+   + +H AV +N  ++V L L
Sbjct:  339 LTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGF-TPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKM-TKKGFTPLHVAAKYGKVDVAVLLLERGA-----NPNAAGKVGLTPLHVAVHHNNLDVVNLLL 589          

HSP 3 Score: 103.99 bits (258), Expect = 1.454e-22
Identity = 70/250 (28.00%), Postives = 127/250 (50.80%), Query Frame = 3
Query:  366 FDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNN 1115
             D+NA+  ++ +   K   P+H+ +  G   +   L++ G + N +       PLH A   + L    LL++ GG   +    G TPLH A++  +  + + LLQ+GA+++++ +   TPL  A++ G+   V  L+    NVN+ +K+  T LH  A++G   +  +L+K+ A + A  + G TPL  A  Y    +V+ L++ + ++  +  R   T LH A ++ +  +V +LLK G    E   N 
Sbjct:  523 LDMNAQLTKMTK---KGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGL-TPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTPLHLASQEGQPDMVLLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKHGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNCK-TRMSYTPLHQAAQQGHTDIVTLLLKHGAQPNEVTSNG 767          

HSP 4 Score: 101.679 bits (252), Expect = 6.490e-22
Identity = 75/256 (29.30%), Postives = 122/256 (47.66%), Query Frame = 3
Query:  525 PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            PLH AA    L+ +QLL+N G  ++     G TPLH A+  G   ++ LLL  GA  D++     TPL  A R+G +  ++ LL  G  +  K KN  + +H AA+    D I  LL+Y+A ID      LTPL  A       V ++L+        R    G T LH+A +KN++ ++++LLK             G + +H + +     +V++ +    + +    K+     ++P  +    GH E+A+ L
Sbjct:  209 PLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRAL-NGFTPLHIACKKNHMRVMDLLLKHSASL--EAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKV-----ETPLHMASRAGHCEVAEFL 456          

HSP 5 Score: 89.3521 bits (220), Expect = 5.016e-18
Identity = 87/304 (28.62%), Postives = 136/304 (44.74%), Query Frame = 3
Query:  453 FSILHYLIQSGVD------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVK 1337
            F+ L   +Q G +      +N  T    R P LH AA +     + +L+      D     G TPLH AA     N+  LLL  GA+ +       TPL  A+R G +  V+ LL  G  ++ K K+E T LH AAR G   +I +LL   A I A+ + GL+P+  A        ++ L++   ++   D  T D  T LHVA    +  + ++LL  G        N F  + +H A   N   ++ L L H+ + +       + +  +P  +    GHL + K+L +     S N++ VK
Sbjct:  145 FTPLAVALQQGHENVVALLINHGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGF--TPLHIACKKNHMRVMDLLLKHSASLEA-----VTESGLTPLHVSSFMGHLNIVKILMQKGA--SPNASNVK 436          

HSP 6 Score: 87.0409 bits (214), Expect = 2.852e-17
Identity = 73/300 (24.33%), Postives = 121/300 (40.33%), Query Frame = 3
Query:  414 DLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRS---------------------------------GRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAK 1214
            +L P+H  +  G+  I+  L+  G  + Q+ T     P+H AA    L C + L+    +ID       TPLH AA  G + +  +LL  GA  +++ +   TPL  A +                                  G +  VK L+  G + N  +   +T LH A+R G  ++   LL+  A +DA+ +   TPL  A       +V++L+  K +        G T LH+A R+ +     +LL       +     F  + +H A  Y + ++  L L    N +   K
Sbjct:  272 ELTPLHCAARNGHVRIIEILLDQGAPI-QAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKAN-SNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGF--TPLHVAAKYGKVDVAVLLLERGANPNAAGK 567          

HSP 7 Score: 79.7221 bits (195), Expect = 5.151e-15
Identity = 57/183 (31.15%), Postives = 88/183 (48.09%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
            P+H+ S +    +   L+Q G   N  +      PLH A+   Q     LLI+    ++  +  G TPLH  A++G   +  +L+++GA+  +      TPL  A   G I  VK LL    NVN K +   T LH AA+QG  D++ +LLK+ A+ +     G + L  A      SV+ +L
Sbjct:  605 PLHIASKQNQAEVASSLLQHGASANAESLQGV-TPLHLASQEGQPDMVLLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKHGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNCKTRMSYTPLHQAAQQGHTDIVTLLLKHGAQPNEVTSNGTSALAIAKRLGYISVIDVL 786          

HSP 8 Score: 77.0258 bits (188), Expect = 3.849e-14
Identity = 86/334 (25.75%), Postives = 129/334 (38.62%), Query Frame = 3
Query:  474 IQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNV-----------------------------KDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDL------------------------------YKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            I++G+D+N +        LH A+    +     L++ G  ++     GNT LH AA  G+  ++T L+  GAN ++Q     TPL  A +   +  VK LL  G N  +                             K K    ALH AAR        +LL+ D   D  ++ G TPL  A  Y   +V Q+L+    D+                               K D +T D  T LH A R  +V ++E+LL  G   I+    N G S +H A   +  + +R  L +N   D       +    +P  +    GH  +AKVL
Sbjct:   32 IKNGIDINTANQNGLNG-LHLASKEGHVKMVLELLHHGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLDNGANQTIPTEDGFTPLAVALQQGHENVVALLINHGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGA-PIQAKTKN-GLSPIHMAAQGDHLDCIRQLLQYNAEIDD-----ITLDHLTPLHVAAHCGHHRVAKVL 357          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 131.724 bits (330), Expect = 1.188e-31
Identity = 92/294 (31.29%), Postives = 142/294 (48.30%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            L P+H+ +F G+ +I+  L+Q G   N S   +   PLH AA +     +Q L+    Q+DAK     TPLH AA  G   L+ LL+++ AN DS      TPL  A R G     + LL          K   T LH A + G  D++ +LL+  A  +A  + GLTPL  AV ++   VV++L+ SK        R G TALH+A ++N + +   LL+ G      +    G + +H A    + ++V L +    N +     L +    +P  LV + GH+ +A +L +
Sbjct:  346 LTPLHVAAFMGHLNIVKSLLQRGASPNASNVKV-ETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV-SKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQ--GITPLHLASQEGQPDMVALLISKQANVN-----LGNKNGLTPLHLVAQEGHVGIADMLVK 630          

HSP 2 Score: 113.235 bits (282), Expect = 1.368e-25
Identity = 79/255 (30.98%), Postives = 125/255 (49.02%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFL 1181
            L P+H+ +  G+  ++  L+  G   N      F  PLH A   + +    LL+     ++A    G TPLH AA  G  N++  LLQ GA+ ++ ++  +TPL  A R+G     + LL     V+ K K++ T LH AAR G  +L+ +L+++ A  D+    G TPL  A         +IL+       K   + G T LHVA +   V +VE+LL+ G        N  G + +H AV +N  ++V+L +
Sbjct:  280 LTPLHVAAHCGHHRMVKVLLDKGAKANARALNGF-TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKM-TKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKN--GLTPLHVAVHHNNLDVVKLLV 530          

HSP 3 Score: 107.071 bits (266), Expect = 1.058e-23
Identity = 72/235 (30.64%), Postives = 118/235 (50.21%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNN 1115
            K   P+H+    G   ++  L++ G + N +       PLH A   + L   +LL++ GG   +    G T LH AA+  +  + + LLQ GAN++S+ +   TPL  A++ G+   V  L+    NVN+ +KN  T LH  A++G   +  ML+K  A + A ++ G TPL  A  Y    +V+ L++ +  +  +  R G T LH A ++ +  +V +LLK G    E   N 
Sbjct:  476 KGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGL-TPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSK-TRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNG 708          

HSP 4 Score: 106.301 bits (264), Expect = 2.001e-23
Identity = 86/287 (29.97%), Postives = 126/287 (43.90%), Query Frame = 3
Query:  525 PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK---------------------AGKWYIEYNFNNFG----------ESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            PLH AA    LS +QLL+N G  ++     G TPLH A+  G   ++ LLL  GA  D++     TPL  A R+G +  V+ LL  G  +  K KN  + +H AA+    D +  LL+Y+A ID      LTPL  A       +V++L+        R    G T LH+A +KN++  +++LLK                      G   I  +    G          E+ +H A     CE+ +  L +N   D  AK      +++P       GH EL K+L
Sbjct:  150 PLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARAL-NGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKD-----DQTPLHCAARMGHKELVKLL 430          

HSP 5 Score: 95.1301 bits (235), Expect = 7.972e-20
Identity = 78/326 (23.93%), Postives = 138/326 (42.33%), Query Frame = 3
Query:  414 DLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRS---------------------------------GRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +L P+H  +  G+  ++  L+  G  + Q+ T     P+H AA    + C + L+    +ID       TPLH AA  G + ++ +LL  GA ++++ +   TPL  A +                                  G +  VK LL  G + N  +   +T LH AAR G  ++   LL+ +A++DA+ +   TPL  A     + +V++L+  K +        G T LH+A R+ +     +LL       +     F  + +H A  Y + ++V L L    N +   K        +P  + +   +L++ K+L
Sbjct:  213 ELTPLHCAARNGHVRVVEILLDQGAPL-QAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKAN-PDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGF--TPLHVACKYGKVDVVELLLERGANPNAAGKN-----GLTPLHVAVHHNNLDVVKLL 529          

HSP 6 Score: 88.1965 bits (217), Expect = 9.481e-18
Identity = 89/345 (25.80%), Postives = 146/345 (42.32%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVD---------------------------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVK 1337
            V   + K   P+++ + + +  ++ YL++ G +                           +N  T    R P LH AA +     + +L+      D     G TPLH AA     ++  LLL  GAN +       TPL  A+R G +  V+ LL  G  ++ K K+E T LH AAR G   ++ +LL   A + A+ + GL+P+  A        V+ L++   ++   D  T D  T LHVA    +  +V++LL  G        N F  + +H A   N    + L L H+ + +       + +  +P  +    GHL + K L +     S N++ VK
Sbjct:   45 VNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGF--TPLHIACKKNHMRSMDLLLKHSASLEA-----VTESGLTPLHVAAFMGHLNIVKSLLQRGA--SPNASNVK 377          

HSP 7 Score: 86.2705 bits (212), Expect = 4.314e-17
Identity = 85/306 (27.78%), Postives = 127/306 (41.50%), Query Frame = 3
Query:  471 LIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDL------------------------------YKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L+ +G+D+ ++TT      LH AA++ Q      LIN G  ++A+   G +PL+ AA++    ++  LL++GAN         TPL  A + G    V  L+    N   K K    ALH AAR        +LL+ D   D  ++ G TPL  A  Y   SV Q+L+    ++                               + D +T D  T LH A R  +V +VE+LL  G        N  G S +H A   +  + VR  L +N   D       +    +P  +    GH  + KVL
Sbjct:    5 LLHNGIDL-ETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKN--GLSPIHMAAQGDHMDCVRQLLQYNAEIDD-----ITLDHLTPLHVAAHCGHHRMVKVL 298          

HSP 8 Score: 75.0998 bits (183), Expect = 1.519e-13
Identity = 55/182 (30.22%), Postives = 87/182 (47.80%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
            +H+ + +    +   L+Q G + N  +      PLH A+   Q     LLI+    ++  +  G TPLH  A++G   +  +L++ GA+  +      TPL  A   G I  VK LL    +VN K +   T LH AA+QG  D++ +LLK+ A  +     G +PL  A      SV+ +L
Sbjct:  547 LHIAAKQNQLEVASSLLQYGANANSESLQGI-TPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 727          

HSP 9 Score: 50.0618 bits (118), Expect = 8.480e-6
Identity = 33/108 (30.56%), Postives = 55/108 (50.93%), Query Frame = 3
Query:  762 VKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            V  LL  G ++    K  +TALH AA  G   ++  L+ Y A ++AQ+Q G +PL  A   +   VV+ L+    +        G T L VA+++ + ++V +L+  G
Sbjct:    2 VLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGAN-QSLPTEDGFTPLAVALQQGHENVVALLINYG 108          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 131.724 bits (330), Expect = 1.245e-31
Identity = 92/294 (31.29%), Postives = 142/294 (48.30%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            L P+H+ +F G+ +I+  L+Q G   N S   +   PLH AA +     +Q L+    Q+DAK     TPLH AA  G   L+ LL+++ AN DS      TPL  A R G     + LL          K   T LH A + G  D++ +LL+  A  +A  + GLTPL  AV ++   VV++L+ SK        R G TALH+A ++N + +   LL+ G      +    G + +H A    + ++V L +    N +     L +    +P  LV + GH+ +A +L +
Sbjct:  438 LTPLHVAAFMGHLNIVKSLLQRGASPNASNVKV-ETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV-SKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQ--GITPLHLASQEGQPDMVALLISKQANVN-----LGNKNGLTPLHLVAQEGHVGIADMLVK 722          

HSP 2 Score: 112.849 bits (281), Expect = 1.464e-25
Identity = 79/255 (30.98%), Postives = 125/255 (49.02%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFL 1181
            L P+H+ +  G+  ++  L+  G   N      F  PLH A   + +    LL+     ++A    G TPLH AA  G  N++  LLQ GA+ ++ ++  +TPL  A R+G     + LL     V+ K K++ T LH AAR G  +L+ +L+++ A  D+    G TPL  A         +IL+       K   + G T LHVA +   V +VE+LL+ G        N  G + +H AV +N  ++V+L +
Sbjct:  372 LTPLHVAAHCGHHRMVKVLLDKGAKANARALNGF-TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKM-TKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKN--GLTPLHVAVHHNNLDVVKLLV 622          

HSP 3 Score: 106.301 bits (264), Expect = 1.871e-23
Identity = 86/287 (29.97%), Postives = 126/287 (43.90%), Query Frame = 3
Query:  525 PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK---------------------AGKWYIEYNFNNFG----------ESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            PLH AA    LS +QLL+N G  ++     G TPLH A+  G   ++ LLL  GA  D++     TPL  A R+G +  V+ LL  G  +  K KN  + +H AA+    D +  LL+Y+A ID      LTPL  A       +V++L+        R    G T LH+A +KN++  +++LLK                      G   I  +    G          E+ +H A     CE+ +  L +N   D  AK      +++P       GH EL K+L
Sbjct:  242 PLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARAL-NGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKD-----DQTPLHCAARMGHKELVKLL 522          

HSP 4 Score: 95.9005 bits (237), Expect = 4.709e-20
Identity = 91/333 (27.33%), Postives = 141/333 (42.34%), Query Frame = 3
Query:  390 EVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDL------------------------------YKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            ++  +N   L  +HL S +G+  ++  L+ +G+D+ ++TT      LH AA++ Q      LIN G  ++A+   G +PL+ AA++    ++  LL++GAN         TPL  A + G    V  L+    N   K K    ALH AAR        +LL+ D   D  ++ G TPL  A  Y   SV Q+L+    ++                               + D +T D  T LH A R  +V +VE+LL  G        N  G S +H A   +  + VR  L +N   D       +    +P  +    GH  + KVL
Sbjct:   70 DINIANQNGLNGLHLASKEGHVKMVLELLHNGIDL-ETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKN--GLSPIHMAAQGDHMDCVRQLLQYNAEIDD-----ITLDHLTPLHVAAHCGHHRMVKVL 390          

HSP 5 Score: 94.7449 bits (234), Expect = 9.081e-20
Identity = 78/326 (23.93%), Postives = 138/326 (42.33%), Query Frame = 3
Query:  414 DLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRS---------------------------------GRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +L P+H  +  G+  ++  L+  G  + Q+ T     P+H AA    + C + L+    +ID       TPLH AA  G + ++ +LL  GA ++++ +   TPL  A +                                  G +  VK LL  G + N  +   +T LH AAR G  ++   LL+ +A++DA+ +   TPL  A     + +V++L+  K +        G T LH+A R+ +     +LL       +     F  + +H A  Y + ++V L L    N +   K        +P  + +   +L++ K+L
Sbjct:  305 ELTPLHCAARNGHVRVVEILLDQGAPL-QAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKAN-PDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGF--TPLHVACKYGKVDVVELLLERGANPNAAGKN-----GLTPLHVAVHHNNLDVVKLL 621          

HSP 6 Score: 94.3597 bits (233), Expect = 1.191e-19
Identity = 85/317 (26.81%), Postives = 144/317 (45.43%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNY-VHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVK-RIEFQE 1355
            K   P+H+    G   ++  L++ G + N +       PLH A   + L   +LL++ GG   +    G T LH AA+  +  + + LLQ GAN++S+ +   TPL  A++ G+   V  L+    NVN+ +KN  T LH  A++G   +  ML+K  A + A ++ G TPL  A  Y    +V+ L++ +  +  +  R     L  +    + V +  +   A  + + + F   G + +H A      ++V L L H      P +   +GT  SP  +    G++ +  VL  V         T K R+ F E
Sbjct:  568 KGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGL-TPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSK-TRVSVLLLDASYTGLFSVSVCTLRTFAFSFSLIFLF-QLGYTPLHQAAQQGHTDIVTLLLKHGA---LPNEITTNGT--SPLGIAKRLGYISVIDVLKLVTEESVSMITTEKHRMSFPE 876          

HSP 7 Score: 88.1965 bits (217), Expect = 9.863e-18
Identity = 89/345 (25.80%), Postives = 146/345 (42.32%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVD---------------------------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVK 1337
            V   + K   P+++ + + +  ++ YL++ G +                           +N  T    R P LH AA +     + +L+      D     G TPLH AA     ++  LLL  GAN +       TPL  A+R G +  V+ LL  G  ++ K K+E T LH AAR G   ++ +LL   A + A+ + GL+P+  A        V+ L++   ++   D  T D  T LHVA    +  +V++LL  G        N F  + +H A   N    + L L H+ + +       + +  +P  +    GHL + K L +     S N++ VK
Sbjct:  137 VNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGF--TPLHIACKKNHMRSMDLLLKHSASLEA-----VTESGLTPLHVAAFMGHLNIVKSLLQRGA--SPNASNVK 469          

HSP 8 Score: 66.6254 bits (161), Expect = 6.763e-11
Identity = 71/292 (24.32%), Postives = 121/292 (41.44%), Query Frame = 3
Query:  501 STTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILI----------------------RSKCDLYKRD------YRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +TT+  R     AA S  L  +   I  G  I+  +  G   LH A+++G   ++  LL NG + ++      T L  A  +G+   V  L+  G NVN + +   + L+ AA++   +++  LL++ A      + G TPL  A+    ++VV +LI                      R+   L + D       +TG T LH+A     + + ++LL  G   + +   N G + +H A       +VRL L      D   K      E +P       GH+ + ++L
Sbjct:   45 ATTSFLR-----AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRG-ANVNFTPKN-GITPLHIASRRGNVIMVRLLLDRGAQIDAKTKD-----ELTPLHCAARNGHVRVVEIL 324          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 130.568 bits (327), Expect = 3.399e-31
Identity = 91/294 (30.95%), Postives = 142/294 (48.30%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQS--TTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +F G+ +I+  L+Q G   N +  ++     PLH AA +     +Q L+    Q+DAK     TPLH AA  G   L+ LL+++ AN DS      TPL  A R G     + LL          K   T LH A + G  D++ +LL+  A  +A  + GLTPL  AV ++   VV++L+ SK        R G TALH+A ++N + +   LL+ G      +    G + +H A    + ++V L +    N +     L +    +P  LV + GH+ +A +L
Sbjct:  435 LTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV-SKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQ--GITPLHLASQEGQPDMVALLISKQANVN-----LGNKNGLTPLHLVAQEGHVGIADML 720          

HSP 2 Score: 107.842 bits (268), Expect = 7.714e-24
Identity = 72/235 (30.64%), Postives = 118/235 (50.21%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNN 1115
            K   P+H+    G   ++  L++ G + N +       PLH A   + L   +LL++ GG   +    G T LH AA+  +  + + LLQ GAN++S+ +   TPL  A++ G+   V  L+    NVN+ +KN  T LH  A++G   +  ML+K  A + A ++ G TPL  A  Y    +V+ L++ +  +  +  R G T LH A ++ +  +V +LLK G    E   N 
Sbjct:  568 KGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGL-TPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSK-TRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNG 800          

HSP 3 Score: 107.457 bits (267), Expect = 9.881e-24
Identity = 88/290 (30.34%), Postives = 126/290 (43.45%), Query Frame = 3
Query:  525 PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK---------------------AGKWYI---------EYNFNNFGESFV----HDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            PLH AA    LS +QLL+N G  ++     G TPLH A+  G   ++ LLL  GA  D++     TPL  A R+G +  V+ LL  G  +  K KN  + +H AA+    D +  LL+Y+A ID      LTPL  A       +V++L+        R    G T LH+A +KN++  +++LLK                      G   I           N N F   +V    H A     CE+ +  L +N   D  AK      +++P       GH EL K+L
Sbjct:  239 PLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARAL-NGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKD-----DQTPLHCAARMGHKELVKLL 522          

HSP 4 Score: 94.7449 bits (234), Expect = 1.107e-19
Identity = 89/321 (27.73%), Postives = 136/321 (42.37%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDL------------------------------YKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +HL S +G+  ++  L+ +G+D+ ++TT      LH AA++ Q      LIN G  ++A+   G +PL+ AA++    ++  LL++GAN         TPL  A + G    V  L+    N   K K    ALH AAR        +LL+ D   D  ++ G TPL  A  Y   SV Q+L+    ++                               + D +T D  T LH A R  +V +VE+LL  G        N  G S +H A   +  + VR  L +N   D       +    +P  +    GH  + KVL
Sbjct:   79 LHLASKEGHVKMVLELLHNGIDL-ETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKN--GLSPIHMAAQGDHMDCVRQLLQYNAEIDD-----ITLDHLTPLHVAAHCGHHRMVKVL 387          

HSP 5 Score: 90.5077 bits (223), Expect = 2.537e-18
Identity = 79/329 (24.01%), Postives = 138/329 (41.95%), Query Frame = 3
Query:  414 DLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRS---------------------------------GRIGAVKRLLGVGCNVNVKDKNED---TALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +L P+H  +  G+  ++  L+  G  + Q+ T     P+H AA    + C + L+    +ID       TPLH AA  G + ++ +LL  GA ++++ +   TPL  A +                                  G +  VK LL  G + N    + D   T LH AAR G  ++   LL+ +A++DA+ +   TPL  A     + +V++L+  K +        G T LH+A R+ +     +LL       +     F  + +H A  Y + ++V L L    N +   K        +P  + +   +L++ K+L
Sbjct:  302 ELTPLHCAARNGHVRVVEILLDQGAPL-QAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKAN-PDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGF--TPLHVACKYGKVDVVELLLERGANPNAAGKN-----GLTPLHVAVHHNNLDVVKLL 621          

HSP 6 Score: 88.9669 bits (219), Expect = 7.273e-18
Identity = 85/330 (25.76%), Postives = 139/330 (42.12%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVD---------------------------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            V   + K   P+++ + + +  ++ YL++ G +                           +N  T    R P LH AA +     + +L+      D     G TPLH AA     ++  LLL  GAN +       TPL  A+R G +  V+ LL  G  ++ K K+E T LH AAR G   ++ +LL   A + A+ + GL+P+  A        V+ L++   ++   D  T D  T LHVA    +  +V++LL  G        N F  + +H A   N    + L L H+ + +       + +  +P  +    GHL + K L
Sbjct:  134 VNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGF--TPLHIACKKNHMRSMDLLLKHSASLEA-----VTESGLTPLHVAAFMGHLNIVKSL 453          

HSP 7 Score: 76.2554 bits (186), Expect = 6.814e-14
Identity = 55/182 (30.22%), Postives = 87/182 (47.80%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
            +H+ + +    +   L+Q G + N  +      PLH A+   Q     LLI+    ++  +  G TPLH  A++G   +  +L++ GA+  +      TPL  A   G I  VK LL    +VN K +   T LH AA+QG  D++ +LLK+ A  +     G +PL  A      SV+ +L
Sbjct:  639 LHIAAKQNQLEVASSLLQYGANANSESLQGI-TPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 819          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 120.939 bits (302), Expect = 7.288e-28
Identity = 87/292 (29.79%), Postives = 136/292 (46.58%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ SF G+  I+  L+Q G   N  +  +   PLH AA +     +  LI    +++A+     TPLH AA  G   ++ LLL+NGA+ D       TPL   TR G     + LL          K   T LH AA+ G   +  +LL+ +A  ++  + GLTPL  AV ++  ++V++L+      +    R G T LH+AV++  V     LL+ G      +    G + +H A      ++V L L    N       L + +  +P  L  + GHL +A+VL
Sbjct:  438 LTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-ETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHC-TARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQ--GVTPLHLAAQEGHGDMVTLLLSKQANV-----HLGNKSSLTPLHLASQEGHLNIAEVL 720          

HSP 2 Score: 97.4413 bits (241), Expect = 1.935e-20
Identity = 68/236 (28.81%), Postives = 113/236 (47.88%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNF 1118
            K   P+H+ +  G   I   L++     N +  T    PLH A   + L+  +LL+N G         G TPLH A +    +    LLQ GA  ++Q +   TPL  A + G    V  LL    NV++ +K+  T LH A+++G  ++  +L+ +DA + A+ + G  PL  A  Y    VV+ L++ + ++     + G T LH A ++ +  +V +LLK G    + + N  
Sbjct:  568 KGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGL-TPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAV-TKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGI 801          

HSP 3 Score: 96.2857 bits (238), Expect = 5.436e-20
Identity = 78/289 (26.99%), Postives = 133/289 (46.02%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +H+ S +G   ++  L+  G  ++  T      PLH A  +  +  S++L++ G  I AK   G +P+H A++    + + LLLQ  A+ D   + + TPL  A   G     K LL  G   N +  N  T LH A ++    ++ +LLK  A IDA  + GLTPL  A       +V+ L++          +  +T LH+A R  +  + + L++  K  +     +  ++ +H A      E+VRL L +  + D P     +    +P  L    GH + A++L
Sbjct:  276 LHIASRRGNVIMVRLLLDRGAQIDACTKDEL-TPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-ETPLHMAARAAHTDVADFLIQ-NKAKVNARAKD-DQTPLHCAARSGHYEMVRLLLENGAHPDPP-----TTAGHTPLHLTTRGGHTQTAELL 555          

HSP 4 Score: 92.4337 bits (228), Expect = 8.515e-19
Identity = 76/274 (27.74%), Postives = 128/274 (46.72%), Query Frame = 3
Query:  471 LIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L+Q+  + +  + T F  PLH AA    L+ +QLL+N G  ++     G + LH A+  G   ++ LLL  GA  D+      TPL  A R+G +   + LL  G  +  K KN  + +H A++    D + +LL+Y A ID      LTPL  A       V ++L+        R    G T LH+A +K+++ ++E+LLK+G           G + +H A +     +V+  L    + +  + K+     ++P  +     H ++A  L
Sbjct:  225 LLQNDPNADVLSKTGF-TPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARAL-NGFTPLHIACKKSHIRVMELLLKSGASIDA--VTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-----ETPLHMAARAAHTDVADFL 489          

HSP 5 Score: 78.9518 bits (193), Expect = 1.530e-14
Identity = 81/330 (24.55%), Postives = 137/330 (41.52%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLF---------------------------RQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            V   + K   P+++ + + +  ++ +L+++G + N +T   F                           R P LH AA +     + +L+      D     G TPLH AA     N+  LLL  GAN +       + L  A+R G +  V+ LL  G  ++   K+E T LH A R G   +  +LL + A I A+ + GL+P+  A        V++L++ +  +   D  T D  T LHVA    +  + ++LL  G        N F  + +H A   +   ++ L L    + D       + +  +P  +    GHL + K L
Sbjct:  137 VNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHI---DDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGF--TPLHIACKKSHIRVMELLLKSGASIDA-----VTESGLTPLHVASFMGHLPIVKTL 456          

HSP 6 Score: 70.8626 bits (172), Expect = 4.075e-12
Identity = 75/302 (24.83%), Postives = 121/302 (40.07%), Query Frame = 3
Query:  474 IQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVN-----------------------------VKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +++GVD+N          LH ++    +     L++    ++     GNT LH AA  G+ +++  L+ +GAN +SQ     TPL  A +   +  VK LL  G N N                             +K K    ALH AAR        +LL+ D   D  ++ G TPL  A  Y   +V Q+L+    ++     + G +ALH+A R+  V +V +LL  G        +    + +H AV      +  + L H        K        SP  +  +  HL+  ++L
Sbjct:   65 LRNGVDINTCNQNGLNA-LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANV-NFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDEL--TPLHCAVRNGHVRISEILLDHGAPIQAKTKN-----GLSPIHMASQGDHLDCVRLL 357          

HSP 7 Score: 68.1662 bits (165), Expect = 3.235e-11
Identity = 55/183 (30.05%), Postives = 82/183 (44.81%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
            P+H+   +        L+Q G   N  +      PLH AA         LL++    +   +    TPLH A+++G  N+  +L+ + A+  ++      PL  A   G I  VK LL    NVN   K   T LH AA+QG  D++ +LLK  A  +  +  G+TPL  A      SV  +L
Sbjct:  638 PLHMAVKQRSVDTARALLQFGATCNAQSLQGV-TPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 819          

HSP 8 Score: 66.2402 bits (160), Expect = 1.235e-10
Identity = 45/141 (31.91%), Postives = 65/141 (46.10%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNE 815
            V   N   L P+HL S +G+ +I   L+     V   T   F  PLH A     +   + L+     ++A    G TPLH AA+ G  +++TLLL+NGA  +   +   TPL  A R G I     L  V    +++  NE
Sbjct:  694 VHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGF-APLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANE 833          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 120.939 bits (302), Expect = 7.320e-28
Identity = 87/292 (29.79%), Postives = 136/292 (46.58%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ SF G+  I+  L+Q G   N  +  +   PLH AA +     +  LI    +++A+     TPLH AA  G   ++ LLL+NGA+ D       TPL   TR G     + LL          K   T LH AA+ G   +  +LL+ +A  ++  + GLTPL  AV ++  ++V++L+      +    R G T LH+AV++  V     LL+ G      +    G + +H A      ++V L L    N       L + +  +P  L  + GHL +A+VL
Sbjct:  401 LTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-ETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHC-TARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQ--GVTPLHLAAQEGHGDMVTLLLSKQANV-----HLGNKSSLTPLHLASQEGHLNIAEVL 683          

HSP 2 Score: 97.8265 bits (242), Expect = 1.845e-20
Identity = 68/236 (28.81%), Postives = 113/236 (47.88%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNF 1118
            K   P+H+ +  G   I   L++     N +  T    PLH A   + L+  +LL+N G         G TPLH A +    +    LLQ GA  ++Q +   TPL  A + G    V  LL    NV++ +K+  T LH A+++G  ++  +L+ +DA + A+ + G  PL  A  Y    VV+ L++ + ++     + G T LH A ++ +  +V +LLK G    + + N  
Sbjct:  531 KGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGL-TPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAV-TKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGI 764          

HSP 3 Score: 96.2857 bits (238), Expect = 5.559e-20
Identity = 78/289 (26.99%), Postives = 133/289 (46.02%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +H+ S +G   ++  L+  G  ++  T      PLH A  +  +  S++L++ G  I AK   G +P+H A++    + + LLLQ  A+ D   + + TPL  A   G     K LL  G   N +  N  T LH A ++    ++ +LLK  A IDA  + GLTPL  A       +V+ L++          +  +T LH+A R  +  + + L++  K  +     +  ++ +H A      E+VRL L +  + D P     +    +P  L    GH + A++L
Sbjct:  239 LHIASRRGNVIMVRLLLDRGAQIDACTKDEL-TPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-ETPLHMAARAAHTDVADFLIQ-NKAKVNARAKD-DQTPLHCAARSGHYEMVRLLLENGAHPDPP-----TTAGHTPLHLTTRGGHTQTAELL 518          

HSP 4 Score: 92.4337 bits (228), Expect = 7.641e-19
Identity = 76/274 (27.74%), Postives = 128/274 (46.72%), Query Frame = 3
Query:  471 LIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L+Q+  + +  + T F  PLH AA    L+ +QLL+N G  ++     G + LH A+  G   ++ LLL  GA  D+      TPL  A R+G +   + LL  G  +  K KN  + +H A++    D + +LL+Y A ID      LTPL  A       V ++L+        R    G T LH+A +K+++ ++E+LLK+G           G + +H A +     +V+  L    + +  + K+     ++P  +     H ++A  L
Sbjct:  188 LLQNDPNADVLSKTGF-TPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARAL-NGFTPLHIACKKSHIRVMELLLKSGASIDA--VTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-----ETPLHMAARAAHTDVADFL 452          

HSP 5 Score: 78.9518 bits (193), Expect = 1.525e-14
Identity = 81/330 (24.55%), Postives = 137/330 (41.52%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLF---------------------------RQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            V   + K   P+++ + + +  ++ +L+++G + N +T   F                           R P LH AA +     + +L+      D     G TPLH AA     N+  LLL  GAN +       + L  A+R G +  V+ LL  G  ++   K+E T LH A R G   +  +LL + A I A+ + GL+P+  A        V++L++ +  +   D  T D  T LHVA    +  + ++LL  G        N F  + +H A   +   ++ L L    + D       + +  +P  +    GHL + K L
Sbjct:  100 VNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHI---DDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGF--TPLHIACKKSHIRVMELLLKSGASIDA-----VTESGLTPLHVASFMGHLPIVKTL 419          

HSP 6 Score: 71.2478 bits (173), Expect = 3.729e-12
Identity = 75/302 (24.83%), Postives = 121/302 (40.07%), Query Frame = 3
Query:  474 IQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVN-----------------------------VKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +++GVD+N          LH ++    +     L++    ++     GNT LH AA  G+ +++  L+ +GAN +SQ     TPL  A +   +  VK LL  G N N                             +K K    ALH AAR        +LL+ D   D  ++ G TPL  A  Y   +V Q+L+    ++     + G +ALH+A R+  V +V +LL  G        +    + +H AV      +  + L H        K        SP  +  +  HL+  ++L
Sbjct:   28 LRNGVDINTCNQNGLNA-LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANV-NFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDEL--TPLHCAVRNGHVRISEILLDHGAPIQAKTKN-----GLSPIHMASQGDHLDCVRLL 320          

HSP 7 Score: 68.1662 bits (165), Expect = 3.144e-11
Identity = 55/183 (30.05%), Postives = 82/183 (44.81%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
            P+H+   +        L+Q G   N  +      PLH AA         LL++    +   +    TPLH A+++G  N+  +L+ + A+  ++      PL  A   G I  VK LL    NVN   K   T LH AA+QG  D++ +LLK  A  +  +  G+TPL  A      SV  +L
Sbjct:  601 PLHMAVKQRSVDTARALLQFGATCNAQSLQGV-TPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 782          

HSP 8 Score: 66.2402 bits (160), Expect = 1.150e-10
Identity = 47/148 (31.76%), Postives = 68/148 (45.95%), Query Frame = 3
Query:  372 LNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNE 815
            L +K   V   N   L P+HL S +G+ +I   L+     V   T   F  PLH A     +   + L+     ++A    G TPLH AA+ G  +++TLLL+NGA  +   +   TPL  A R G I     L  V    +++  NE
Sbjct:  650 LLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGF-APLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANE 796          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 120.553 bits (301), Expect = 7.892e-28
Identity = 87/292 (29.79%), Postives = 136/292 (46.58%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ SF G+  I+  L+Q G   N  +  +   PLH AA +     +  LI    +++A+     TPLH AA  G   ++ LLL+NGA+ D       TPL   TR G     + LL          K   T LH AA+ G   +  +LL+ +A  ++  + GLTPL  AV ++  ++V++L+      +    R G T LH+AV++  V     LL+ G      +    G + +H A      ++V L L    N       L + +  +P  L  + GHL +A+VL
Sbjct:  396 LTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-ETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHC-TARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQ--GVTPLHLAAQEGHGDMVTLLLSKQANV-----HLGNKSSLTPLHLASQEGHLNIAEVL 678          

HSP 2 Score: 97.4413 bits (241), Expect = 2.279e-20
Identity = 67/225 (29.78%), Postives = 110/225 (48.89%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            K   P+H+ +  G   I   L++     N +  T    PLH A   + L+  +LL+N G         G TPLH A +    +    LLQ GA  ++Q +   TPL  A + G    V  LL    NV++ +K+  T LH A+++G  ++  +L+ +DA + A+ + G  PL  A  Y    VV+ L++ + ++     + G T LH A ++ +  +V +LLK G
Sbjct:  526 KGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGL-TPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAV-TKLGFTPLHQAAQQGHTDIVTLLLKNG 748          

HSP 3 Score: 96.6709 bits (239), Expect = 3.789e-20
Identity = 78/289 (26.99%), Postives = 133/289 (46.02%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +H+ S +G   ++  L+  G  ++  T      PLH A  +  +  S++L++ G  I AK   G +P+H A++    + + LLLQ  A+ D   + + TPL  A   G     K LL  G   N +  N  T LH A ++    ++ +LLK  A IDA  + GLTPL  A       +V+ L++          +  +T LH+A R  +  + + L++  K  +     +  ++ +H A      E+VRL L +  + D P     +    +P  L    GH + A++L
Sbjct:  234 LHIASRRGNVIMVRLLLDRGAQIDACTKDEL-TPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-ETPLHMAARAAHTDVADFLIQ-NKAKVNARAKD-DQTPLHCAARSGHYEMVRLLLENGAHPDPP-----TTAGHTPLHLTTRGGHTQTAELL 513          

HSP 4 Score: 92.8189 bits (229), Expect = 5.221e-19
Identity = 76/274 (27.74%), Postives = 128/274 (46.72%), Query Frame = 3
Query:  471 LIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L+Q+  + +  + T F  PLH AA    L+ +QLL+N G  ++     G + LH A+  G   ++ LLL  GA  D+      TPL  A R+G +   + LL  G  +  K KN  + +H A++    D + +LL+Y A ID      LTPL  A       V ++L+        R    G T LH+A +K+++ ++E+LLK+G           G + +H A +     +V+  L    + +  + K+     ++P  +     H ++A  L
Sbjct:  183 LLQNDPNADVLSKTGF-TPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARAL-NGFTPLHIACKKSHIRVMELLLKSGASIDA--VTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-----ETPLHMAARAAHTDVADFL 447          

HSP 5 Score: 78.9518 bits (193), Expect = 1.251e-14
Identity = 81/330 (24.55%), Postives = 137/330 (41.52%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLF---------------------------RQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            V   + K   P+++ + + +  ++ +L+++G + N +T   F                           R P LH AA +     + +L+      D     G TPLH AA     N+  LLL  GAN +       + L  A+R G +  V+ LL  G  ++   K+E T LH A R G   +  +LL + A I A+ + GL+P+  A        V++L++ +  +   D  T D  T LHVA    +  + ++LL  G        N F  + +H A   +   ++ L L    + D       + +  +P  +    GHL + K L
Sbjct:   95 VNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHI---DDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGF--TPLHIACKKSHIRVMELLLKSGASIDA-----VTESGLTPLHVASFMGHLPIVKTL 414          

HSP 6 Score: 71.2478 bits (173), Expect = 3.047e-12
Identity = 75/302 (24.83%), Postives = 121/302 (40.07%), Query Frame = 3
Query:  474 IQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVN-----------------------------VKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +++GVD+N          LH ++    +     L++    ++     GNT LH AA  G+ +++  L+ +GAN +SQ     TPL  A +   +  VK LL  G N N                             +K K    ALH AAR        +LL+ D   D  ++ G TPL  A  Y   +V Q+L+    ++     + G +ALH+A R+  V +V +LL  G        +    + +H AV      +  + L H        K        SP  +  +  HL+  ++L
Sbjct:   23 LRNGVDINTCNQNGLNA-LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANV-NFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDEL--TPLHCAVRNGHVRISEILLDHGAPIQAKTKN-----GLSPIHMASQGDHLDCVRLL 315          

HSP 7 Score: 60.8474 bits (146), Expect = 5.461e-9
Identity = 47/155 (30.32%), Postives = 70/155 (45.16%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDA 887
            P+H+   +        L+Q G   N  +      PLH AA         LL++    +   +    TPLH A+++G  N+  +L+ + A+  ++      PL  A   G I  VK LL    NVN   K   T LH AA+QG  D++ +LLK  A
Sbjct:  596 PLHMAVKQRSVDTARALLQFGATCNAQSLQGV-TPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA 749          

HSP 8 Score: 50.8322 bits (120), Expect = 6.539e-6
Identity = 37/132 (28.03%), Postives = 65/132 (49.24%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDV---NQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVN 797
            + + P+HL + +G+  ++  L+    +V   N+S+ T    PLH A+    L+ +++L++    + A+   G  PLH A   G   ++  LLQ+ AN ++      TPL +A + G    V  LL  G   N
Sbjct:  625 QGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLT----PLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPN 752          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 120.553 bits (301), Expect = 8.058e-28
Identity = 87/292 (29.79%), Postives = 136/292 (46.58%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ SF G+  I+  L+Q G   N  +  +   PLH AA +     +  LI    +++A+     TPLH AA  G   ++ LLL+NGA+ D       TPL   TR G     + LL          K   T LH AA+ G   +  +LL+ +A  ++  + GLTPL  AV ++  ++V++L+      +    R G T LH+AV++  V     LL+ G      +    G + +H A      ++V L L    N       L + +  +P  L  + GHL +A+VL
Sbjct:  363 LTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-ETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHC-TARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQ--GVTPLHLAAQEGHGDMVTLLLSKQANV-----HLGNKSSLTPLHLASQEGHLNIAEVL 645          

HSP 2 Score: 97.4413 bits (241), Expect = 1.957e-20
Identity = 68/236 (28.81%), Postives = 113/236 (47.88%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNF 1118
            K   P+H+ +  G   I   L++     N +  T    PLH A   + L+  +LL+N G         G TPLH A +    +    LLQ GA  ++Q +   TPL  A + G    V  LL    NV++ +K+  T LH A+++G  ++  +L+ +DA + A+ + G  PL  A  Y    VV+ L++ + ++     + G T LH A ++ +  +V +LLK G    + + N  
Sbjct:  493 KGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGL-TPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAV-TKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGI 726          

HSP 3 Score: 95.9005 bits (237), Expect = 5.695e-20
Identity = 78/289 (26.99%), Postives = 133/289 (46.02%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +H+ S +G   ++  L+  G  ++  T      PLH A  +  +  S++L++ G  I AK   G +P+H A++    + + LLLQ  A+ D   + + TPL  A   G     K LL  G   N +  N  T LH A ++    ++ +LLK  A IDA  + GLTPL  A       +V+ L++          +  +T LH+A R  +  + + L++  K  +     +  ++ +H A      E+VRL L +  + D P     +    +P  L    GH + A++L
Sbjct:  201 LHIASRRGNVIMVRLLLDRGAQIDACTKDEL-TPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-ETPLHMAARAAHTDVADFLIQ-NKAKVNARAKD-DQTPLHCAARSGHYEMVRLLLENGAHPDPP-----TTAGHTPLHLTTRGGHTQTAELL 480          

HSP 4 Score: 92.0485 bits (227), Expect = 9.320e-19
Identity = 76/274 (27.74%), Postives = 128/274 (46.72%), Query Frame = 3
Query:  471 LIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L+Q+  + +  + T F  PLH AA    L+ +QLL+N G  ++     G + LH A+  G   ++ LLL  GA  D+      TPL  A R+G +   + LL  G  +  K KN  + +H A++    D + +LL+Y A ID      LTPL  A       V ++L+        R    G T LH+A +K+++ ++E+LLK+G           G + +H A +     +V+  L    + +  + K+     ++P  +     H ++A  L
Sbjct:  150 LLQNDPNADVLSKTGF-TPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARAL-NGFTPLHIACKKSHIRVMELLLKSGASI--DAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-----ETPLHMAARAAHTDVADFL 414          

HSP 5 Score: 90.8929 bits (224), Expect = 2.209e-18
Identity = 79/289 (27.34%), Postives = 131/289 (45.33%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +HL S +G+  ++  L+   + V ++TT      LH AA++ Q    + L+N G  ++++   G TPL+ AA++    ++  LL+NGAN +       TPL  A + G    V  L+  G    +K K    ALH AAR        +LL+ D   D  ++ G TPL  A  Y   +V Q+L+    ++     + G +ALH+A R+  V +V +LL  G        +    + +H AV      +  + L H        K        SP  +  +  HL+  ++L
Sbjct:    7 LHLSSKEGHVKMVTELLHKDI-VLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYG----MKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANV-NFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDEL--TPLHCAVRNGHVRISEILLDHGAPIQAKTKN-----GLSPIHMASQGDHLDCVRLL 282          

HSP 6 Score: 78.5666 bits (192), Expect = 1.794e-14
Identity = 81/330 (24.55%), Postives = 137/330 (41.52%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLF---------------------------RQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            V   + K   P+++ + + +  ++ +L+++G + N +T   F                           R P LH AA +     + +L+      D     G TPLH AA     N+  LLL  GAN +       + L  A+R G +  V+ LL  G  ++   K+E T LH A R G   +  +LL + A I A+ + GL+P+  A        V++L++ +  +   D  T D  T LHVA    +  + ++LL  G        N F  + +H A   +   ++ L L    + D       + +  +P  +    GHL + K L
Sbjct:   62 VNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHI---DDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGF--TPLHIACKKSHIRVMELLLKSGASIDA-----VTESGLTPLHVASFMGHLPIVKTL 381          

HSP 7 Score: 68.1662 bits (165), Expect = 3.422e-11
Identity = 55/183 (30.05%), Postives = 82/183 (44.81%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
            P+H+   +        L+Q G   N  +      PLH AA         LL++    +   +    TPLH A+++G  N+  +L+ + A+  ++      PL  A   G I  VK LL    NVN   K   T LH AA+QG  D++ +LLK  A  +  +  G+TPL  A      SV  +L
Sbjct:  563 PLHMAVKQRSVDTARALLQFGATCNAQSLQGV-TPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 744          

HSP 8 Score: 66.2402 bits (160), Expect = 1.273e-10
Identity = 45/141 (31.91%), Postives = 65/141 (46.10%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNE 815
            V   N   L P+HL S +G+ +I   L+     V   T   F  PLH A     +   + L+     ++A    G TPLH AA+ G  +++TLLL+NGA  +   +   TPL  A R G I     L  V    +++  NE
Sbjct:  619 VHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGF-APLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANE 758          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 120.553 bits (301), Expect = 8.968e-28
Identity = 87/292 (29.79%), Postives = 136/292 (46.58%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ SF G+  I+  L+Q G   N  +  +   PLH AA +     +  LI    +++A+     TPLH AA  G   ++ LLL+NGA+ D       TPL   TR G     + LL          K   T LH AA+ G   +  +LL+ +A  ++  + GLTPL  AV ++  ++V++L+      +    R G T LH+AV++  V     LL+ G      +    G + +H A      ++V L L    N       L + +  +P  L  + GHL +A+VL
Sbjct:  438 LTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-ETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHC-TARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQ--GVTPLHLAAQEGHGDMVTLLLSKQANV-----HLGNKSSLTPLHLASQEGHLNIAEVL 720          

HSP 2 Score: 97.4413 bits (241), Expect = 2.190e-20
Identity = 68/236 (28.81%), Postives = 113/236 (47.88%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNF 1118
            K   P+H+ +  G   I   L++     N +  T    PLH A   + L+  +LL+N G         G TPLH A +    +    LLQ GA  ++Q +   TPL  A + G    V  LL    NV++ +K+  T LH A+++G  ++  +L+ +DA + A+ + G  PL  A  Y    VV+ L++ + ++     + G T LH A ++ +  +V +LLK G    + + N  
Sbjct:  568 KGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGL-TPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAV-TKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGI 801          

HSP 3 Score: 95.9005 bits (237), Expect = 6.715e-20
Identity = 78/289 (26.99%), Postives = 133/289 (46.02%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +H+ S +G   ++  L+  G  ++  T      PLH A  +  +  S++L++ G  I AK   G +P+H A++    + + LLLQ  A+ D   + + TPL  A   G     K LL  G   N +  N  T LH A ++    ++ +LLK  A IDA  + GLTPL  A       +V+ L++          +  +T LH+A R  +  + + L++  K  +     +  ++ +H A      E+VRL L +  + D P     +    +P  L    GH + A++L
Sbjct:  276 LHIASRRGNVIMVRLLLDRGAQIDACTKDEL-TPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-ETPLHMAARAAHTDVADFLIQ-NKAKVNARAKD-DQTPLHCAARSGHYEMVRLLLENGAHPDPP-----TTAGHTPLHLTTRGGHTQTAELL 555          

HSP 4 Score: 92.0485 bits (227), Expect = 1.006e-18
Identity = 76/274 (27.74%), Postives = 128/274 (46.72%), Query Frame = 3
Query:  471 LIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L+Q+  + +  + T F  PLH AA    L+ +QLL+N G  ++     G + LH A+  G   ++ LLL  GA  D+      TPL  A R+G +   + LL  G  +  K KN  + +H A++    D + +LL+Y A ID      LTPL  A       V ++L+        R    G T LH+A +K+++ ++E+LLK+G           G + +H A +     +V+  L    + +  + K+     ++P  +     H ++A  L
Sbjct:  225 LLQNDPNADVLSKTGF-TPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARAL-NGFTPLHIACKKSHIRVMELLLKSGASIDA--VTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-----ETPLHMAARAAHTDVADFL 489          

HSP 5 Score: 78.5666 bits (192), Expect = 1.852e-14
Identity = 81/330 (24.55%), Postives = 137/330 (41.52%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLF---------------------------RQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            V   + K   P+++ + + +  ++ +L+++G + N +T   F                           R P LH AA +     + +L+      D     G TPLH AA     N+  LLL  GAN +       + L  A+R G +  V+ LL  G  ++   K+E T LH A R G   +  +LL + A I A+ + GL+P+  A        V++L++ +  +   D  T D  T LHVA    +  + ++LL  G        N F  + +H A   +   ++ L L    + D       + +  +P  +    GHL + K L
Sbjct:  137 VNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHI---DDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGF--TPLHIACKKSHIRVMELLLKSGASIDA-----VTESGLTPLHVASFMGHLPIVKTL 456          

HSP 6 Score: 70.8626 bits (172), Expect = 4.601e-12
Identity = 75/302 (24.83%), Postives = 121/302 (40.07%), Query Frame = 3
Query:  474 IQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVN-----------------------------VKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +++GVD+N          LH ++    +     L++    ++     GNT LH AA  G+ +++  L+ +GAN +SQ     TPL  A +   +  VK LL  G N N                             +K K    ALH AAR        +LL+ D   D  ++ G TPL  A  Y   +V Q+L+    ++     + G +ALH+A R+  V +V +LL  G        +    + +H AV      +  + L H        K        SP  +  +  HL+  ++L
Sbjct:   65 LRNGVDINTCNQNGLNA-LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANV-NFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDEL--TPLHCAVRNGHVRISEILLDHGAPIQAKTKN-----GLSPIHMASQGDHLDCVRLL 357          

HSP 7 Score: 67.781 bits (164), Expect = 3.845e-11
Identity = 55/183 (30.05%), Postives = 82/183 (44.81%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
            P+H+   +        L+Q G   N  +      PLH AA         LL++    +   +    TPLH A+++G  N+  +L+ + A+  ++      PL  A   G I  VK LL    NVN   K   T LH AA+QG  D++ +LLK  A  +  +  G+TPL  A      SV  +L
Sbjct:  638 PLHMAVKQRSVDTARALLQFGATCNAQSLQGV-TPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 819          

HSP 8 Score: 66.2402 bits (160), Expect = 1.301e-10
Identity = 45/141 (31.91%), Postives = 65/141 (46.10%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNE 815
            V   N   L P+HL S +G+ +I   L+     V   T   F  PLH A     +   + L+     ++A    G TPLH AA+ G  +++TLLL+NGA  +   +   TPL  A R G I     L  V    +++  NE
Sbjct:  694 VHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGF-APLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANE 833          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 125.561 bits (314), Expect = 1.516e-29
Identity = 89/293 (30.38%), Postives = 142/293 (48.46%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +F G+ +I+  L+  G   N +T       LH AA S Q    + L+  G Q++AK     TPLH +A  G+ +++  LLQ GA+ ++   +  TPL  A R G       LL  G ++++  K   T LH AA+ G  ++  +LL+  A  DA  + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +KN + +   LL+ G    + N     G + VH A      ++V L L  N N +     L++ +  +P  L  +   + +A+VL
Sbjct:  417 LTPIHVAAFMGHVNIVSQLMHHGASPN-TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAA-AKNGYTPLHIAAKKNQMDIATSLLEYG---ADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVN-----LSNKSGLTPLHLAAQEDRVNVAEVL 699          

HSP 2 Score: 102.834 bits (255), Expect = 3.472e-22
Identity = 81/308 (26.30%), Postives = 139/308 (45.13%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKR 1340
            L  +H+ +  G++ +   L+      N      F  PLH A   +++   +LL+  G  I A    G TP+H AA  G  N+++ L+ +GA+ ++ ++  +T L  A RSG+   V+ L+  G  V  K K++ T LH +AR G AD++  LL+  A  +A    G TPL  A     + V   L+     L     + G T LHVA +   + +  +LL+  K          G + +H A  Y+  ++  L L    +    AK        +P  +  ++  +++A  L      +  ++N V R
Sbjct:  351 LTALHVAAHCGHYKVAKVLLDKKASPNAKALNGF-TPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASL-SITTKKGFTPLHVAAKYGKLEVASLLLQ--KSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK-----NGYTPLHIAAKKNQMDIATSL----LEYGADANAVTR 645          

HSP 3 Score: 98.2117 bits (243), Expect = 9.262e-21
Identity = 68/257 (26.46%), Postives = 118/257 (45.91%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHN 1190
             P+HL + +G+  +  +L+  G  ++ +T   F  PLH AA   +L  + LL+      DA    G TPLH AA      +  LLL  GA+  +      TPL  A +  ++     LL  G + N   +    ++H AA++G  D++ +LL  +A ++  N+ GLTPL  A    + +V ++L+     +  +  + G T LHV      + +V  LL+          N +  + +H A       ++ + L +N
Sbjct:  517 TPLHLAAREGHEDVAAFLLDHGASLSITTKKGF-TPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQ-TKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGY--TALHQAAQQGHTHIINVLLQNN 769          

HSP 4 Score: 91.2781 bits (225), Expect = 1.432e-18
Identity = 80/258 (31.01%), Postives = 113/258 (43.80%), Query Frame = 3
Query:  453 FSILHYLIQSGVD------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRS--KCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNF 1199
            F+ L   +Q G D      +   T    R P LH AA       + LL+      D +   G TPLH AA  G  N+ TLLL   A  D     + TPL  A++ G    VK LL  G  ++ K ++  T LH  AR G   ++ MLL   A I ++ + GL+PL  A      + VQ+L++     D    DY    TALHVA    +  + ++LL           N F  + +H A   NR  ++ L L H  + 
Sbjct:  157 FTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYL---TALHVAAHCGHYKVAKVLLDKKASPNAKALNGF--TPLHIACKKNRIRVMELLLKHGASI 409          

HSP 5 Score: 83.5741 bits (205), Expect = 4.192e-16
Identity = 73/299 (24.41%), Postives = 124/299 (41.47%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQID---------------------------------AKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAK 1214
            L P+H  +  G+  ++  L+     +   T      PLH A     L+C QLL+     +D                                 AK   G TPLH A +     ++ LLL++GA+  +   +  TP+  A   G +  V +L+  G + N  +   +TALH AAR G A+++  L++  A+++A+ +   TPL  +    +  +VQ L++           +G T LH+A R+ +  +   LL  G          F  + +H A  Y + E+  L L  + + D   K
Sbjct:  285 LTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGL-SPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS-PNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGF--TPLHVAAKYGKLEVASLLLQKSASPDAAGK 579          

HSP 6 Score: 76.2554 bits (186), Expect = 7.163e-14
Identity = 60/184 (32.61%), Postives = 85/184 (46.20%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
             P+H+ + K    I   L++ G D N  T       +H AA    +    LL++    ++  +  G TPLH AA++   N+  +L+  GA+ D+Q     TPL      G I  V  LL     VN K KN  TALH AA+QG   +I +LL+ +A  +     G T L  A      SVV  L
Sbjct:  616 TPLHIAAKKNQMDIATSLLEYGADANAVTRQGIAS-VHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 7 Score: 74.7146 bits (182), Expect = 2.215e-13
Identity = 91/371 (24.53%), Postives = 134/371 (36.12%), Query Frame = 3
Query:  363 KFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNV-----------------------------NVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRD------------------------------YRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            K D NA +    R+ H +               L Y I++GVDVN          LH A+    +     L+     +DA    GNT LH A+  G+  ++ +L+ NGAN ++Q     TPL  A +   +  V+ LL  G +                              + K K    ALH AAR+       +LL+ D   D +++ G TPL  A  Y   +V  +L+   +  D   R+                               R G T LH   R  +  +VEMLL      +    N  G S +H A   +    V+L L HN   D       +        +    GH ++AKVL
Sbjct:   21 KSDANASYLRAARAGHLE-------------KALDY-IKNGVDVNICNQNGLNA-LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKN--GLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTA-----LHVAAHCGHYKVAKVL 369          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 125.561 bits (314), Expect = 1.558e-29
Identity = 89/293 (30.38%), Postives = 142/293 (48.46%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +F G+ +I+  L+  G   N +T       LH AA S Q    + L+  G Q++AK     TPLH +A  G+ +++  LLQ GA+ ++   +  TPL  A R G       LL  G ++++  K   T LH AA+ G  ++  +LL+  A  DA  + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +KN + +   LL+ G    + N     G + VH A      ++V L L  N N +     L++ +  +P  L  +   + +A+VL
Sbjct:  417 LTPIHVAAFMGHVNIVSQLMHHGASPN-TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAA-AKNGYTPLHIAAKKNQMDIATSLLEYGA---DANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVN-----LSNKSGLTPLHLAAQEDRVNVAEVL 699          

HSP 2 Score: 102.834 bits (255), Expect = 2.998e-22
Identity = 81/308 (26.30%), Postives = 139/308 (45.13%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKR 1340
            L  +H+ +  G++ +   L+      N      F  PLH A   +++   +LL+  G  I A    G TP+H AA  G  N+++ L+ +GA+ ++ ++  +T L  A RSG+   V+ L+  G  V  K K++ T LH +AR G AD++  LL+  A  +A    G TPL  A     + V   L+     L     + G T LHVA +   + +  +LL+  K          G + +H A  Y+  ++  L L    +    AK        +P  +  ++  +++A  L      +  ++N V R
Sbjct:  351 LTALHVAAHCGHYKVAKVLLDKKASPNAKALNGF-TPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASL-SITTKKGFTPLHVAAKYGKLEVASLLLQ--KSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK-----NGYTPLHIAAKKNQMDIATSL----LEYGADANAVTR 645          

HSP 3 Score: 98.2117 bits (243), Expect = 8.590e-21
Identity = 68/257 (26.46%), Postives = 118/257 (45.91%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHN 1190
             P+HL + +G+  +  +L+  G  ++ +T   F  PLH AA   +L  + LL+      DA    G TPLH AA      +  LLL  GA+  +      TPL  A +  ++     LL  G + N   +    ++H AA++G  D++ +LL  +A ++  N+ GLTPL  A    + +V ++L+     +  +  + G T LHV      + +V  LL+          N +  + +H A       ++ + L +N
Sbjct:  517 TPLHLAAREGHEDVAAFLLDHGASLSITTKKGF-TPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQ-TKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGY--TALHQAAQQGHTHIINVLLQNN 769          

HSP 4 Score: 91.2781 bits (225), Expect = 1.543e-18
Identity = 80/258 (31.01%), Postives = 113/258 (43.80%), Query Frame = 3
Query:  453 FSILHYLIQSGVD------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRS--KCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNF 1199
            F+ L   +Q G D      +   T    R P LH AA       + LL+      D +   G TPLH AA  G  N+ TLLL   A  D     + TPL  A++ G    VK LL  G  ++ K ++  T LH  AR G   ++ MLL   A I ++ + GL+PL  A      + VQ+L++     D    DY    TALHVA    +  + ++LL           N F  + +H A   NR  ++ L L H  + 
Sbjct:  157 FTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYL---TALHVAAHCGHYKVAKVLLDKKASPNAKALNGF--TPLHIACKKNRIRVMELLLKHGASI 409          

HSP 5 Score: 83.1889 bits (204), Expect = 4.257e-16
Identity = 73/299 (24.41%), Postives = 124/299 (41.47%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQID---------------------------------AKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAK 1214
            L P+H  +  G+  ++  L+     +   T      PLH A     L+C QLL+     +D                                 AK   G TPLH A +     ++ LLL++GA+  +   +  TP+  A   G +  V +L+  G + N  +   +TALH AAR G A+++  L++  A+++A+ +   TPL  +    +  +VQ L++           +G T LH+A R+ +  +   LL  G          F  + +H A  Y + E+  L L  + + D   K
Sbjct:  285 LTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGL-SPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS-PNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGF--TPLHVAAKYGKLEVASLLLQKSASPDAAGK 579          

HSP 6 Score: 76.6406 bits (187), Expect = 5.028e-14
Identity = 60/184 (32.61%), Postives = 85/184 (46.20%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
             P+H+ + K    I   L++ G D N  T       +H AA    +    LL++    ++  +  G TPLH AA++   N+  +L+  GA+ D+Q     TPL      G I  V  LL     VN K KN  TALH AA+QG   +I +LL+ +A  +     G T L  A      SVV  L
Sbjct:  616 TPLHIAAKKNQMDIATSLLEYGADANAVTRQGIAS-VHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 7 Score: 75.0998 bits (183), Expect = 1.833e-13
Identity = 91/371 (24.53%), Postives = 134/371 (36.12%), Query Frame = 3
Query:  363 KFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNV-----------------------------NVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRD------------------------------YRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            K D NA +    R+ H +               L Y I++GVDVN          LH A+    +     L+     +DA    GNT LH A+  G+  ++ +L+ NGAN ++Q     TPL  A +   +  V+ LL  G +                              + K K    ALH AAR+       +LL+ D   D +++ G TPL  A  Y   +V  +L+   +  D   R+                               R G T LH   R  +  +VEMLL      +    N  G S +H A   +    V+L L HN   D       +        +    GH ++AKVL
Sbjct:   21 KSDANASYLRAARAGHLE-------------KALDY-IKNGVDVNICNQNGLNA-LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKN--GLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTA-----LHVAAHCGHYKVAKVL 369          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 125.561 bits (314), Expect = 1.635e-29
Identity = 89/293 (30.38%), Postives = 142/293 (48.46%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +F G+ +I+  L+  G   N +T       LH AA S Q    + L+  G Q++AK     TPLH +A  G+ +++  LLQ GA+ ++   +  TPL  A R G       LL  G ++++  K   T LH AA+ G  ++  +LL+  A  DA  + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +KN + +   LL+ G    + N     G + VH A      ++V L L  N N +     L++ +  +P  L  +   + +A+VL
Sbjct:  417 LTPIHVAAFMGHVNIVSQLMHHGASPN-TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAA-AKNGYTPLHIAAKKNQMDIATSLLEYGA---DANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVN-----LSNKSGLTPLHLAAQEDRVNVAEVL 699          

HSP 2 Score: 102.834 bits (255), Expect = 3.067e-22
Identity = 81/308 (26.30%), Postives = 139/308 (45.13%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKR 1340
            L  +H+ +  G++ +   L+      N      F  PLH A   +++   +LL+  G  I A    G TP+H AA  G  N+++ L+ +GA+ ++ ++  +T L  A RSG+   V+ L+  G  V  K K++ T LH +AR G AD++  LL+  A  +A    G TPL  A     + V   L+     L     + G T LHVA +   + +  +LL+  K          G + +H A  Y+  ++  L L    +    AK        +P  +  ++  +++A  L      +  ++N V R
Sbjct:  351 LTALHVAAHCGHYKVAKVLLDKKASPNAKALNGF-TPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASL-SITTKKGFTPLHVAAKYGKLEVASLLLQ--KSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK-----NGYTPLHIAAKKNQMDIATSL----LEYGADANAVTR 645          

HSP 3 Score: 98.2117 bits (243), Expect = 9.103e-21
Identity = 68/257 (26.46%), Postives = 118/257 (45.91%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHN 1190
             P+HL + +G+  +  +L+  G  ++ +T   F  PLH AA   +L  + LL+      DA    G TPLH AA      +  LLL  GA+  +      TPL  A +  ++     LL  G + N   +    ++H AA++G  D++ +LL  +A ++  N+ GLTPL  A    + +V ++L+     +  +  + G T LHV      + +V  LL+          N +  + +H A       ++ + L +N
Sbjct:  517 TPLHLAAREGHEDVAAFLLDHGASLSITTKKGF-TPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQ-TKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGY--TALHQAAQQGHTHIINVLLQNN 769          

HSP 4 Score: 90.8929 bits (224), Expect = 1.753e-18
Identity = 80/258 (31.01%), Postives = 113/258 (43.80%), Query Frame = 3
Query:  453 FSILHYLIQSGVD------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRS--KCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNF 1199
            F+ L   +Q G D      +   T    R P LH AA       + LL+      D +   G TPLH AA  G  N+ TLLL   A  D     + TPL  A++ G    VK LL  G  ++ K ++  T LH  AR G   ++ MLL   A I ++ + GL+PL  A      + VQ+L++     D    DY    TALHVA    +  + ++LL           N F  + +H A   NR  ++ L L H  + 
Sbjct:  157 FTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYL---TALHVAAHCGHYKVAKVLLDKKASPNAKALNGF--TPLHIACKKNRIRVMELLLKHGASI 409          

HSP 5 Score: 83.1889 bits (204), Expect = 4.400e-16
Identity = 73/299 (24.41%), Postives = 124/299 (41.47%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQID---------------------------------AKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAK 1214
            L P+H  +  G+  ++  L+     +   T      PLH A     L+C QLL+     +D                                 AK   G TPLH A +     ++ LLL++GA+  +   +  TP+  A   G +  V +L+  G + N  +   +TALH AAR G A+++  L++  A+++A+ +   TPL  +    +  +VQ L++           +G T LH+A R+ +  +   LL  G          F  + +H A  Y + E+  L L  + + D   K
Sbjct:  285 LTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGL-SPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS-PNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGF--TPLHVAAKYGKLEVASLLLQKSASPDAAGK 579          

HSP 6 Score: 76.6406 bits (187), Expect = 5.024e-14
Identity = 60/184 (32.61%), Postives = 85/184 (46.20%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
             P+H+ + K    I   L++ G D N  T       +H AA    +    LL++    ++  +  G TPLH AA++   N+  +L+  GA+ D+Q     TPL      G I  V  LL     VN K KN  TALH AA+QG   +I +LL+ +A  +     G T L  A      SVV  L
Sbjct:  616 TPLHIAAKKNQMDIATSLLEYGADANAVTRQGIAS-VHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 7 Score: 74.7146 bits (182), Expect = 1.896e-13
Identity = 91/371 (24.53%), Postives = 134/371 (36.12%), Query Frame = 3
Query:  363 KFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNV-----------------------------NVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRD------------------------------YRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            K D NA +    R+ H +               L Y I++GVDVN          LH A+    +     L+     +DA    GNT LH A+  G+  ++ +L+ NGAN ++Q     TPL  A +   +  V+ LL  G +                              + K K    ALH AAR+       +LL+ D   D +++ G TPL  A  Y   +V  +L+   +  D   R+                               R G T LH   R  +  +VEMLL      +    N  G S +H A   +    V+L L HN   D       +        +    GH ++AKVL
Sbjct:   21 KSDANASYLRAARAGHLE-------------KALDY-IKNGVDVNICNQNGLNA-LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKN--GLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTA-----LHVAAHCGHYKVAKVL 369          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 125.561 bits (314), Expect = 1.849e-29
Identity = 89/293 (30.38%), Postives = 142/293 (48.46%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +F G+ +I+  L+  G   N +T       LH AA S Q    + L+  G Q++AK     TPLH +A  G+ +++  LLQ GA+ ++   +  TPL  A R G       LL  G ++++  K   T LH AA+ G  ++  +LL+  A  DA  + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +KN + +   LL+ G    + N     G + VH A      ++V L L  N N +     L++ +  +P  L  +   + +A+VL
Sbjct:  428 LTPIHVAAFMGHVNIVSQLMHHGASPN-TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAA-AKNGYTPLHIAAKKNQMDIATSLLEYGA---DANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVN-----LSNKSGLTPLHLAAQEDRVNVAEVL 710          

HSP 2 Score: 102.834 bits (255), Expect = 3.221e-22
Identity = 81/308 (26.30%), Postives = 139/308 (45.13%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKR 1340
            L  +H+ +  G++ +   L+      N      F  PLH A   +++   +LL+  G  I A    G TP+H AA  G  N+++ L+ +GA+ ++ ++  +T L  A RSG+   V+ L+  G  V  K K++ T LH +AR G AD++  LL+  A  +A    G TPL  A     + V   L+     L     + G T LHVA +   + +  +LL+  K          G + +H A  Y+  ++  L L    +    AK        +P  +  ++  +++A  L      +  ++N V R
Sbjct:  362 LTALHVAAHCGHYKVAKVLLDKKASPNAKALNGF-TPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASL-SITTKKGFTPLHVAAKYGKLEVASLLLQ--KSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-----GYTPLHIAAKKNQMDIATSL----LEYGADANAVTR 656          

HSP 3 Score: 98.2117 bits (243), Expect = 9.986e-21
Identity = 68/256 (26.56%), Postives = 118/256 (46.09%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHN 1190
            P+HL + +G+  +  +L+  G  ++ +T   F  PLH AA   +L  + LL+      DA    G TPLH AA      +  LLL  GA+  +      TPL  A +  ++     LL  G + N   +    ++H AA++G  D++ +LL  +A ++  N+ GLTPL  A    + +V ++L+     +  +  + G T LHV      + +V  LL+          N +  + +H A       ++ + L +N
Sbjct:  529 PLHLAAREGHEDVAAFLLDHGASLSITTKKGF-TPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQ-TKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGY--TALHQAAQQGHTHIINVLLQNN 780          

HSP 4 Score: 90.8929 bits (224), Expect = 1.856e-18
Identity = 80/258 (31.01%), Postives = 113/258 (43.80%), Query Frame = 3
Query:  453 FSILHYLIQSGVD------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRS--KCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNF 1199
            F+ L   +Q G D      +   T    R P LH AA       + LL+      D +   G TPLH AA  G  N+ TLLL   A  D     + TPL  A++ G    VK LL  G  ++ K ++  T LH  AR G   ++ MLL   A I ++ + GL+PL  A      + VQ+L++     D    DY    TALHVA    +  + ++LL           N F  + +H A   NR  ++ L L H  + 
Sbjct:  168 FTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYL---TALHVAAHCGHYKVAKVLLDKKASPNAKALNGF--TPLHIACKKNRIRVMELLLKHGASI 420          

HSP 5 Score: 83.1889 bits (204), Expect = 4.903e-16
Identity = 73/299 (24.41%), Postives = 124/299 (41.47%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQID---------------------------------AKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAK 1214
            L P+H  +  G+  ++  L+     +   T      PLH A     L+C QLL+     +D                                 AK   G TPLH A +     ++ LLL++GA+  +   +  TP+  A   G +  V +L+  G + N  +   +TALH AAR G A+++  L++  A+++A+ +   TPL  +    +  +VQ L++           +G T LH+A R+ +  +   LL  G          F  + +H A  Y + E+  L L  + + D   K
Sbjct:  296 LTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGL-SPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS-PNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGF--TPLHVAAKYGKLEVASLLLQKSASPDAAGK 590          

HSP 6 Score: 76.6406 bits (187), Expect = 5.358e-14
Identity = 60/183 (32.79%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
            P+H+ + K    I   L++ G D N  T       +H AA    +    LL++    ++  +  G TPLH AA++   N+  +L+  GA+ D+Q     TPL      G I  V  LL     VN K KN  TALH AA+QG   +I +LL+ +A  +     G T L  A      SVV  L
Sbjct:  628 PLHIAAKKNQMDIATSLLEYGADANAVTRQGIAS-VHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 809          

HSP 7 Score: 74.7146 bits (182), Expect = 1.855e-13
Identity = 91/371 (24.53%), Postives = 134/371 (36.12%), Query Frame = 3
Query:  363 KFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNV-----------------------------NVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRD------------------------------YRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            K D NA +    R+ H +               L Y I++GVDVN          LH A+    +     L+     +DA    GNT LH A+  G+  ++ +L+ NGAN ++Q     TPL  A +   +  V+ LL  G +                              + K K    ALH AAR+       +LL+ D   D +++ G TPL  A  Y   +V  +L+   +  D   R+                               R G T LH   R  +  +VEMLL      +    N  G S +H A   +    V+L L HN   D       +        +    GH ++AKVL
Sbjct:   32 KSDANASYLRAARAGHLE-------------KALDY-IKNGVDVNICNQNGLNA-LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKN--GLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTA-----LHVAAHCGHYKVAKVL 380          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 125.561 bits (314), Expect = 1.866e-29
Identity = 89/293 (30.38%), Postives = 142/293 (48.46%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +F G+ +I+  L+  G   N +T       LH AA S Q    + L+  G Q++AK     TPLH +A  G+ +++  LLQ GA+ ++   +  TPL  A R G       LL  G ++++  K   T LH AA+ G  ++  +LL+  A  DA  + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +KN + +   LL+ G    + N     G + VH A      ++V L L  N N +     L++ +  +P  L  +   + +A+VL
Sbjct:  442 LTPIHVAAFMGHVNIVSQLMHHGASPN-TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAA-AKNGYTPLHIAAKKNQMDIATSLLEYG---ADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVN-----LSNKSGLTPLHLAAQEDRVNVAEVL 724          

HSP 2 Score: 101.679 bits (252), Expect = 7.099e-22
Identity = 81/308 (26.30%), Postives = 139/308 (45.13%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKR 1340
            L  +H+ +  G++ +   L+      N      F  PLH A   +++   +LL+  G  I A    G TP+H AA  G  N+++ L+ +GA+ ++ ++  +T L  A RSG+   V+ L+  G  V  K K++ T LH +AR G AD++  LL+  A  +A    G TPL  A     + V   L+     L     + G T LHVA +   + +  +LL+  K          G + +H A  Y+  ++  L L    +    AK        +P  +  ++  +++A  L      +  ++N V R
Sbjct:  376 LTALHVAAHCGHYKVAKVLLDKKASPNAKALNGF-TPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASL-SITTKKGFTPLHVAAKYGKLEVASLLLQ--KSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-----GYTPLHIAAKKNQMDIATSL----LEYGADANAVTR 670          

HSP 3 Score: 97.4413 bits (241), Expect = 1.836e-20
Identity = 68/257 (26.46%), Postives = 118/257 (45.91%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHN 1190
             P+HL + +G+  +  +L+  G  ++ +T   F  PLH AA   +L  + LL+      DA    G TPLH AA      +  LLL  GA+  +      TPL  A +  ++     LL  G + N   +    ++H AA++G  D++ +LL  +A ++  N+ GLTPL  A    + +V ++L+     +  +  + G T LHV      + +V  LL+          N +  + +H A       ++ + L +N
Sbjct:  542 TPLHLAAREGHEDVAAFLLDHGASLSITTKKGF-TPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQ-TKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGY--TALHQAAQQGHTHIINVLLQNN 794          

HSP 4 Score: 83.9593 bits (206), Expect = 2.612e-16
Identity = 80/266 (30.08%), Postives = 113/266 (42.48%), Query Frame = 3
Query:  453 FSILHYLIQSGVD------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTF--------GNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRS--KCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNF 1199
            F+ L   +Q G D      +   T    R P LH AA       + LL+      D +           G TPLH AA  G  N+ TLLL   A  D     + TPL  A++ G    VK LL  G  ++ K ++  T LH  AR G   ++ MLL   A I ++ + GL+PL  A      + VQ+L++     D    DY    TALHVA    +  + ++LL           N F  + +H A   NR  ++ L L H  + 
Sbjct:  174 FTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYL---TALHVAAHCGHYKVAKVLLDKKASPNAKALNGF--TPLHIACKKNRIRVMELLLKHGASI 434          

HSP 5 Score: 82.8037 bits (203), Expect = 7.506e-16
Identity = 73/299 (24.41%), Postives = 124/299 (41.47%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQID---------------------------------AKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAK 1214
            L P+H  +  G+  ++  L+     +   T      PLH A     L+C QLL+     +D                                 AK   G TPLH A +     ++ LLL++GA+  +   +  TP+  A   G +  V +L+  G + N  +   +TALH AAR G A+++  L++  A+++A+ +   TPL  +    +  +VQ L++           +G T LH+A R+ +  +   LL  G          F  + +H A  Y + E+  L L  + + D   K
Sbjct:  310 LTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGL-SPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS-PNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGF--TPLHVAAKYGKLEVASLLLQKSASPDAAGK 604          

HSP 6 Score: 75.485 bits (184), Expect = 1.412e-13
Identity = 60/184 (32.61%), Postives = 85/184 (46.20%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
             P+H+ + K    I   L++ G D N  T       +H AA    +    LL++    ++  +  G TPLH AA++   N+  +L+  GA+ D+Q     TPL      G I  V  LL     VN K KN  TALH AA+QG   +I +LL+ +A  +     G T L  A      SVV  L
Sbjct:  641 TPLHIAAKKNQMDIATSLLEYGADANAVTRQGIAS-VHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 823          

HSP 7 Score: 68.9366 bits (167), Expect = 1.529e-11
Identity = 60/228 (26.32%), Postives = 101/228 (44.30%), Query Frame = 3
Query:  627 LHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK------AGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            LH A+++G   +++ LLQ  AN D+      T L  A+ +G+   VK L+  G NVN + +N  T L+ AA++   +++  LL   A      + G TPL  A+      VV +L+ +     K   R    ALH+A RK+      +LL+           +       G + +H A  Y    +  L L      D+ A+      + +P  +  +RG+  + K+L
Sbjct:   78 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDT---KGKVRL--PALHIAARKDDTKAAALLLQNDTNADVESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARN-----DITPLHVASKRGNANMVKLL 295          

HSP 8 Score: 67.3958 bits (163), Expect = 4.318e-11
Identity = 77/312 (24.68%), Postives = 116/312 (37.18%), Query Frame = 3
Query:  474 IQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKN----------------------EDT-------ALHYAARQGSADLIIMLLKYDARIDAQNQW--------GLTPLMEAVSYSQQSVVQILIR--SKCDLYKRD------------------------------YRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFD 1202
            I++GVDVN          LH A+    +     L+     +DA    GNT LH A+  G+  ++ +L+ NGAN ++Q     TPL  A +   +  V+ LL  G + ++  ++                       DT       ALH AAR+       +LL+ D   D +++         G TPL  A  Y   +V  +L+   +  D   R+                               R G T LH   R  +  +VEMLL      +    N  G S +H A   +    V+L L HN   D
Sbjct:   61 IKNGVDVNICNQNGLNA-LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKN--GLSPLHMATQGDHLNCVQLLLQHNVPVD 369          
BLAST of Ankyrin repeat-containing, putative vs. UniProt/SwissProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 125.946 bits (315), Expect = 8.347e-29
Identity = 91/292 (31.16%), Postives = 140/292 (47.95%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ SF G+  I+  L+Q G   N S   +   PLH AA +     ++ L+    +++AK     TPLH AA  G  N++ LLL+N AN +       TPL  A R G +  V  LL    +     K   T LH AA+ G   +  +LL+ DA  +A  + GLTPL  AV ++   +V++L+      +   +  G T LH+A ++N V +   LL+ G      +    G + +H A      E+V L L    N +     L + +  +P  LV + GH+ +A VL
Sbjct:  405 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKV-ETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAW-NGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQ--GVTPLHLAAQEGHAEMVALLLSKQANGN-----LGNKSGLTPLHLVAQEGHVPVADVL 687          

HSP 2 Score: 108.227 bits (269), Expect = 4.255e-23
Identity = 80/256 (31.25%), Postives = 122/256 (47.66%), Query Frame = 3
Query:  525 PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            PLH AA    L+ +QLL+N G  ++     G TPLH A+  G   ++ LLL  GA  +++     TPL  A R+G +   + LL  G  +  K KN  + +H AA+    D + +LL+YDA ID      LTPL  A       V ++L+        R    G T LH+A +KN+V ++E+LLK G           G + +H A +     +V+  L    + +    K+     ++P  +    GH E+AK L
Sbjct:  209 PLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRAL-NGFTPLHIACKKNHVRVMELLLKTGASI--DAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKV-----ETPLHMAARAGHTEVAKYL 456          

HSP 3 Score: 107.842 bits (268), Expect = 6.060e-23
Identity = 86/295 (29.15%), Postives = 137/295 (46.44%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR---SKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +  G+  +   L+  G   N      F  PLH A   + +   +LL+  G  IDA    G TPLH A+  G   ++  LLQ GA+ +  ++  +TPL  A R+G     K LL     VN K K++ T LH AAR G  +++ +LL+ +A  +     G TPL  A        V  L+    S+  + K+ +    T LHVA +   V + E+LL+          N  G + +H AV +N  ++V+L L    +   PA         +P  +  ++  +E+A+ L
Sbjct:  339 LTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGF-TPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGF----TPLHVAAKYGKVRVAELLLERDAHPNAAGKN--GLTPLHVAVHHNNLDIVKLLLPRGGSPHSPA-----WNGYTPLHIAAKQNQVEVARSL 621          

HSP 4 Score: 92.4337 bits (228), Expect = 4.139e-18
Identity = 95/365 (26.03%), Postives = 151/365 (41.37%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNF-NNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWS----------KNSNTVKRI------EFQELEEVKSLRQWCRKVIRRQLGFHIYEKLQKINLPPAL 1463
             P+H+ + +G+   +  L++        T   F  PLH AA   ++  ++LL+      +A    G TPLH A      +++ LLL  G +  S      TPL  A +  ++   + LL  G + N +     T LH AA++G A+++ +LL   A  +  N+ GLTPL          V  +LI+    +     R G T LHVA     + LV+ LL   +   + N     G S +H A      ++V L L    N   P +  + GT  +P  +    G++ +  VL  V    S              TV  I      E +EL   K+ R+  R V   +       KL ++   PA+
Sbjct:  505 TPLHIAAREGHVETVLALLEKEASQACMTKKGF-TPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGV-MVDATTRMGYTPLHVASHYGNIKLVKFLL---QHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLL---KNGASPNEVSSDGT--TPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESPAI 859          

HSP 5 Score: 91.6633 bits (226), Expect = 8.313e-18
Identity = 83/334 (24.85%), Postives = 142/334 (42.51%), Query Frame = 3
Query:  390 EVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGEN---------------------------------NLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            ++      +L P+H  +  G+  I   L+  G  + Q+ T     P+H AA    L C +LL+    +ID       TPLH AA  G +                                  ++ LLL+ GA+ D+   +  TPL  A+  G +  VK LL  G + NV +   +T LH AAR G  ++   LL+  A+++A+ +   TPL  A      ++V++L+ +  +        G T LH+A R+ +V  V  LL+  K   +      G + +H A  Y +  +  L L  + + +   K        +P  + +   +L++ K+L
Sbjct:  264 QIETKTKDELTPLHCAARNGHVRISEILLDHGAPI-QAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNAN-PNLATTAGHTPLHIAAREGHVETVLALLE--KEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKN-----GLTPLHVAVHHNNLDIVKLL 588          

HSP 6 Score: 89.7373 bits (221), Expect = 2.838e-17
Identity = 59/219 (26.94%), Postives = 106/219 (48.40%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEML 1073
            L P+H+        I+  L+  G   +      +  PLH AA  +Q+  ++ L+  GG  +A+   G TPLH AA++G   ++ LLL   AN +  + +  TPL    + G +     L+  G  V+   +   T LH A+  G+  L+  LL++ A ++A+ + G +PL +A       +V +L+++     +     G T L +A R  Y+ + ++L
Sbjct:  570 LTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGY-TPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVS-SDGTTPLAIAKRLGYISVTDVL 786          

HSP 7 Score: 66.6254 bits (161), Expect = 5.091e-10
Identity = 67/255 (26.27%), Postives = 99/255 (38.82%), Query Frame = 3
Query:  615 GNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNV-----------------------------KDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            GNT LH AA  G++ ++  L+  GAN ++Q     TPL  A +   +  VK LL  G N NV                             K K    ALH AAR        +LL+ D   D  ++ G TPL  A  Y   +V Q+L+     +     + G T LH+A R+  V +V +LL  G        +    + +H A       +  + L H        K        SP  +  +  HL+  ++L
Sbjct:   78 GNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASV-NFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDEL--TPLHCAARNGHVRISEILLDHGAPIQAKTKN-----GLSPIHMAAQGDHLDCVRLL 324          
BLAST of Ankyrin repeat-containing, putative vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.556e-28
Identity = 89/293 (30.38%), Postives = 142/293 (48.46%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +F G+ +I+  L+  G   N +T       LH AA S Q    + L+  G Q++AK     TPLH +A  G+ +++  LLQ GA+ ++   +  TPL  A R G       LL  G ++++  K   T LH AA+ G  ++  +LL+  A  DA  + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +KN + +   LL+ G    + N     G + VH A      ++V L L  N N +     L++ +  +P  L  +   + +A+VL
Sbjct:  417 LTPIHVAAFMGHVNIVSQLMHHGASPN-TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAA-AKNGYTPLHIAAKKNQMDIATSLLEYGA---DANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVN-----LSNKSGLTPLHLAAQEDRVNVAEVL 699          

HSP 2 Score: 102.449 bits (254), Expect = 3.266e-21
Identity = 81/308 (26.30%), Postives = 139/308 (45.13%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKR 1340
            L  +H+ +  G++ +   L+      N      F  PLH A   +++   +LL+  G  I A    G TP+H AA  G  N+++ L+ +GA+ ++ ++  +T L  A RSG+   V+ L+  G  V  K K++ T LH +AR G AD++  LL+  A  +A    G TPL  A     + V   L+     L     + G T LHVA +   + +  +LL+  K          G + +H A  Y+  ++  L L    +    AK        +P  +  ++  +++A  L      +  ++N V R
Sbjct:  351 LTALHVAAHCGHYKVAKVLLDKKASPNAKALNGF-TPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASL-SITTKKGFTPLHVAAKYGKLEVASLLLQ--KSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK-----NGYTPLHIAAKKNQMDIATSL----LEYGADANAVTR 645          

HSP 3 Score: 97.8265 bits (242), Expect = 8.476e-20
Identity = 68/256 (26.56%), Postives = 118/256 (46.09%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHN 1190
            P+HL + +G+  +  +L+  G  ++ +T   F  PLH AA   +L  + LL+      DA    G TPLH AA      +  LLL  GA+  +      TPL  A +  ++     LL  G + N   +    ++H AA++G  D++ +LL  +A ++  N+ GLTPL  A    + +V ++L+     +  +  + G T LHV      + +V  LL+          N +  + +H A       ++ + L +N
Sbjct:  518 PLHLAAREGHEDVAAFLLDHGASLSITTKKGF-TPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQ-TKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGY--TALHQAAQQGHTHIINVLLQNN 769          

HSP 4 Score: 90.8929 bits (224), Expect = 1.331e-17
Identity = 80/258 (31.01%), Postives = 113/258 (43.80%), Query Frame = 3
Query:  453 FSILHYLIQSGVD------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRS--KCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNF 1199
            F+ L   +Q G D      +   T    R P LH AA       + LL+      D +   G TPLH AA  G  N+ TLLL   A  D     + TPL  A++ G    VK LL  G  ++ K ++  T LH  AR G   ++ MLL   A I ++ + GL+PL  A      + VQ+L++     D    DY    TALHVA    +  + ++LL           N F  + +H A   NR  ++ L L H  + 
Sbjct:  157 FTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYL---TALHVAAHCGHYKVAKVLLDKKASPNAKALNGF--TPLHIACKKNRIRVMELLLKHGASI 409          

HSP 5 Score: 82.8037 bits (203), Expect = 4.065e-15
Identity = 73/299 (24.41%), Postives = 124/299 (41.47%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQID---------------------------------AKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAK 1214
            L P+H  +  G+  ++  L+     +   T      PLH A     L+C QLL+     +D                                 AK   G TPLH A +     ++ LLL++GA+  +   +  TP+  A   G +  V +L+  G + N  +   +TALH AAR G A+++  L++  A+++A+ +   TPL  +    +  +VQ L++           +G T LH+A R+ +  +   LL  G          F  + +H A  Y + E+  L L  + + D   K
Sbjct:  285 LTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGL-SPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS-PNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGF--TPLHVAAKYGKLEVASLLLQKSASPDAAGK 579          

HSP 6 Score: 76.2554 bits (186), Expect = 5.450e-13
Identity = 60/183 (32.79%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
            P+H+ + K    I   L++ G D N  T       +H AA    +    LL++    ++  +  G TPLH AA++   N+  +L+  GA+ D+Q     TPL      G I  V  LL     VN K KN  TALH AA+QG   +I +LL+ +A  +     G T L  A      SVV  L
Sbjct:  617 PLHIAAKKNQMDIATSLLEYGADANAVTRQGIAS-VHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 7 Score: 74.7146 bits (182), Expect = 1.714e-12
Identity = 91/371 (24.53%), Postives = 134/371 (36.12%), Query Frame = 3
Query:  363 KFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNV-----------------------------NVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRD------------------------------YRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            K D NA +    R+ H +               L Y I++GVDVN          LH A+    +     L+     +DA    GNT LH A+  G+  ++ +L+ NGAN ++Q     TPL  A +   +  V+ LL  G +                              + K K    ALH AAR+       +LL+ D   D +++ G TPL  A  Y   +V  +L+   +  D   R+                               R G T LH   R  +  +VEMLL      +    N  G S +H A   +    V+L L HN   D       +        +    GH ++AKVL
Sbjct:   21 KSDANASYLRAARAGHLE-------------KALDY-IKNGVDVNICNQNGLNA-LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKN--GLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTA-----LHVAAHCGHYKVAKVL 369          
BLAST of Ankyrin repeat-containing, putative vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 124.405 bits (311), Expect = 3.260e-28
Identity = 88/293 (30.03%), Postives = 142/293 (48.46%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +F G+ +I+  L+  G   N +T       LH AA S Q    + L+  G Q++AK     TPLH +A  G+ +++  LLQ GA+ ++   +  TPL  + R G       LL  G ++++  K   T LH AA+ G  ++  +LL+  A  DA  + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +KN + +   LL+ G    + N     G + VH A      ++V L L  N N +     L++ +  +P  L  +   + +A+VL
Sbjct:  442 LTPIHVAAFMGHVNIVSQLMHHGASPN-TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAA-AKNGYTPLHIAAKKNQMDIATSLLEYG---ADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVN-----LSNKSGLTPLHLAAQEDRVNVAEVL 724          

HSP 2 Score: 100.908 bits (250), Expect = 8.788e-21
Identity = 80/308 (25.97%), Postives = 140/308 (45.45%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKR 1340
            L  +H+ +  G++ +   L+    + N      F  PLH A   +++   +LL+  G  I A    G TP+H AA  G  N+++ L+ +GA+ ++ ++  +T L  A RSG+   V+ L+  G  V  K K++ T LH +AR G AD++  LL+  A  +A    G TPL  +     + V   L+     L     + G T LHVA +   + +  +LL+  K          G + +H A  Y+  ++  L L    +    AK        +P  +  ++  +++A  L      +  ++N V R
Sbjct:  376 LTALHVAAHCGHYKVAKVLLDKKANPNAKALNGF-TPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASL-SITTKKGFTPLHVAAKYGKLEVASLLLQ--KSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-----GYTPLHIAAKKNQMDIATSL----LEYGADANAVTR 670          

HSP 3 Score: 96.2857 bits (238), Expect = 2.563e-19
Identity = 68/257 (26.46%), Postives = 118/257 (45.91%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHN 1190
             P+HL + +G+  +  +L+  G  ++ +T   F  PLH AA   +L  + LL+      DA    G TPLH AA      +  LLL  GA+  +      TPL  A +  ++     LL  G + N   +    ++H AA++G  D++ +LL  +A ++  N+ GLTPL  A    + +V ++L+     +  +  + G T LHV      + +V  LL+          N +  + +H A       ++ + L +N
Sbjct:  542 TPLHLSAREGHEDVAAFLLDHGASLSITTKKGF-TPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQ-TKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGY--TPLHQAAQQGHTHIINVLLQNN 794          

HSP 4 Score: 88.5817 bits (218), Expect = 7.515e-17
Identity = 70/238 (29.41%), Postives = 113/238 (47.48%), Query Frame = 3
Query:  474 IQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMH 1187
            I+S + VN++T + F  PLH AA    ++ + LL+N    +D       TPLH A++ G  N++ LLL  GA  D++     TPL    RSG    V+ LL     +  K KN  + LH A +    + + +LL+++  +D      LT L  A       V ++L+  K +   +    G T LH+A +KN + ++E+LLK G           G + +H A +     +V   + H
Sbjct:  230 IESKMVVNRATESGF-TPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALN-GFTPLHIACKKNRIRVMELLLKHGASI--QAVTESGLTPIHVAAFMGHVNIVSQLMHH 463          

HSP 5 Score: 83.5741 bits (205), Expect = 2.473e-15
Identity = 56/219 (25.57%), Postives = 109/219 (49.77%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEML 1073
            L P+H+ +      +   L+  G   + +    +  PLH AA  +Q+  +  L+  G   +A    G   +H AA++G  ++++LLL   AN +  + +  TPL  A +  R+   + L+  G +V+ + K   T LH     G+  ++  LL++ A+++A+ + G TPL +A       ++ +L+++     +     G+TAL +A R  Y+ +V+ L
Sbjct:  607 LTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGY-TPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVN-GNTALAIARRLGYISVVDTL 823          

HSP 6 Score: 81.6481 bits (200), Expect = 1.067e-14
Identity = 72/299 (24.08%), Postives = 124/299 (41.47%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQID---------------------------------AKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAK 1214
            L P+H  +  G+  ++  L+     +   T      PLH A     L+C QLL+     +D                                 AK   G TPLH A +     ++ LLL++GA+  +   +  TP+  A   G +  V +L+  G + N  +   +TALH AAR G A+++  L++  A+++A+ +   TPL  +    +  +VQ L++           +G T LH++ R+ +  +   LL  G          F  + +H A  Y + E+  L L  + + D   K
Sbjct:  310 LTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGL-SPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS-PNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGF--TPLHVAAKYGKLEVASLLLQKSASPDAAGK 604          

HSP 7 Score: 68.5514 bits (166), Expect = 1.270e-10
Identity = 62/228 (27.19%), Postives = 102/228 (44.74%), Query Frame = 3
Query:  627 LHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK-AGKWYIEYNF-----NNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            LH A+++G   +++ LLQ  AN D+      T L  A+ +G+   VK L+  G NVN + +N  T L+ AA++   +++  LL   A      + G TPL  A+      VV +L+ +     K   R    ALH+A RK+      +LL+      IE           G + +H A  Y    +  L L      D+ A+      + +P  +  +RG+  + K+L
Sbjct:   78 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDT---KGKVRL--PALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARN-----DITPLHVASKRGNANMVKLL 295          

HSP 8 Score: 67.0106 bits (162), Expect = 3.555e-10
Identity = 77/312 (24.68%), Postives = 116/312 (37.18%), Query Frame = 3
Query:  474 IQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKN----------------------EDT-------ALHYAARQGSADLIIMLLKYDARIDAQNQW--------GLTPLMEAVSYSQQSVVQILIR--SKCDLYKRD------------------------------YRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFD 1202
            I++GVDVN          LH A+    +     L+     +DA    GNT LH A+  G+  ++ +L+ NGAN ++Q     TPL  A +   +  V+ LL  G + ++  ++                       DT       ALH AAR+       +LL+ D   D +++         G TPL  A  Y   +V  +L+   +  D   R+                               R G T LH   R  +  +VEMLL      +    N  G S +H A   +    V+L L HN   D
Sbjct:   61 IKNGVDVNICNQNGLNA-LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKN--GLSPLHMATQGDHLNCVQLLLQHNVPVD 369          
BLAST of Ankyrin repeat-containing, putative vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 123.635 bits (309), Expect = 6.117e-28
Identity = 88/293 (30.03%), Postives = 142/293 (48.46%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +F G+ +I+  L+  G   N +T       LH AA S Q    + L+  G Q++AK     TPLH +A  G+ +++  LLQ GA+ ++   +  TPL  + R G       LL  G ++++  K   T LH AA+ G  ++  +LL+  A  DA  + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +KN + +   LL+ G    + N     G + VH A      ++V L L  N N +     L++ +  +P  L  +   + +A+VL
Sbjct:  434 LTPIHVAAFMGHVNIVSQLMHHGASPN-TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAA-AKNGYTPLHIAAKKNQMDIATTLLEYG---ADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVN-----LSNKSGLTPLHLAAQEDRVNVAEVL 716          

HSP 2 Score: 100.523 bits (249), Expect = 1.367e-20
Identity = 80/308 (25.97%), Postives = 140/308 (45.45%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKR 1340
            L  +H+ +  G++ +   L+    + N      F  PLH A   +++   +LL+  G  I A    G TP+H AA  G  N+++ L+ +GA+ ++ ++  +T L  A RSG+   V+ L+  G  V  K K++ T LH +AR G AD++  LL+  A  +A    G TPL  +     + V   L+     L     + G T LHVA +   + +  +LL+  K          G + +H A  Y+  ++  L L    +    AK        +P  +  ++  +++A  L      +  ++N V R
Sbjct:  368 LTALHVAAHCGHYKVAKVLLDKKANPNAKALNGF-TPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSIT-TKKGFTPLHVAAKYGKLEVANLLLQ--KSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK-----NGYTPLHIAAKKNQMDIATTL----LEYGADANAVTR 662          

HSP 3 Score: 95.1301 bits (235), Expect = 6.590e-19
Identity = 68/257 (26.46%), Postives = 118/257 (45.91%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHN 1190
             P+HL + +G+  +  +L+  G  ++ +T   F  PLH AA   +L  + LL+      DA    G TPLH AA      +  LLL  GA+  +      TPL  A +  ++     LL  G + N   +    ++H AA++G  D++ +LL  +A ++  N+ GLTPL  A    + +V ++L+     +  +  + G T LHV      + +V  LL+          N +  + +H A       ++ + L +N
Sbjct:  534 TPLHLSAREGHEDVAAFLLDHGASLSITTKKGF-TPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQ-TKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGY--TPLHQAAQQGHTHIINVLLQNN 786          

HSP 4 Score: 89.3521 bits (220), Expect = 4.011e-17
Identity = 80/258 (31.01%), Postives = 114/258 (44.19%), Query Frame = 3
Query:  453 FSILHYLIQSGVD------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRS--KCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNF 1199
            F+ L   +Q G D      +   T    R P LH AA       + LL+      D +   G TPLH AA  G  N+ TLLL   A  D     + TPL  A++ G    VK LL  G  ++ K ++  T LH  AR G   ++ MLL   A I ++ + GL+PL  A      + VQ+L++     D    DY    TALHVA    +  + ++LL           N F  + +H A   NR +++ L L H  + 
Sbjct:  174 FTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYL---TALHVAAHCGHYKVAKVLLDKKANPNAKALNGF--TPLHIACKKNRIKVMELLLKHGASI 426          

HSP 5 Score: 82.8037 bits (203), Expect = 5.041e-15
Identity = 56/219 (25.57%), Postives = 109/219 (49.77%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEML 1073
            L P+H+ +      +   L+  G   + +    +  PLH AA  +Q+  +  L+  G   +A    G   +H AA++G  ++++LLL   AN +  + +  TPL  A +  R+   + L+  G +V+ + K   T LH     G+  ++  LL++ A+++A+ + G TPL +A       ++ +L+++     +     G+TAL +A R  Y+ +V+ L
Sbjct:  599 LTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGY-TPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTV-NGNTALGIARRLGYISVVDTL 815          

HSP 6 Score: 81.2629 bits (199), Expect = 1.748e-14
Identity = 72/299 (24.08%), Postives = 124/299 (41.47%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQID---------------------------------AKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAK 1214
            L P+H  +  G+  ++  L+     +   T      PLH A     L+C QLL+     +D                                 AK   G TPLH A +     ++ LLL++GA+  +   +  TP+  A   G +  V +L+  G + N  +   +TALH AAR G A+++  L++  A+++A+ +   TPL  +    +  +VQ L++           +G T LH++ R+ +  +   LL  G          F  + +H A  Y + E+  L L  + + D   K
Sbjct:  302 LTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGL-SPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAA-TTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGF--TPLHVAAKYGKLEVANLLLQKSASPDAAGK 596          

HSP 7 Score: 73.1738 bits (178), Expect = 4.592e-12
Identity = 77/304 (25.33%), Postives = 116/304 (38.16%), Query Frame = 3
Query:  474 IQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKN----------------------EDT-------ALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRD------------------------------YRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFD 1202
            I++GVD+N          LH A+    +     L+     +DA    GNT LH A+  G+  ++ +L+ NGAN ++Q     TPL  A +   +  VK LL  G + ++  ++                       DT       ALH AAR+       +LL+ D   D +++ G TPL  A  Y   +V  +L+   +  D   R+                               R G T LH   R  +  +VEMLL      +    N  G S +H A   +    V+L L HN   D
Sbjct:   61 IKNGVDINICNQNGLNA-LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKN--GLSPLHMATQGDHLNCVQLLLQHNVPVD 361          

HSP 8 Score: 70.0922 bits (170), Expect = 4.279e-11
Identity = 63/228 (27.63%), Postives = 103/228 (45.18%), Query Frame = 3
Query:  627 LHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNF------GESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            LH A+++G   +++ LLQ  AN D+      T L  A+ +G+   VK L+  G NVN + +N  T L+ AA++   +++  LL   A      + G TPL  A+      VV +L+ +     K   R    ALH+A RK+      +LL+        N NN       G + +H A  Y    +  L L      D+ A+      + +P  +  +RG+  + K+L
Sbjct:   78 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDT---KGKVRL--PALHIAARKDDTKAAALLLQ--------NDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTAR-----NDITPLHVASKRGNANMVKLL 287          
BLAST of Ankyrin repeat-containing, putative vs. UniProt/SwissProt
Match: sp|Q4UMH6|Y381_RICFE (Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0381 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.798e-27
Identity = 81/254 (31.89%), Postives = 137/254 (53.94%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNF-NNFGESFVHDAVWYNRCELVRLFLM 1184
            +H  +  G  +++++LI++  D++  T +     LH AA S  L+    LI     I AK   G T LH+AAE G  NL++LL+ NG + +++     T L  A  SG +  V  L+  G +VN K  + +T LH+A   GS DL+ +L+   A ++A+   GLT L  AV     ++V +L+    D+  ++  +G+T LH AV  N + LV +L+  G    + N  NN GE+ ++  + +N C +++ F++
Sbjct:  902 LHFAAKSGNLNLVNWLIKNKADIHAKTNS-GETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKN-NSGETPLHYAVIFNSLDLVSLLIHNGA---DINTKNNSGETVLNSIMEFNNCNILKSFIL 1150          

HSP 2 Score: 108.997 bits (271), Expect = 2.126e-23
Identity = 83/256 (32.42%), Postives = 134/256 (52.34%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNF-NNFGESFVHDAVWYNRCELVRLFLMHN 1190
            +H  +  G  +++++LI++  D++  T +     LH AA S  L+    LI     I AK   G T LH+AA+ G  NL+  L++N A+  ++  + +T L  A  SG +  V  L+  G ++N K  +  TALHYA   G+ +L+ +L+     ++A+   G T L  AV      +V +L+    D+  +    G TALH AV  + + LV +L+  G    + N  NN GE+ +H AV +N  +LV L L+HN
Sbjct:  869 LHFAAESGNLNLVNWLIKNKADIHAKTNS-GETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKT-DDGLTALHYAVESDNLALVSLLMVYGA---DVNAKNNSGETPLHYAVIFNSLDLVSL-LIHN 1118          

HSP 3 Score: 105.916 bits (263), Expect = 1.860e-22
Identity = 82/254 (32.28%), Postives = 129/254 (50.79%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNF-NNFGESFVHDAVWYNRCELVRLFLM 1184
            +H     G   ++  LI +G +VN + T L     H AA S  L+    LI     I AK   G T LH+AAE G  NL+  L++N A+  ++  + +T L  A +SG +  V  L+    +++ K  + +T LH+AA+ G+ +L+  L+K  A I A+   G T L  A      ++V +LI +  D+  +    G TALH AV    ++LV +L+  G   I+ N   N GE+ +H AV     +LV L ++
Sbjct:  807 LHYAVESGNLDLVSLLIHNGANVNNAKTIL-----HFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKT-DDGLTALHYAVESGNLNLVSLLIHKG---IDVNAKTNSGETILHFAVDLGSLDLVSLLMV 1051          

HSP 4 Score: 105.531 bits (262), Expect = 2.425e-22
Identity = 68/220 (30.91%), Postives = 120/220 (54.55%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            +H  +  G  +++++LI++  D++  T +     LH AA S  L+   LLI+ G  I+ K   G T LHYA E G  NL++LL+  G + +++  + +T L  A   G +  V  L+  G +VN K  +  TALHYA    +  L+ +L+ Y A ++A+N  G TPL  AV ++   +V +LI +  D+  ++  +G+T L+  +  N  ++++  +  G
Sbjct:  935 LHFAAKSGNLNLVNWLIKNKADIHAKTNS-GETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFNSLDLVSLLIHNGADINTKN-NSGETVLNSIMEFNNCNILKSFILGG 1152          

HSP 5 Score: 98.2117 bits (243), Expect = 5.468e-20
Identity = 81/257 (31.52%), Postives = 123/257 (47.86%), Query Frame = 3
Query:  528 LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            LH AA +  L  ++LL   G  ++AK   G T LHYA + G  +L+  L++N AN  ++    +T L  A        V  L+  G +VN K  N  TALHYA   G+ DL+ +L+ + A ++A+   G T L  AV Y    +V +LI    D+  +    G+T LH AV    + LV +L+  G      N NN  ++ +H A       LV  +L+ N   D  AK   + + ++      E G+L L   L +
Sbjct:  642 LHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKT-DNGETVLHYAVESGNLDLVSLLIHNGA-----NVNN-AKTILHFAAKSGNLNLVN-WLIKN-KADIHAK---TNSGETILHFAAESGNLNLVNWLIK 886          

HSP 6 Score: 89.7373 bits (221), Expect = 2.980e-17
Identity = 57/189 (30.16%), Postives = 98/189 (51.85%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDL 992
            +H  +  G  +++  LI +G D+N  T       LH+A  S  L+   LLI+ G  ++AK   G T LH+A + G  +L++LL+  GA+ +++     T L  A  S  +  V  L+  G +VN K+ + +T LHYA    S DL+ +L+   A I+ +N  G T L   + ++  ++++  I    D+
Sbjct:  968 LHFAAESGNLNLVSLLIHNGTDINTKTDDGLT-ALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFNSLDLVSLLIHNGADINTKNNSGETVLNSIMEFNNCNILKSFILGGADI 1155          

HSP 7 Score: 55.8398 bits (133), Expect = 9.889e-7
Identity = 36/126 (28.57%), Postives = 63/126 (50.00%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVK 803
            +H     G   ++  L+  G DVN  T       LH+A  S  L+   LL+  G  ++AK+  G TPLHYA      +L++LL+ NGA+ ++++ + +T L           +K  +  G ++N++
Sbjct: 1034 LHFAVDLGSLDLVSLLMVRGADVNAKTDDGLT-ALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFNSLDLVSLLIHNGADINTKNNSGETVLNSIMEFNNCNILKSFILGGADINLE 1158          
BLAST of Ankyrin repeat-containing, putative vs. TrEMBL
Match: A0A267FMI3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034199g2 PE=4 SV=1)

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 261/407 (64.13%), Postives = 328/407 (80.59%), Query Frame = 3
Query:  294 ALLFYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKN--SNTVKRIEFQELEEVKSLRQWCRKVIRRQLGFHIYEKLQKINLPPALIEYIQLEDIKWGPKM 1508
            A+ FYDAII ND+D LR+ VE++K DLNAKF  VR+ +H DL PVHLV++KGY S+LHYLIQ+GV VNQ+T TL R  +H+AA+  QLSC Q+L+NAGG+IDA+DTFGNTPLHYAAEDG   L++LLL NGA+ D+QDITNKTPLMKATR+G++ AVKRL   G +VN+KDKNEDTALH+AAR GS ++  ML++ +AR+DAQNQWGLTPLMEAVSY+Q+ VV  LI+ +CDLYKRD+RTGDT+LH+AV+KNY  LV MLL AG WYI+YNFNNFGESFVHD V YNR +L+RLF+ +NYNFDYPAKK  +G EK PFQLVLERGHLE+AK+L++V CY S     ++V+R    ELE VKSLR W RK IR QLGF    K+ K+ +P  + +++ L+D+KW  ++
Sbjct:   38 AIHFYDAIIQNDMDALRRAVEVFKVDLNAKFTLVRKQHHFDLFPVHLVAYKGYLSMLHYLIQTGVAVNQTTATLHRHAVHYAALRSQLSCLQMLVNAGGKIDARDTFGNTPLHYAAEDGNVILMSLLLHNGASLDAQDITNKTPLMKATRNGKLAAVKRLTAAGASVNLKDKNEDTALHFAARHGSGEMTCMLIRAEARVDAQNQWGLTPLMEAVSYNQKEVVAALIKHRCDLYKRDFRTGDTSLHIAVKKNYTDLVSMLLSAGNWYIQYNFNNFGESFVHDVVVYNRMDLLRLFVTYNYNFDYPAKKTPTGVEKLPFQLVLERGHLEMAKILAQVGCYSSSRFCQSSVRRCP--ELESVKSLRSWARKTIRDQLGFSPGGKINKLPVPTMVKDFLLLKDVKWDTRL 442          
BLAST of Ankyrin repeat-containing, putative vs. TrEMBL
Match: A0A267FMN2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034199g1 PE=4 SV=1)

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 261/407 (64.13%), Postives = 328/407 (80.59%), Query Frame = 3
Query:  294 ALLFYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKN--SNTVKRIEFQELEEVKSLRQWCRKVIRRQLGFHIYEKLQKINLPPALIEYIQLEDIKWGPKM 1508
            A+ FYDAII ND+D LR+ VE++K DLNAKF  VR+ +H DL PVHLV++KGY S+LHYLIQ+GV VNQ+T TL R  +H+AA+  QLSC Q+L+NAGG+IDA+DTFGNTPLHYAAEDG   L++LLL NGA+ D+QDITNKTPLMKATR+G++ AVKRL   G +VN+KDKNEDTALH+AAR GS ++  ML++ +AR+DAQNQWGLTPLMEAVSY+Q+ VV  LI+ +CDLYKRD+RTGDT+LH+AV+KNY  LV MLL AG WYI+YNFNNFGESFVHD V YNR +L+RLF+ +NYNFDYPAKK  +G EK PFQLVLERGHLE+AK+L++V CY S     ++V+R    ELE VKSLR W RK IR QLGF    K+ K+ +P  + +++ L+D+KW  ++
Sbjct:   38 AIHFYDAIIQNDMDALRRAVEVFKVDLNAKFTLVRKQHHFDLFPVHLVAYKGYLSMLHYLIQTGVAVNQTTATLHRHAVHYAALRSQLSCLQMLVNAGGKIDARDTFGNTPLHYAAEDGNVILMSLLLHNGASLDAQDITNKTPLMKATRNGKLAAVKRLTAAGASVNLKDKNEDTALHFAARHGSGEMTCMLIRAEARVDAQNQWGLTPLMEAVSYNQKEVVAALIKHRCDLYKRDFRTGDTSLHIAVKKNYTDLVSMLLSAGNWYIQYNFNNFGESFVHDVVVYNRMDLLRLFVTYNYNFDYPAKKTPTGVEKLPFQLVLERGHLEMAKILAQVGCYSSSRFCQSSVRRCP--ELESVKSLRSWARKTIRDQLGFSPGGKINKLPVPTMVKDFLLLKDVKWDTRL 442          
BLAST of Ankyrin repeat-containing, putative vs. TrEMBL
Match: A0A1I8I5G8 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 506.523 bits (1303), Expect = 1.554e-174
Identity = 231/335 (68.96%), Postives = 284/335 (84.78%), Query Frame = 3
Query:  294 ALLFYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            A+ FYDAII ND+D LR+ VE++K DLNAKF  VR+ +H DL PVHLV++KGY S+LHYLIQ+GV VNQ+T TL R  +H+AA+  QLSC Q+L+NAGG+IDA+DTFGNTPLHYAAEDG   L++LLL NGA+ D+QDITNKTPLMKATR+G++ AVKRL   G +VN+KDKNEDTALH+AAR GS ++  ML++ +AR+DAQNQWGLTPLMEAVSY+Q+ VV  LI+ +CDLYKRD+RTGDT+LH+AV+KNY  LV MLL AG WYI+YNFNNFGESFVHD V YNR +L+RLF+ +NYNFDYPAKK  +G EK PFQLVLERGHLE+AK+L++
Sbjct:   18 AIHFYDAIIQNDMDALRRAVEVFKVDLNAKFTLVRKQHHFDLFPVHLVAYKGYLSMLHYLIQTGVAVNQTTATLHRHAVHYAALRSQLSCLQMLVNAGGKIDARDTFGNTPLHYAAEDGNVILMSLLLHNGASLDAQDITNKTPLMKATRNGKLAAVKRLTAAGASVNLKDKNEDTALHFAARHGSGEMTCMLIRAEARVDAQNQWGLTPLMEAVSYNQKEVVAALIKHRCDLYKRDFRTGDTSLHIAVKKNYTDLVSMLLSAGNWYIQYNFNNFGESFVHDVVVYNRLDLLRLFVTYNYNFDYPAKKTPTGVEKLPFQLVLERGHLEMAKILAQ 352          
BLAST of Ankyrin repeat-containing, putative vs. TrEMBL
Match: A0A1I8GY03 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 2.269e-174
Identity = 231/334 (69.16%), Postives = 283/334 (84.73%), Query Frame = 3
Query:  294 ALLFYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLS 1295
            A+ FYDAII ND+D LR+ VE++K DLNAKF  VR+ +H DL PVHLV++KGY S+LHYLIQ+GV VNQ+T TL R  +H+AA+  QLSC Q+L+NAGG+IDA+DTFGNTPLHYAAEDG   L++LLL NGA+ D+QDITNKTPLMKATR+G++ AVKRL   G +VN+KDKNEDTALH+AAR GS ++  ML++ +AR+DAQNQWGLTPLMEAVSY+Q+ VV  LI+ +CDLYKRD+RTGDT+LH+AV+KNY  LV MLL AG WYI+YNFNNFGESFVHD V YNR +L+RLF+ +NYNFDYPAKK  +G EK PFQLVLERGHLE+AK+L+
Sbjct:   18 AIHFYDAIIQNDMDALRRAVEVFKVDLNAKFTLVRKQHHFDLFPVHLVAYKGYLSMLHYLIQTGVAVNQTTATLHRHAVHYAALRSQLSCLQMLVNAGGKIDARDTFGNTPLHYAAEDGNVILMSLLLHNGASLDAQDITNKTPLMKATRNGKLAAVKRLTAAGASVNLKDKNEDTALHFAARHGSGEMTCMLIRAEARVDAQNQWGLTPLMEAVSYNQKEVVAALIKHRCDLYKRDFRTGDTSLHIAVKKNYTDLVSMLLSAGNWYIQYNFNNFGESFVHDVVVYNRMDLLRLFVTYNYNFDYPAKKTPTGVEKLPFQLVLERGHLEMAKILA 351          
BLAST of Ankyrin repeat-containing, putative vs. TrEMBL
Match: G7YRI6 (Putative ankyrin repeat protein RF_0381 OS=Clonorchis sinensis OX=79923 GN=CLF_108341 PE=4 SV=1)

HSP 1 Score: 502.286 bits (1292), Expect = 1.895e-170
Identity = 247/464 (53.23%), Postives = 329/464 (70.91%), Query Frame = 3
Query:  285 TSPALLFYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSK-CDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKL-------------------ASGT-----EKSPFQLVLERGHLELAKVLSRVCCYWSK----------------------NSNT-------------VKRIEFQELEEVKSLRQWCRKVIRRQLGFHIYEKLQKINLPPALIEYIQLEDIKW 1496
            T P L FYDA++NN + +L++ VE++K DLNA+   VR+ NH DLCPVHLV++KGYF++LHYLIQ+G++V+Q T TL R+ +H AA+ HQ+SC Q+L+NAG Q+DA+DTFGNTPLHYAAEDG+  LL+LLL NGA+ DSQDITNKTPLMKA RSG++ AV+RL+  G NVNVKD+N++TALH+A RQGS ++  ML+K  AR++AQNQ GLTPLMEAVSY+Q+  V ++++ +  DLYKRD+ TGDTALH+AV+KNY+H+VE+LL+AG WYIEYN+NN GESFVHD + YNR +L+RLFL +NY+FD PAK+L                   A G+     EKSPFQL LERGHL+LA++L+ V CY  K                      N++T                  +  L EVKSL++WCR+ IR+ LGF + + L ++ LP AL +++ L DI W
Sbjct:    7 TIPGLAFYDALVNNSLVELKRCVELHKIDLNARLSHVRKRNHTDLCPVHLVAYKGYFAMLHYLIQNGINVHQPTLTLQRRAVHFAALRHQVSCLQMLLNAGAQLDARDTFGNTPLHYAAEDGDGALLSLLLNNGASVDSQDITNKTPLMKAARSGKLWAVRRLIAFGANVNVKDRNDETALHFACRQGSTEITSMLIKAGARLNAQNQIGLTPLMEAVSYNQREAVSLMVKQRGVDLYKRDFCTGDTALHIAVKKNYIHMVEILLQAGNWYIEYNYNNLGESFVHDVIAYNRLDLLRLFLAYNYDFDRPAKRLPASILGAIVPEASSSNTVGAGGSFSNTCEKSPFQLALERGHLDLARILADVGCYRIKLPITSGPFTLPLSLYTTSALQSNNSTPSWPNVASLSNSSSLARRYSGLLEVKSLKKWCRRAIRQLLGFRLIDALPQLPLPIALKDFLLLRDIDW 470          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 134.806 bits (338), Expect = 1.043e-32
Identity = 94/294 (31.97%), Postives = 140/294 (47.62%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            L P+H+ +F G+ +I+  L+Q G   N S   +   PLH AA +     +Q L+    Q+DAK     TPLH AA  G   L+ LLL++ AN DS      TPL  A R G     + LL          K   T LH A + G  D+  +LL+  A  +A  + GLTPL  AV ++   VV++L+ SK        R G T LH+A ++N + +   LL+ G      +    G + +H A    R ++V L +    N +   K     T  +P  LV + GH+ +A +L +
Sbjct:  380 LTPLHVAAFMGHLNIVKSLLQRGASPNASNVKV-ETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV-SKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQ--GITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVK 669          

HSP 2 Score: 114.005 bits (284), Expect = 5.827e-26
Identity = 89/309 (28.80%), Postives = 145/309 (46.93%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKRI 1343
            L P+H+ +  G+  +   L+  G   N      F  PLH A   + +    LL+     ++A    G TPLH AA  G  N++  LLQ GA+ ++ ++  +TPL  A R+G     + LL     V+ K K++ T LH AAR G  +L+ +LL++ A  D+    G TPL  A         +IL+       K   + G T LHVA +   V + E+LL+ G        N  G + +H AV +N  ++V+L +    +    A+        +P  +  ++  LE+A  L  + C  + NS +++ I
Sbjct:  314 LTPLHVAAHCGHHRMAKVLLDKGAKANARALNGF-TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKM-TKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKN--GLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARN-----GYTPLHIAAKQNQLEVASSL--LQCGANANSESLQGI 611          

HSP 3 Score: 105.145 bits (261), Expect = 4.655e-23
Identity = 77/256 (30.08%), Postives = 120/256 (46.88%), Query Frame = 3
Query:  525 PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            PLH AA    LS +QLL+N G  ++     G TPLH AA  G   ++ LLL  GA  D++     TPL  A R+G +  ++ LL  G  +  K KN  + +H AA+    D +  LL+Y+A ID      LTPL  A       + ++L+        R    G T LH+A +KN++  +++LLK             G + +H A +     +V+  L    + +    K+     ++P  +    GH E+A+ L
Sbjct:  184 PLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARAL-NGFTPLHIACKKNHMRSMDLLLKHSASL--EAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKV-----ETPLHMAARAGHCEVAQFL 431          

HSP 4 Score: 98.9821 bits (245), Expect = 3.330e-21
Identity = 92/332 (27.71%), Postives = 142/332 (42.77%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDL------------------------------YKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +  +N   L  +HL S +G+  ++  L+  G+D+ ++TT      LH AA++ Q      L++ G  ++A+   G +PL+ AA++    ++  LL+NGAN         TPL  A + G    V  L+    N   K K    ALH AAR        +LL+ D   D  ++ G TPL  A  Y   SV Q+L+    ++                               + D RT D  T LH A R  +V ++E+LL  G   I+    N G S +H A   +  + VR  L +N   D       +    +P  +    GH  +AKVL
Sbjct:   13 INTANQNGLNGLHLASKEGHVKMVLELLHHGIDL-ETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAP-IQAKTKN-GLSPIHMAAQGDHMDCVRQLLQYNAEIDD-----ITLDHLTPLHVAAHCGHHRMAKVL 332          

HSP 5 Score: 96.2857 bits (238), Expect = 2.830e-20
Identity = 78/326 (23.93%), Postives = 136/326 (41.72%), Query Frame = 3
Query:  414 DLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRS---------------------------------GRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +L P+H  +  G+  ++  L+  G  + Q+ T     P+H AA    + C + L+    +ID       TPLH AA  G + +  +LL  GA ++++ +   TPL  A +                                  G +  VK LL  G + N  +   +T LH AAR G  ++   LL+  A++DA+ +   TPL  A     + +V++L+  K +        G T LH+A R+ + H   +LL       +     F  + +H A  Y + ++  L L    N +   K        +P  + +   +L++ K+L
Sbjct:  247 ELTPLHCAARNGHVRVIEILLDQGAPI-QAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKAN-PDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGF--TPLHVACKYGKVDVAELLLERGANPNAAGKN-----GLTPLHVAVHHNNLDVVKLL 563          

HSP 6 Score: 92.0485 bits (227), Expect = 5.885e-19
Identity = 80/317 (25.24%), Postives = 137/317 (43.22%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQ-----WGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVK-RIEFQE 1355
            P+H+ + +G+      L+       + T   F  PLH A    ++  ++LL+  G   +A    G TPLH A      +++ LL+  G +  S      TPL  A +  ++     LL  G N N +     T LH AA++G  D++ +L+     ++  N+       LTPL          +  +L++    +Y    R G TALHVA     + +V+ LL+  + ++       G + +H A      ++V L L H      P +   +GT  SP  +    G++ +  VL  V    ++ S + K R+ F E
Sbjct:  481 PLHIAAREGHAHTTRILLDGNAQQTKMTKKGF-TPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSAS-RMGYTALHVACHYGNIKMVKFLLQQ-QAHVNCK-TRVGYTPLHQAAQQGHTDIVTLLLKHGA---LPNEITTNGT--SPLGIAKRLGYISVIDVLKLV----TEESMSAKHRMSFPE 784          

HSP 7 Score: 87.0409 bits (214), Expect = 2.367e-17
Identity = 88/345 (25.51%), Postives = 145/345 (42.03%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVD---------------------------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVK 1337
            V   + K   P+++ + + +  ++ +L+++G +                           +N  T    R P LH AA +     + +L+      D     G TPLH AA     ++  LLL  GAN +       TPL  A R G +  V+ LL  G  ++ + K+E T LH AAR G   +I +LL   A I A+ + GL+P+  A        V+ L++   ++   D  T D  T LHVA    +  + ++LL  G        N F  + +H A   N    + L L H+ + +       + +  +P  +    GHL + K L +     S N++ VK
Sbjct:   79 VNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGF--TPLHIACKKNHMRSMDLLLKHSASLEA-----VTESGLTPLHVAAFMGHLNIVKSLLQRGA--SPNASNVK 411          

HSP 8 Score: 85.8853 bits (211), Expect = 5.131e-17
Identity = 60/224 (26.79%), Postives = 103/224 (45.98%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQ-----NGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEML 1073
            L P+H+        ++  L+  G     ST      PLH AA  +QL  +  L+  G   +++   G TPLH AA++G  +++ LL+      N  N     +T  TPL    + G +G    L+  G +V    +   TALH A   G+  ++  LL+  A ++ + + G TPL +A       +V +L++    L       G + L +A R  Y+ ++++L
Sbjct:  545 LTPLHVAVHHNNLDVVKLLVSKG-GSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGA-LPNEITTNGTSPLGIAKRLGYISVIDVL 766          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Cavefish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 121.709 bits (304), Expect = 1.958e-28
Identity = 101/334 (30.24%), Postives = 159/334 (47.60%), Query Frame = 3
Query:  354 EIYKFDLNAKFPEVRRSNHKDLCPVHL--VSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKAT------------RSGRIGAV------KRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALH-VAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            E    +L  +   V + N++   P+HL  VS  G    L  L+ +G DVN  +    + PLH AA+  + + SQ+LI  GG+ID  D +GNTPLH AA+ G   L++ L+ NGA++  Q I    PL  A              SG++ ++      + +L  G ++N  D    T LH AA  G+ + + +LL   A ++ ++++G TPL  A +  +   V IL+ +  ++ + D R+G T LH  A    +   VE LL  G      N   +  S VH +  +   + + L L+ ++N    A+   S    SP  L    GH E   VL
Sbjct:  243 EAVANELVNRGANVNQPNNRGYTPLHLAAVSTNGAL-CLELLVNNGADVNMQSKE-GKSPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAAKYGHELLISTLMTNGADTARQGIHGMFPLHLAVLYGFSDCCRKLLSSGQLYSIVLSMSKEHVLSAGFDINTPDDFGRTCLHAAASGGNTECLNLLLSSGADMNKKDKFGRTPLHYAAANRRYQCVVILVGAGAEVNEPD-RSGCTPLHYSAASTAFCRCVEYLLDNGADPCMRNSKGY--SPVHYSAAHGNKQSLELLLVMSFNTSGDAE---SCGPVSPLHLAASAGHWECVNVL 568          

HSP 2 Score: 90.1225 bits (222), Expect = 2.154e-18
Identity = 81/341 (23.75%), Postives = 154/341 (45.16%), Query Frame = 3
Query:  300 LFYDAIINNDIDKLRKMVE-IYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSIL----HYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPL-MKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLI--IMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLL--KAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L    ++ N  D  R+ +  ++   L   +         D C   L S + Y  +L     +++ +G D+N +     R  LH AA      C  LL+++G  ++ KD FG TPLHYAA +     + +L+  GA  +  D +  TPL   A  +     V+ LL  G +  +++    + +HY+A  G+   +  ++++ ++   DA++   ++PL  A S      V +L+ S   +   D   G + L+VA +K +   VE+LL   A   + E+       + +H A      E +++ +    + D P   ++    ++P  L +  GH++  ++L
Sbjct:  344 LLISTLMTNGADTARQGIHGMFPLHLAVLY------GFSDCCRKLLSSGQLYSIVLSMSKEHVLSAGFDIN-TPDDFGRTCLHAAASGGNTECLNLLLSSGADMNKKDKFGRTPLHYAAANRRYQCVVILVGAGAEVNEPDRSGCTPLHYSAASTAFCRCVEYLLDNGADPCMRNSKGYSPVHYSAAHGNKQSLELLLVMSFNTSGDAESCGPVSPLHLAASAGHWECVNVLLESGMQVEVCD-SVGRSVLYVASQKGHSRCVELLLSQSASCLFTEHCSR---WTPLHIAAVNGHTECLQMLISSKEDPDLP--NISDTEGQTPLMLAVLDGHIDCVRLL 671          

HSP 3 Score: 88.5817 bits (218), Expect = 5.826e-18
Identity = 92/335 (27.46%), Postives = 146/335 (43.58%), Query Frame = 3
Query:  282 PTSPALLFYDAIINNDIDKL-----RKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNED---------------------TALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHV-AVRKNYVHLVEMLLKAGKWYIEYNFNN-FGESFVHDAVWYNRCELVRLFLMHNYNFD 1202
            P  P L+   AI N + D++     R+M  ++ +D      + RR+      P+H  ++ G   I+  LI +G+   Q+   L   PLH AA S       LL+  G  + A+D F  T LH AA +        LL + ++ +  D T +  L  A +SG    VK LL  G +++  DK E                      T LH AA  G  D++  LL+  A ID  N +G T L  A    Q++V   L+    ++ + + R G T LH+ AV  N    +E+L+  G    + N  +  G+S +H A  + R    ++ + +    D
Sbjct:   10 PPQPPLV--QAIFNRNADEVQLFCTRRMKSMHWYD------QERRT------PLHAAAWLGDVHIMDLLISAGIVDAQTMCGL--TPLHRAAASRNERAVGLLLRKGADVTARDKFWQTALHIAAANRATRCADTLLPHISSLNIADRTGRAALHHAAQSGCQEMVKLLLNKGASLSASDKKERQPIHWAAYLGHLEVVKLLRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYMGQEAVANELVNRGANVNQPNNR-GYTPLHLAAVSTNGALCLELLVNNGA---DVNMQSKEGKSPLHMAAIHGRFTRSQILIQNGGEID 324          

HSP 4 Score: 81.2629 bits (199), Expect = 1.330e-15
Identity = 63/226 (27.88%), Postives = 112/226 (49.56%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGN-TPLHYAAEDGENNLLTLLLQNGANSDSQDITN---KTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDY---RTGDTALHVAVRKNYVHLVEMLLK 1079
            P+HL +  G++  ++ L++SG+ V +   ++ R  L+ A+      C +LL++        +     TPLH AA +G    L +L+ +  + D  +I++   +TPLM A   G I  V+ LL  G   + KD+   TALH AA  G  D +  LL ++A + +++  G TP+  A S     ++  L+ +    + +D    R G T  H A    +   +E++L+
Sbjct:  552 PLHLAASAGHWECVNVLLESGMQV-EVCDSVGRSVLYVASQKGHSRCVELLLSQSASCLFTEHCSRWTPLHIAAVNGHTECLQMLISSKEDPDLPNISDTEGQTPLMLAVLDGHIDCVRLLLDQGACPDGKDRKGRTALHRAALLGWEDCVTALLSHNASVVSRDVRGRTPIHLAASCGHAEILSSLLSAADHSHPQDPITDRHGFTPAHWAAYHGHEDCLEVVLE 776          

HSP 5 Score: 60.8474 bits (146), Expect = 2.947e-9
Identity = 62/241 (25.73%), Postives = 105/241 (43.57%), Query Frame = 3
Query:  387 PEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAG---GQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLG-VGCNVNVKDKNEDTALHYA---ARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGK 1088
            P+   ++     P H  ++ G+   L  +++      Q  +     PLH A ++     +++L+N+      ++  D  G T LH AA   +   L L+L+ GA  ++ D   ++ LM A   GR  AV  LL     ++++ D+N++TALH A   A +  A LI+  +     I+A N     PL  A      +VVQ L+     +   D      AL  A  K     + ++L   K
Sbjct:  746 PQDPITDRHGFTPAHWAAYHGHEDCLEVVLELKPCSIQEGSPF--TPLHCALINGHSGSAEMLLNSSFGTSLVNTGDAKGRTVLHAAAVAEDVAGLQLILRMGAEINAVDHAGRSALMVAADKGRSAAVALLLHRAKADLSILDENKNTALHLACSKAHEMCAMLILKEIHNPVLINATNSMLQMPLHIAARNGLATVVQALLNRGATVLAVDEEGHTPALACAPNKAVADCLALILSTMK 984          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 117.472 bits (293), Expect = 5.820e-27
Identity = 86/293 (29.35%), Postives = 137/293 (46.76%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +F G+ +I+  L+  G   N +T       LH AA + Q    + L+  G  +DAK     TPLH ++  G+  ++  LLQ+GA  DS   +  TPL  A R G       LL  G ++ +  K   T LH AA+ G  ++  +LL+  A  DA  + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +KN + +   LL+ G    + N     G S +H A      ++V L +  +   +     L + +  +P  L  +   + +A+VL
Sbjct:  381 LTPIHVAAFMGHENIVTQLMNHGASPN-TTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAA-AKNGYTPLHIAAKKNQMEIATTLLEYGA---DTNAITRQGISPLHLASQEGNVDMVTLLMARDATIN-----LCNKSGLTPLHLAAQEDQVNVAEVL 663          

HSP 2 Score: 106.301 bits (264), Expect = 1.872e-23
Identity = 80/308 (25.97%), Postives = 142/308 (46.10%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKR 1340
            L  +H+ +  G++ +   ++    + N      F  PLH A   +++   +LL+  G  I A    G TP+H AA  G  N++T L+ +GA+ ++ ++  +T L  A R+G+   VK L+  G  V+ K K++ T LH ++R G  ++I  LL++ A  D+    G TPL  A     + V  IL+     L     + G T LHVA +   + +  +LL+  K          G + +H A  Y+  ++  L L    +    AK        +P  +  ++  +E+A  L      +  ++N + R
Sbjct:  315 LTALHVAAHCGHYKVAKVIVDKKANPNAKALNGF-TPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASL-GITTKKGFTPLHVAAKYGKIEVANLLLQ--KRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-----GYTPLHIAAKKNQMEIATTL----LEYGADTNAITR 609          

HSP 3 Score: 99.7525 bits (247), Expect = 2.154e-21
Identity = 77/293 (26.28%), Postives = 138/293 (47.10%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAA-MSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
              P+H+   K    ++  L++ G  + Q+ T     P+H AA M H+   +QL+ N G   +  +  G T LH AA  G+  ++  L+QNGA  D++   ++TPL  ++R G+   +++LL  G   +    +  T LH AAR+G  D+  +LL   A +    + G TPL  A  Y +  V  +L++ +        ++G T LHVA   +   +  +LL  G        N +  + +H A   N+ E+    L +  + +   ++       SP  L  + G++++  +L
Sbjct:  348 FTPLHIACKKNRIKVMELLLKHGASI-QAVTESGLTPIHVAAFMGHENIVTQLM-NHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAP-PDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGY--TPLHIAAKKNQMEIATTLLEYGADTNAITRQGI-----SPLHLASQEGNVDMVTLL 630          

HSP 4 Score: 99.7525 bits (247), Expect = 2.393e-21
Identity = 67/219 (30.59%), Postives = 106/219 (48.40%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK 1079
            P+HL + +G+  +   L+  G  +  +T   F  PLH AA   ++  + LL+      DA    G TPLH AA      +  LLL  GA+  +      TPL  A +  ++     LL  G + N   +   + LH A+++G+ D++ +L+  DA I+  N+ GLTPL  A    Q +V ++L+     +   + + G T LHVA     V +V  LLK
Sbjct:  482 PLHLAAREGHKDVASILLDQGASLGITTKKGF-TPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATV-DPETKMGYTPLHVACHYGNVKMVHFLLK 698          

HSP 5 Score: 91.2781 bits (225), Expect = 1.179e-18
Identity = 80/264 (30.30%), Postives = 119/264 (45.08%), Query Frame = 3
Query:  435 VSFKGYFSILHYLIQSGVD------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSK--CDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNF 1199
            ++ +  F+ L   +Q G D      +   T    R P LH AA       + LL+      D +   G TPLH AA  G  N+ TLLL  GA  D +   + TPL  A++ G    VK LL  G  ++ K K+  T LH  AR G   ++ MLL   A I ++ + GL+PL  A      + VQ+L+  +   D    DY    TALHVA    +  + ++++           N F  + +H A   NR +++ L L H  + 
Sbjct:  115 IATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYL---TALHVAAHCGHYKVAKVIVDKKANPNAKALNGF--TPLHIACKKNRIKVMELLLKHGASI 373          

HSP 6 Score: 87.8113 bits (216), Expect = 1.384e-17
Identity = 60/238 (25.21%), Postives = 113/238 (47.48%), Query Frame = 3
Query:  402 SNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNN 1115
            +  K   P+H+ +  G   + + L+Q     + S  +    PLH AA       + LL++ G    A    G TPLH AA+  +  + T LL+ GA++++      +PL  A++ G +  V  L+     +N+ +K+  T LH AA++   ++  +L+ + A +D + + G TPL  A  Y    +V  L++++  +  +   T       A ++ + H++ +LL+ G    E   N 
Sbjct:  508 TTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGL-TPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKVT-------AAQQGHTHIINLLLQHGAAPNELTVNG 737          

HSP 7 Score: 78.5666 bits (192), Expect = 9.844e-15
Identity = 82/308 (26.62%), Postives = 121/308 (39.29%), Query Frame = 3
Query:  462 LHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKN----------------------EDT-------ALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKR----------------------------DYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFD 1202
            L YL +SGVD+N          LH A+    +     LI  G  +DA    GNT LH A+  G+++++  L+ NGAN ++Q     TPL  A +   +  V+ LL  G + ++  ++                       DT       ALH AAR+       +LL+ D   D +++ G TPL  A  Y   +V  +L+   +  D   R                            D +T D  T LH   R  +  +VEMLL  G   +    N  G S +H A   +    V+L L H    D
Sbjct:    5 LDYL-KSGVDINICNQNGLNA-LHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKN--GLSPLHMATQGDHLNCVQLLLHHEVPVD 308          

HSP 8 Score: 62.3882 bits (150), Expect = 1.017e-9
Identity = 58/186 (31.18%), Postives = 83/186 (44.62%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQ---PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
            P+H+ + K    I   L++ G D N  T    RQ   PLH A+    +    LL+     I+  +  G TPLH AA++ + N+  +L+ +GA  D +     TPL  A   G +  V  LL     VN K K        AA+QG   +I +LL++ A  +     G T L  A      SVV  L
Sbjct:  581 PLHIAAKKNQMEIATTLLEYGADTNAIT----RQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKV------TAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTL 756          

HSP 9 Score: 54.299 bits (129), Expect = 3.901e-7
Identity = 39/148 (26.35%), Postives = 63/148 (42.57%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYA---------------------------AEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRL 773
            + + P+HL S +G   ++  L+     +N    +    PLH AA   Q++ +++L+N G  +D +   G TPLH A                           A+ G  +++ LLLQ+GA  +   +   T L  A R G I  V  L
Sbjct:  610 QGISPLHLASQEGNVDMVTLLMARDATINLCNKSGL-TPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKVTAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTL 756          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Cavefish
Match: ENSAMXT00000017800.2 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21012912:21225385:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000017800.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.005 bits (284), Expect = 8.718e-26
Identity = 79/267 (29.59%), Postives = 129/267 (48.31%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAK 1214
            L P+H+ +F G+ +I+  L+Q+G   + S        LH AA + Q+   + L+  G  +DA+     TPLH A+  G+  ++ LLLQ+ A+ D+      TPL  + R G++     LL  G + ++  K   T LH A++ GS D+  +LL+  A  D+  + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +KN + +   LL   ++  E N     G + +H A      ++  L L      + P K
Sbjct:  428 LTPIHVAAFMGHLNIVLLLLQNGASPDVSNIR-GETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHA-TAKNGYTPLHIAAKKNQMEIATTLL---QYEAETNILTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTK 689          

HSP 2 Score: 105.916 bits (263), Expect = 2.793e-23
Identity = 84/303 (27.72%), Postives = 143/303 (47.19%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQ---PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK-------AGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEK-SPFQLVLERGHLELAKVL 1292
            L  +H+ +  G++ +   L+      N +   L +    PLH A   +++   +LL+  G  I A    G TP+H AA  G  N++ LLLQNGA+ D  +I  +T L  A R+G++  V+ LL  G  V+ + + + T LH A+R G  +++ +LL++ A  DA    G TPL  +    Q  V  +L+ +    +    + G T LHVA +   + + ++LL+       AGK          G + +H A  Y+  ++  L L      D  A   A+     +P  +  ++  +E+A  L
Sbjct:  360 LTALHVAAHCGHYRVTKLLLDK--RANPNARALLQNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGAS-HSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGK---------NGLTPLHVAAHYDNQKVALLLL------DKGASPHATAKNGYTPLHIAAKKNQMEIATTL 644          

HSP 3 Score: 100.523 bits (249), Expect = 1.741e-21
Identity = 81/302 (26.82%), Postives = 134/302 (44.37%), Query Frame = 3
Query:  387 PEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            P  R        P+H+   K    ++  L++ G  + Q+ T     P+H AA    L+   LL+  G   D  +  G T LH AA  G+  ++  LL+NGA  D++   ++TPL  A+R G+   V+ LL    + +    N  T LH +AR+G  D+  +LL+  A      + G TPL  A  Y    V ++L++ +        + G T LHVA   +   +  +LL  G     +     G + +H A   N+ E+    L +    +   K+       +P  L  + GH ++A +L
Sbjct:  385 PNARALLQNGFTPLHIACKKNRVKVMELLVKYGASI-QAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAG-KNGLTPLHVAAHYDNQKVALLLLDKGA--SPHATAKNGYTPLHIAAKKNQMEIATTLLQYEAETNILTKQGV-----TPLHLASQEGHSDMAALL 677          

HSP 4 Score: 99.7525 bits (247), Expect = 2.605e-21
Identity = 69/228 (30.26%), Postives = 107/228 (46.93%), Query Frame = 3
Query:  402 SNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            +  K   P+H+ S  G   +   L+Q     + +       PLH AA       + LL++ G    A    G TPLH AA+  +  + T LLQ  A ++       TPL  A++ G       LL  G  VNV  K+  TALH AA++    +  +L+K  A +D Q + G TPL+ A  Y    +V  L++S   +  +  + G T LH A ++   H++ +LL+ G
Sbjct:  555 ATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGL-TPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYEAETNILTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTKSGLTALHLAAQEDRVGVAEILVKNGASMDQQTKLGYTPLIVACHYGNAKMVNFLLKSNASVNAKT-KNGYTPLHQAAQQGNTHIINVLLQYG 780          

HSP 5 Score: 97.0561 bits (240), Expect = 1.741e-20
Identity = 82/292 (28.08%), Postives = 140/292 (47.95%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQN--QWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            P+H+ +  G  ++   L+  G  V+ +       PLH A+     +  +LL++ G QIDAK   G TPLH AA  G +  + LLL+ GA   ++     +PL  A +   +  VK LL     V+    +  TALH AA  G   +  +LL   A  +A+   Q G TPL  A   ++  V+++L++    + +    +G T +HVA    ++++V +LL+ G      N    GE+ +H A    + E+VR  L +    D  A++     +++P  +    G  E+ ++L
Sbjct:  229 PLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALLQNGFTPLHIACKKNRVKVMELLVKYGASI-QAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIR--GETALHMAARAGQVEVVRCLLRNGAMVDARARE-----DQTPLHIASRLGKTEIVQLL 512          

HSP 6 Score: 87.0409 bits (214), Expect = 2.458e-17
Identity = 62/183 (33.88%), Postives = 88/183 (48.09%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
            P+H+ + K    I   L+Q   + N  T      PLH A+       + LL+  G Q++     G T LH AA++    +  +L++NGA+ D Q     TPL+ A   G    V  LL    +VN K KN  T LH AA+QG+  +I +LL+Y A+ +A    G T L  A      SVV  L
Sbjct:  628 PLHIAAKKNQMEIATTLLQYEAETNILTKQGV-TPLHLASQEGHSDMAALLLQKGAQVNVPTKSGLTALHLAAQEDRVGVAEILVKNGASMDQQTKLGYTPLIVACHYGNAKMVNFLLKSNASVNAKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTALAIARRLGYISVVDTL 809          

HSP 7 Score: 85.1149 bits (209), Expect = 9.833e-17
Identity = 66/238 (27.73%), Postives = 103/238 (43.28%), Query Frame = 3
Query:  459 ILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNV-----------------------------NVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            +L YL + GVD+  S        LH AA    +   Q L+  G  +D+    GNT LH A+  G+  ++ +L++ GA+ ++Q     TPL  A++   +  V+ LL  G N                              + K K    ALH AAR+       +LL+ D   D Q++ G TPL  A  Y   +V  +L+     +     + G T LHVA ++   ++V +LL  G
Sbjct:   48 VLEYL-KGGVDIGTSNQNGL-NALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLDRG 283          

HSP 8 Score: 63.5438 bits (153), Expect = 4.874e-10
Identity = 61/233 (26.18%), Postives = 109/233 (46.78%), Query Frame = 3
Query:  603 KDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK---AGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            K +  NT    AA  G  + +   L+ G +  + +      L  A + G +  V+ LL  G +V+   K  +TALH A+  G A+++ +L+K  A I+AQ+Q G TPL  A   +   VV+ L+ +  +        G T L +A+++ +  +V +LL+    GK  +           +H A   +  +   L L +++N D  +K   SG   +P  +    G++ +A +L
Sbjct:   28 KKSDSNTSFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGN-QSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPA---------LHIAARKDDTKSAALLLQNDHNADVQSK---SGF--TPLHIAAHYGNVNVATLL 245          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Cavefish
Match: ankrd6b (ankyrin repeat domain 6b [Source:ZFIN;Acc:ZDB-GENE-030916-4])

HSP 1 Score: 111.694 bits (278), Expect = 2.327e-25
Identity = 84/249 (33.73%), Postives = 125/249 (50.20%), Query Frame = 3
Query:  432 LVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLF 1178
            + S KG    +  LI  G  V  + T   R PLH AA    L   ++L+ AG  +D +D    T LH AA  G +++++ L+Q G   D QD    T L +    G   +VK L+  G N++ K+K  +TALH A + G      +LL   AR D++N  G T L  A  Y+   V++IL+   C + +R+ + GDTALHVA   N+     +LL+AG        NN G++ +  A  +N  E+  L 
Sbjct:   18 VASHKGQADHVVQLINKGAKV--AVTKYGRTPLHLAAYKGHLEVVRILLKAGCDLDIEDDGEQTALHRAAVVGNSDVISALIQEGCALDRQDKDGNTSLHEVAWHGFSQSVKLLVKAGVNLHAKNKAGNTALHLACQNGHTQSCKVLLLGGARPDSKNNVGDTCLHVAARYNHVCVIRILLGVFCSVSERN-QAGDTALHVAAVLNHKKTARLLLEAGTDSTIR--NNVGQTALDQAREHNNPEVALLL 261          

HSP 2 Score: 77.411 bits (189), Expect = 1.884e-14
Identity = 63/219 (28.77%), Postives = 100/219 (45.66%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVN--------------------------QSTTTLFRQ------PLHHAAMSHQLSCS-QLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRS 980
            P+HL ++KG+  ++  L+++G D++                          Q    L RQ       LH  A  H  S S +LL+ AG  + AK+  GNT LH A ++G      +LL  GA  DS++    T L  A R   +  ++ LLGV C+V+ +++  DTALH AA         +LL+       +N  G T L +A  ++   V  +L ++
Sbjct:   47 PLHLAAYKGHLEVVRILLKAGCDLDIEDDGEQTALHRAAVVGNSDVISALIQEGCALDRQDKDGNTSLHEVAW-HGFSQSVKLLVKAGVNLHAKNKAGNTALHLACQNGHTQSCKVLLLGGARPDSKNNVGDTCLHVAARYNHVCVIRILLGVFCSVSERNQAGDTALHVAAVLNHKKTARLLLEAGTDSTIRNNVGQTALDQAREHNNPEVALLLTKA 264          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.939 bits (302), Expect = 5.677e-29
Identity = 85/292 (29.11%), Postives = 145/292 (49.66%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +  G++ +   L+  G + N      F  PLH A   +++   +LL+  G  I      G TP+H A+  G  N++ LLLQNGA+S++ ++  +TPL  A+R+G++  VK LL  G  V VK + + T LH A+R G A+++ +LL+  +  +A    G TPL  A       V  +L+ +  D+     + G T LH+A +   + +  +LL+  K+         G + +H A  Y+  ++  L L    +    AK        +P  +  ++  LE+ KVL
Sbjct:  345 LTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGF-TPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPV-TKKGFTPLHIASKYGRLEVATLLLE--KYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKN-----GYTPLHIAAKKNQLEVGKVL 627          

HSP 2 Score: 119.783 bits (299), Expect = 1.469e-28
Identity = 83/303 (27.39%), Postives = 148/303 (48.84%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            +  +    L P+H+ SF G+ +++  L+Q+G   N +T      PLH A+ + QL   + L+ +G ++  K     TPLH A+  G+  ++ LLLQ G++ ++   +  TPL  A+R G       LL  G +++   K   T LH A++ G  ++  +LL+  A  D + + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +KN + + ++LL+ G    E N     G + +H A      ++V L L  + +       LA+    +   L  +   + +A++L++
Sbjct:  403 IHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSN-ATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHST-AKNGYTPLHIAAKKNQLEVGKVLLELGA---ETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASI-----SLATKGGLTAMHLAAQEDKVNVAEILTK 695          

HSP 3 Score: 100.908 bits (250), Expect = 1.517e-22
Identity = 82/273 (30.04%), Postives = 129/273 (47.25%), Query Frame = 3
Query:  474 IQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            + S + +NQ+T + F  PLH AA    ++ + LL+N G  +D     G TPLH AA+ G NN++ LLL  GA  D++     TPL  A RSG    ++ LL     +  K KN  + LH A +      + +LL   A +D      LTPL  A       V ++L+    +   R    G T LH+A +KN + ++E+LLK G     +     G + +H A +     +V+L L +  + +    +      ++P  +    G LE+ K L
Sbjct:  199 VTSKMMLNQTTESGF-TPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALN-GFTPLHIACKKNRIKVMELLLKHGASI--HTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVR-----GETPLHMASRAGQLEVVKTL 462          

HSP 4 Score: 92.4337 bits (228), Expect = 6.788e-20
Identity = 82/305 (26.89%), Postives = 134/305 (43.93%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTV 1334
             P++  S +G+  +   L+++G D++  T   F  PLH A+   +L  + LL+      D K   G TPLH A       +  LLL  GA+  S      TPL  A +  ++   K LL +G   N+  +     LH AA++G AD++ +LL   A I    + GLT +  A    + +V +IL + K D+     +   T LHVA     + +V  LL+  +  +     N G + +H A       +V   L H  +   P +  A+G   +   +    G++ +   LS +        NTV
Sbjct:  511 TPLYFASREGHGDVASLLLENGADISPVTKKGF-TPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADV-NTTTKLCYTPLHVASHYGNIKMVNFLLR-NRALVNAKTRN-GYTPLHQAAQQGHTHVVNALLQHEAS---PNELTANG--NTALAIARRLGYISVVDTLSILTEEPVTGVNTV 806          

HSP 5 Score: 89.3521 bits (220), Expect = 6.220e-19
Identity = 77/292 (26.37%), Postives = 132/292 (45.21%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H  +  G+  ++  L++    +   T      PLH A     L+C QLL+     +D       TPLH AA  G   +  LLL  G   +++ +   TPL  A +  RI  ++ LL  G +++   ++  T +H A+  G  +++ +LL+  A  +A N  G TPL  A    Q  VV+ L++S   +  +  R   T LH+A R     +V++LL+ G        +  G + ++ A      ++  L L +  +     KK       +P  +  + G LE+A +L
Sbjct:  279 LTPLHCAARSGHEKVIEMLLERDAPILAKTKNGL-SPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVK-AREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTAS--GSTPLYFASREGHGDVASLLLENGADISPVTKK-----GFTPLHIASKYGRLEVATLL 561          

HSP 6 Score: 67.781 bits (164), Expect = 4.528e-12
Identity = 65/243 (26.75%), Postives = 104/243 (42.80%), Query Frame = 3
Query:  474 IQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYD-------------ARIDAQN------------------------QWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            ++ G+D+N          LH A+    +     L+    +ID     GNT LH AA  G+ +++ +L++ GAN ++Q     TPL  A +   +  VK LL  G N +V  ++  T L  A +QG   ++ +LL+ D             AR D  N                        + G TPL  A  Y   +V  +L+   +  D   R+   G T LHVA ++   ++V++LL  G
Sbjct:   30 LKGGMDINTCNQNGLNA-LHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARN---GITPLHVAAKRGNNNMVKLLLDRG 268          

HSP 7 Score: 66.6254 bits (161), Expect = 8.579e-12
Identity = 56/211 (26.54%), Postives = 98/211 (46.45%), Query Frame = 3
Query:  678 QNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKA---GKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKS---PFQLVLERGHLELAKVL 1292
            QNG N+          L  A++ G +  V  LL     ++   K  +TALH AA  G  D++ +L+++ A I+AQ+Q G TPL  A   +   +V+ L+ +  +        G T L VA+++ +  +V +LL++   GK  +           +H A   +      L L H +N D  +K + + T +S   P  +    G++ +A +L
Sbjct:   41 QNGLNA----------LHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGAN-QSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPA---------LHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLL 231          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.783 bits (299), Expect = 1.273e-28
Identity = 84/292 (28.77%), Postives = 143/292 (48.97%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +  G++ +   L+  G + N      F  PLH A   +++   +LL+  G  I      G TP+H A+  G  N++ LLLQNGA+S++ ++  +TPL  A+R+G++  VK LL  G  V VK + + T LH A+R G A+++ +LL+  +  +A    G TPL  A       V  +L+ +  D+     + G T LH+A +   + +  +LL+             G + +H A  Y+  ++  L L    +    AK        +P  +  ++  LE+ KVL
Sbjct:  338 LTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGF-TPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPV-TKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKN-----GYTPLHIAAKKNQLEVGKVL 622          

HSP 2 Score: 116.316 bits (290), Expect = 1.607e-27
Identity = 84/305 (27.54%), Postives = 148/305 (48.52%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQ--NQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            +  +    L P+H+ SF G+ +++  L+Q+G   N +T      PLH A+ + QL   + L+ +G ++  K     TPLH A+  G+  ++ LLLQ G++ ++   +  TPL  A+R G       LL  G +++   K   T LH A++ G  ++  +LL+  A  D +   Q GLTPL  A  Y  Q V  +L+      +    + G T LH+A +KN + + ++LL+ G    E N     G + +H A      ++V L L  + +       LA+    +   L  +   + +A++L++
Sbjct:  396 IHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSN-ATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHST-AKNGYTPLHIAAKKNQLEVGKVLLELGA---ETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASI-----SLATKGGLTAMHLAAQEDKVNVAEILTK 690          

HSP 3 Score: 102.449 bits (254), Expect = 4.295e-23
Identity = 112/387 (28.94%), Postives = 170/387 (43.93%), Query Frame = 3
Query:  351 VEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILI--RSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVK-------RIEFQELEEVKSLRQWCRKVIRR----QLGFHIYEKLQKINLPPALIE 1469
            +EI KF L+    +   +      P+ +   +G+  ++  L++S       T    R P LH AA     + + LL+      D     G TPLH AA  G  N+ TLLL  GA  D       TPL  A + G    VK LL  G  ++ K ++  T LH AAR G   +I MLL+ DA I A+ + GL+PL  A      + VQ+L+  ++  D    DY    T LHVA    +  + ++LL  G        N F  + +H A   NR +++ L L H  +     +   SG   +P  +    GHL + ++L +     S N+  V+            +LE VK+L Q   +V  +    Q   HI  +L K  +   L++
Sbjct:  123 LEIVKFLLDNGANQ-SVATEDGFTPLAVALQQGHEQVVGLLLES------DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYL---TPLHVAAHCGHYRVAKLLLDRGGEPNARALNGF--TPLHIACKKNRIKVMELLLKHGASIHTTTE---SGL--TPIHVASFMGHLNVVQLLLQNGA--SSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQ 490          

HSP 4 Score: 73.9442 bits (180), Expect = 4.397e-14
Identity = 64/235 (27.23%), Postives = 105/235 (44.68%), Query Frame = 3
Query:  474 IQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKN----------------------EDT-------ALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIR--SKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            ++ G+D+N          LH A+    +     L+    +ID     GNT LH AA  G+ +++ +L++ GAN ++Q     TPL  A +   +  VK LL  G N +V  ++                       DT       ALH AAR+   +   +LL+++   D  ++ G TPL  A  Y   +V  +L+   +  D   R+   G T LHVA ++   ++V++LL  G
Sbjct:   31 LKGGMDINTCNQNGLNA-LHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARN---GITPLHVAAKRGNNNMVKLLLDRG 261          

HSP 5 Score: 73.9442 bits (180), Expect = 5.139e-14
Identity = 62/229 (27.07%), Postives = 106/229 (46.29%), Query Frame = 3
Query:  387 PEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEML 1073
            P+V   N   L P+H+ +   +  +   L+  G     ST      PLH AA  +QL   ++L+  G + +     G  PLH AA++G  +++ LLL   A+         T +  A +  ++   + L     +VN   K   T LH A+  G+  ++  LL+  A ++A+ + G TPL +A       VV  L++ +    +     G+TAL +A R  Y+ +V+ L
Sbjct:  563 PKVAGQN--GLTPLHVATHYDHQKVALLLLDKGAS-PHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTAN-GNTALAIARRLGYISVVDTL 787          

HSP 6 Score: 63.5438 bits (153), Expect = 8.438e-11
Identity = 56/208 (26.92%), Postives = 96/208 (46.15%), Query Frame = 3
Query:  678 QNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKA---GKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            QNG N+          L  A++ G +  V  LL     ++   K  +TALH AA  G  D++ +L+++ A I+AQ+Q G TPL  A   +   +V+ L+ +  +        G T L VA+++ +  +V +LL++   GK  +           +H A   +      L L H +N D  +K   SG   +P  +    G++ +A +L
Sbjct:   42 QNGLNA----------LHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGAN-QSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPA---------LHIAARKDDTNAAALLLQHEHNADVTSK---SGF--TPLHIAAHYGNMNVATLL 224          

HSP 7 Score: 60.4622 bits (145), Expect = 8.083e-10
Identity = 36/122 (29.51%), Postives = 68/122 (55.74%), Query Frame = 3
Query:  720 TPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            T  ++A R+G +  +   L  G ++N  ++N   ALH A+++G  D++  LLK +A ID   + G T L  A    Q  +V++L+    ++  +  + G T L++A ++N++ +V+ LL  G
Sbjct:   13 TSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQS-QNGFTPLYMAAQENHLEIVKFLLDNG 133          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.079 bits (279), Expect = 4.524e-26
Identity = 95/323 (29.41%), Postives = 149/323 (46.13%), Query Frame = 3
Query:  333 DKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            +++R M  + K+   A    V  S    L P+H+ +F G  +I+  L+Q G   N +T       LH AA + Q    + L+  G Q+DAK     TPLH AA  G+  ++ LLLQ+ A+ D+      TPL  A R G       LL  G ++ V  K   T LH A++ G  ++  +LL+  A  DA  + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +K+ + +   LL+ G    E N     G + +H        ++  L L    + ++  K   SG   SP  L  +   + +A++L +
Sbjct:  116 NRIRVMELLLKY--GASIEAVTESG---LTPMHVSAFMGNLNIVLILLQGGASPN-ATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHA-TAKNGYTPLHIAAKKDQLEIATTLLEYGA---ETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATK---SGL--SPLHLAAQEDKVNVAEILVK 423          

HSP 2 Score: 110.923 bits (276), Expect = 1.061e-25
Identity = 82/292 (28.08%), Postives = 138/292 (47.26%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L  +H+ +  G++     L+  G + N      F  PLH A   +++   +LL+  G  I+A    G TP+H +A  G  N++ +LLQ GA+ ++ ++  +T L  A R+G+   V+ LL  G  V+ K + E T LH AAR G  +++ +LL++ A  DA    G TPL  A     + V  IL+     L     + G T LHVA +   + +  +LL+  ++         G + +H A  Y+  ++  L L    +    AK        +P  +  ++  LE+A  L
Sbjct:   73 LTALHVAAHCGHYRTAKVLLDKGANPNVRALNGF-TPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASL-AVTTKKGFTPLHVASKYGKMEVASLLLQ--RFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKN-----GYTPLHIAAKKDQLEIATTL 355          

HSP 3 Score: 96.6709 bits (239), Expect = 3.642e-21
Identity = 75/256 (29.30%), Postives = 116/256 (45.31%), Query Frame = 3
Query:  525 PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            PLH AA S      ++L+  G  I AK   G +PLH A +      + +L+Q  A  D   +   T L  A   G     K LL  G N NV+  N  T LH A ++    ++ +LLKY A I+A  + GLTP+  +      ++V IL++        + R G+TALH+A R     +V  LL+ G            ++ +H A    + E+V+L L H  + D      A+    +P  +    GH ++  +L
Sbjct:    9 PLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVR-GETALHMAARAGQTEVVRSLLRNGAQVDAKAREE--QTPLHIAARLGKLEIVQLLLQHMASPDA-----ATSNGYTPLHVAAREGHEDVTAIL 256          

HSP 4 Score: 90.5077 bits (223), Expect = 3.915e-19
Identity = 63/228 (27.63%), Postives = 107/228 (46.93%), Query Frame = 3
Query:  402 SNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            +  K   P+H+ S  G   +   L+Q     + +       PLH A+       + LL++ G    A    G TPLH AA+  +  + T LL+ GA +++       PL    + G       LL    +VN   K+  + LH AA++   ++  +L+K+ A ++A  + G TPL+ A  Y    +V  L++   D+  +  + G T LH A ++ + H+V +LLK G
Sbjct:  266 TTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGL-TPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKT-KNGYTPLHQAAQQGHTHIVNLLLKCG 491          

HSP 5 Score: 83.1889 bits (204), Expect = 6.345e-17
Identity = 61/232 (26.29%), Postives = 108/232 (46.55%), Query Frame = 3
Query:  381 KFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRT-GDTALHVAVRKNYVHLVEML 1073
            +F     +    L P+H+ S      +   L+  G   + +    +  PLH AA   QL  +  L+  G + +A    G  PLH  A++G  ++ +LLL   A+ +    +  +PL  A +  ++   + L+  G +VN   K   T L  A   G+  ++  LL++ A ++++ + G TPL +A       +V +L+  KC     D    G+TAL +A R  Y+ +V+ L
Sbjct:  292 RFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGY-TPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL--KCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 6 Score: 60.077 bits (144), Expect = 1.137e-9
Identity = 56/222 (25.23%), Postives = 91/222 (40.99%), Query Frame = 3
Query:  720 TPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG------------KWYIEYNFNNF-------------------GESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            TPL  A RSG    V+ LL  G  +  K KN  + LH A +    + + +L++Y A +D      LT L  A         ++L+    +   R    G T LH+A +KN + ++E+LLK G              ++     N                    GE+ +H A    + E+VR  L +    D  A++     E++P  +    G LE+ ++L
Sbjct:    8 TPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRAL-NGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKARE-----EQTPLHIAARLGKLEIVQLL 223          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.694 bits (278), Expect = 6.659e-26
Identity = 95/323 (29.41%), Postives = 149/323 (46.13%), Query Frame = 3
Query:  333 DKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            +++R M  + K+   A    V  S    L P+H+ +F G  +I+  L+Q G   N +T       LH AA + Q    + L+  G Q+DAK     TPLH AA  G+  ++ LLLQ+ A+ D+      TPL  A R G       LL  G ++ V  K   T LH A++ G  ++  +LL+  A  DA  + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +K+ + +   LL+ G    E N     G + +H        ++  L L    + ++  K   SG   SP  L  +   + +A++L +
Sbjct:   26 NRIRVMELLLKY--GASIEAVTESG---LTPMHVSAFMGNLNIVLILLQGGASPN-ATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHA-TAKNGYTPLHIAAKKDQLEIATTLLEYGA---ETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATK---SGL--SPLHLAAQEDKVNVAEILVK 333          

HSP 2 Score: 105.145 bits (261), Expect = 7.516e-24
Identity = 79/274 (28.83%), Postives = 130/274 (47.45%), Query Frame = 3
Query:  471 LIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L+  G + N      F  PLH A   +++   +LL+  G  I+A    G TP+H +A  G  N++ +LLQ GA+ ++ ++  +T L  A R+G+   V+ LL  G  V+ K + E T LH AAR G  +++ +LL++ A  DA    G TPL  A     + V  IL+     L     + G T LHVA +   + +  +LL+  ++         G + +H A  Y+  ++  L L    +    AK        +P  +  ++  LE+A  L
Sbjct:    1 LLDKGANPNVRALNGF-TPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASL-AVTTKKGFTPLHVASKYGKMEVASLLLQ--RFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKN-----GYTPLHIAAKKDQLEIATTL 265          

HSP 3 Score: 90.5077 bits (223), Expect = 2.911e-19
Identity = 63/228 (27.63%), Postives = 107/228 (46.93%), Query Frame = 3
Query:  402 SNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            +  K   P+H+ S  G   +   L+Q     + +       PLH A+       + LL++ G    A    G TPLH AA+  +  + T LL+ GA +++       PL    + G       LL    +VN   K+  + LH AA++   ++  +L+K+ A ++A  + G TPL+ A  Y    +V  L++   D+  +  + G T LH A ++ + H+V +LLK G
Sbjct:  176 TTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGL-TPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKT-KNGYTPLHQAAQQGHTHIVNLLLKCG 401          

HSP 4 Score: 83.5741 bits (205), Expect = 5.112e-17
Identity = 61/232 (26.29%), Postives = 108/232 (46.55%), Query Frame = 3
Query:  381 KFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRT-GDTALHVAVRKNYVHLVEML 1073
            +F     +    L P+H+ S      +   L+  G   + +    +  PLH AA   QL  +  L+  G + +A    G  PLH  A++G  ++ +LLL   A+ +    +  +PL  A +  ++   + L+  G +VN   K   T L  A   G+  ++  LL++ A ++++ + G TPL +A       +V +L+  KC     D    G+TAL +A R  Y+ +V+ L
Sbjct:  202 RFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGY-TPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL--KCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002048.1 (pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 gene:ENSPMAG00000001850.1 transcript:ENSPMAT00000002048.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 2.664e-24
Identity = 87/347 (25.07%), Postives = 162/347 (46.69%), Query Frame = 3
Query:  372 LNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGA--NSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVK-DKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTG-DTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKRIEFQELEEVKSLRQWCRKVI 1400
            L A+   +   + K   P+ L +  G+ +++  L+ +G D+   +      PL  A    +    +LLI  G   + ++    TPL  AA  G  N++ +LL  GA  NS +      +PLM A  +G   AVK LL +G ++N + + N +TAL  A  QG  +++ +L++  A ++ + + GLTPLMEA S     V ++L+    D+      +  DTAL +A  K +    E+++  G  +I+   N  G + +  A      ++V+L +    + D      A   + +P      +GH+++ + L +    +  +S  ++ I     +E+      C ++I
Sbjct:  952 LIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGA-HIDVR-NKKGNTPLWLAANGGHLDVVQLLVNSGADVDA-----ADNRKITPLMAAFRKGHVKVVRYLVKEVNQFPSDSECMRYIATITDKELLKKCHQCMEII 1291          

HSP 2 Score: 106.686 bits (265), Expect = 3.123e-24
Identity = 82/300 (27.33%), Postives = 128/300 (42.67%), Query Frame = 3
Query:  441 FKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQ-------------------------------DITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFN-NFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSP 1244
              G+  +   L++SG  VN    + F  PL  AA    +  + LLI  G  ++  +  G TPL  AA +G   ++ LLL  GAN ++Q                               ++   TPLM+A + G +  VK LL  G NV+      DTAL YA   G  D+  +LL+  A ++ +++ G TPLM+A        VQ LI    D+ +       T L +A    ++ +VE+LL  G    + N     G + + +A       +V       Y  DYP   L++   ++P
Sbjct:  309 MDGHVEVARLLLESGAQVNMPADS-FESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGA---DPNHRLKDGSTMLIEAAKGGHTSVV------CYLIDYPHNLLSASPPEAP 598          

HSP 3 Score: 91.6633 bits (226), Expect = 1.431e-19
Identity = 70/241 (29.05%), Postives = 110/241 (45.64%), Query Frame = 3
Query:  573 LINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNK-TPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L+  G  +      G + L  A   G   L  +LL   AN + + +    TPLM A   G +  V+ LL  G +VN +    +TAL YA   G  D++ +LL+  A ++  N+ G TPLMEA S     V ++L+     +        ++AL +A  K ++ +V  LL+AG    E+  +    + + +A      E+ RL L      + PA        +SP  L    GH+ELA +L
Sbjct:  119 LLGEGRSVHETTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQ-EHKTDEMHTALM-EACMDGHVEVARLLLESGAQVNMPADSF-----ESPLTLAACGGHVELAALL 352          

HSP 4 Score: 89.7373 bits (221), Expect = 6.195e-19
Identity = 78/332 (23.49%), Postives = 138/332 (41.57%), Query Frame = 3
Query:  399 RSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGAN--------------------------------SDSQDITNK--TPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            R    D+ P+   +  G+  I+  L+  G DVN  ++T     L +A     +   ++L+ AG  ++  +  G+TPL  AA  G   +  LLL+ GA                                 +D +  T++  T LM+A   G +   + LL  G  VN+   + ++ L  AA  G  +L  +L++  A ++  N  G TPLMEA     + +V +L+    ++  +   T +TAL +A    ++ + + L+KAG      +      + + +A      ELV+  L    N         + T  +      E GH ++A +L
Sbjct:  162 RGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSST-GNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGA-----DLELGCSTPLMEAAQEGHLELVKYLLAAGANV-----HATTATGDTALTYACENGHTDVADLL 482          

HSP 5 Score: 83.1889 bits (204), Expect = 8.203e-17
Identity = 79/331 (23.87%), Postives = 146/331 (44.11%), Query Frame = 3
Query:  303 FYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNV-KDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
              +A  + D++ +RK++   +        E        LC   L    GY+ +   L+    +V          PL  AA    +   +LL+  G  ++A+ + GNT L YA   G  +++ +LL+ GAN +  + +  TPLM+A   G +   + LL  G  +N   ++ +++AL  A  +G  +++  LL+  A  + +     T LMEA       V ++L+ S   +      + ++ L +A    +V L  +L++ G    E   N+ G + + +A      E+V L L    N +   ++    T+++   L    G LE+A  L
Sbjct:  104 LAEACSDGDVNAVRKLLGEGR-----SVHETTEEGESLLC---LACSAGYYELAQVLLAMHANVEDRGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQV-NMPADSFESPLTLAACGGHVELAALLIERGANLEE--VNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEE----TQETALTLACCGGFLEVADFL 419          

HSP 6 Score: 77.7962 bits (190), Expect = 3.640e-15
Identity = 73/284 (25.70%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  618 NTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVK-DKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKR-DYRTGDTALHVAVRKNYVHLVEMLLKAGK---WYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKRIEFQELEEVKSLRQWCRKVIRRQLGFHIYEKLQKINLP 1454
            +T L  A   G  +L+T+L+  GAN + +D    TPL+ A  +G +  V+ LL  G ++  + ++ +DT L  A   G  +++ +L+   A  + +N    TPL  A S    ++++IL+ +  ++  R   + G + L +A    +   V++LL  G      IE N N    + +  A +  R E+V L +    N ++ AK     T  +P       G+ E+ +VL       +       R     +   K   ++C  VI R  G HI  + +K N P
Sbjct:  934 DTALTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRN----TALTLACFQGRHEVVSLLVERKANVEHRAK-----TGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISR--GAHIDVRNKKGNTP 1206          

HSP 7 Score: 63.929 bits (154), Expect = 6.829e-11
Identity = 53/197 (26.90%), Postives = 87/197 (44.16%), Query Frame = 3
Query:  804 DKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGE-SFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL----SRVCCYWSKNSNTVKRIE-FQELEEVKSL 1376
            + N DTAL  A   G  DL+ +L+   A I+ +++ G TPL+ A +    +VV++L+ +  D+  +  RT DT L +A       +VE+L+  G      N +++   S      + N   ++++ L      +    +  S    SP  L    GH    K+L    S +      N NT   +  FQ   EV SL
Sbjct:  930 ESNHDTALTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVN---IIKILLNAGAEIN---SRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSL 1120          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 70.8626 bits (172), Expect = 2.839e-13
Identity = 58/197 (29.44%), Postives = 92/197 (46.70%), Query Frame = 3
Query:  528 LHHAAMSHQLSCSQLLINAGGQIDAK-DTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAV---------KRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVH-LVEMLLKAG 1085
            LH A+++++LS    L++ G  ++A+      TPLH+AA  G   ++  LL++GA+    D      L  +  S  I  V         K LL + C    +D    T+L +AA QG +  +  LLK+ A I   +  G TPL       Q  V++ LI+   D +++   TG     +A   N V+ L E L  +G
Sbjct:  113 LHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDC----RDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKT-DTGKDCFAIAQEMNTVYSLREALTHSG 304          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 55.8398 bits (133), Expect = 1.289e-8
Identity = 54/199 (27.14%), Postives = 93/199 (46.73%), Query Frame = 3
Query:  447 GYFSILHYLIQSG-VDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQID-AKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCN------VNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGD 1019
            G   ++  +++SG VD+N          LH A ++++ S ++ L+  G   + A    G T LH+AA  G   ++ LLL++GA+   +D      +  +  S  I  V  +L    N      ++ KD N  T L +AA QG    + +LLK+ + +   +  G   L  A+    Q V+  LI S  + Y+R+ +  D
Sbjct:   61 GDLKVVKDVVESGAVDINNDRIDELSG-LHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERNNQKQD 258          

HSP 2 Score: 51.9878 bits (123), Expect = 1.861e-7
Identity = 53/208 (25.48%), Postives = 83/208 (39.90%), Query Frame = 3
Query:  300 LFYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANS------DSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQN 905
            +F +A  + D+  ++ +VE    D+N            +L  +H       FS+  +L+  G + NQ+        LH AA    +    LL+  G     KD  G   +H++       L+  +L    N+      DS+D  N+TPL+ A   G    V+ LL  G  V   D     ALH A   G   +I  L+   A    +N
Sbjct:   53 IFIEAAKDGDLKVVKDVVESGAVDIN-------NDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERN 253          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 52.7582 bits (125), Expect = 7.086e-8
Identity = 38/126 (30.16%), Postives = 57/126 (45.24%), Query Frame = 3
Query:  342 RKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNK 719
            R ++ +Y   L     E+ ++   + C VHL   KG+   LH L+Q             R P+H A M+    C  LLI  G  +   DT G+TPLH   E G  + + +LL  G  S   ++ +K
Sbjct:   52 RYLICVYLIQLGHDKHELIKTFKGNTC-VHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDK 176          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 50.447 bits (119), Expect = 1.693e-7
Identity = 56/224 (25.00%), Postives = 92/224 (41.07%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQI---DAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNK--TPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYD-ARIDAQNQWGLTPLMEAVSYSQQSVVQILIR---SKCDLY-KRDYRTGDTALHVAVRKNYVHLV 1064
            P+H    +  F  +  L+ S   +        R PLH +        +  L++    +   D  D  G TP H A   G   ++  L       D   ITN+  T L  A         + L+  G +V +KDK     LH AA  GS  LI +L     + ++ Q++ G TPL  A++        +L+    ++ DL   +  +  D AL+  V+K +++ V
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV 228          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 48.521 bits (114), Expect = 2.514e-6
Identity = 55/227 (24.23%), Postives = 105/227 (46.26%), Query Frame = 3
Query:  420 CPVHLVSFKGYFSILHYLIQSGV--DVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQ---------ID-AKDTFGNT-----PLHYAAEDGENNLLTLLLQNGANSDSQDITNKT------PLMKATRSG--------RIGA----VKRLLGVGCNVNVKDK-NEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDL 992
             P+H  +  G    +H L+ + +  DV+   +   + PL  A  ++ +   + L+  GG          +D +K+   +T     PL+ A +   ++   LLL+  +  ++ +  NK+      PL K   +G        +IG     ++ L+  G + N  D  N+ T + YA R G +++I  LLK++AR+D ++  G +PL  A+  S   V+  L++   +L
Sbjct:  426 VPLHYAAELGKLEFVHSLLITNLLEDVDPIDSD-SKTPLVLAITNNHIDVVRDLLTIGGANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNL 651          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Nematostella
Match: EDO49485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG84])

HSP 1 Score: 98.2117 bits (243), Expect = 2.713e-23
Identity = 76/228 (33.33%), Postives = 106/228 (46.49%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSG-RIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWG---LTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWY 1094
            P+HL    G+      L+  GVDVN       R PLH AA S  ++C +LL++  G  +  D  G  PLHYAA       +  L+  G+N +  D    TPL  A  S      V+ LL    N + +DK   +A+HYA+  G    I MLL   A        G   +TPL  A  +  +  +++LI+S  DL  RD R G T L +A  + +V  VE LL     +
Sbjct:    3 PLHLACLGGFTECCKKLLFYGVDVNAKDNN-DRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDR-GRTPLDLASFQGHVECVECLLNHNAMF 228          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 76.2554 bits (186), Expect = 7.428e-16
Identity = 65/216 (30.09%), Postives = 93/216 (43.06%), Query Frame = 3
Query:  453 FSILHY------------LIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIG--------------------AVKRLLGV------GCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQ--NQWGLTPLMEAVSYSQQSVVQILIRS 980
            FS LH+            LI++G   + ST      PLH A     +   +LL+  G  +D K+  G TPLH AA  G  + L  LL  G   D +D +++TP + A  +GR                      A  R L V      G + N +D+   +ALH AA  G   ++  LL+Y A I+A+  N+W  TPLM A           L++S
Sbjct:    9 FSALHHATRYNRVEAMAELIRNGSIEDLST------PLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEKDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRW--TPLMCAAKTGSVKTCMELLQS 216          

HSP 2 Score: 61.6178 bits (148), Expect = 7.571e-11
Identity = 58/198 (29.29%), Postives = 92/198 (46.46%), Query Frame = 3
Query:  492 VNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            +N+   T F   LHHA   +++     LI  G   D      +TPLH A + G   +  LL++ GA  D ++   +TPL  A   G   A+K LL  G  ++ +D +  T    A   G  +  ++LL+ D     +NQ   +PL  A +  +   V+ L R+     +RD   G +ALH+A    +  +V  LL+ G
Sbjct:    1 LNKMDDTGF-SALHHATRYNRVEAMAELIRNGSIEDL-----STPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEKD-----ENQK--SPLHLACAAGRALHVEALTRAGLSTNERD-EEGQSALHMAALSGFRKVVTQLLRYG 184          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Nematostella
Match: EDO39112 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB40])

HSP 1 Score: 78.9518 bits (193), Expect = 1.920e-15
Identity = 64/225 (28.44%), Postives = 112/225 (49.78%), Query Frame = 3
Query:  426 VHLVSFKGYFSILHYLIQSG-VDVNQSTTTLFRQPLHHAAMSHQLS-CSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQ-NGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKW 1091
            +H+ +    F  +  ++++G   +  S  +  + PLH+A +  Q     QLLI +G  + A D     PLH+AAE G  + +++LLQ N    +  D  + T L  A  + R  A + LL  G  V+ +D    T L Y A  G    + +LL+YDA ++A+++   TPL+ A  + +  V + L+ S  D+   +  +G  AL VA+  N + +   +++   W
Sbjct:    7 LHVAAACSDFRTVEIILRNGGKSIINSKDSYGKTPLHYAVIRCQGGKIIQLLIESGANVLAVDFDERLPLHHAAEQGMLDNISILLQANPETINEVDNRSLTALHIAAAAARTEACRLLLEKGAEVDYRDDERLTPLFYVASVGCPLTVKVLLEYDADLEARDKNRKTPLISAAYFGRLEVFRTLLDSGADIAA-ETSSGWNALDVALDNNNLDITNEIIRHESW 230          

HSP 2 Score: 55.0694 bits (131), Expect = 5.107e-8
Identity = 38/155 (24.52%), Postives = 74/155 (47.74%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDA 887
            P+H  + +G    +  L+Q+  +            LH AA + +    +LL+  G ++D +D    TPL Y A  G    + +LL+  A+ +++D   KTPL+ A   GR+   + LL  G ++  +  +   AL  A    + D+   ++++++
Sbjct:   75 PLHHAAEQGMLDNISILLQANPETINEVDNRSLTALHIAAAAARTEACRLLLEKGAEVDYRDDERLTPLFYVASVGCPLTVKVLLEYDADLEARDKNRKTPLISAAYFGRLEVFRTLLDSGADIAAETSSGWNALDVALDNNNLDITNEIIRHES 229          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 72.4034 bits (176), Expect = 9.541e-15
Identity = 45/155 (29.03%), Postives = 81/155 (52.26%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQ--PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNG-ANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLK 878
            P+H  +   +  I+  L+ +G DV+   +   ++  P+  AA  + +   ++L+ AG  ++  + +G T LH+A   G + ++ LLL++G  + +  D  N T L  A   G    +K LL  G N+  KD +  TA H AAR+G  +++  LL+
Sbjct:   32 PLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLR 186          

HSP 2 Score: 67.0106 bits (162), Expect = 7.231e-13
Identity = 50/157 (31.85%), Postives = 81/157 (51.59%), Query Frame = 3
Query:  522 QPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGN---TPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVG-CNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRS 980
             PLH+A  ++ +   Q+L++AG  +D + +       P+  AA+        +LL+ GA+ +  +   +T L  ATR G    V+ LL  G  +VNV D++  T+LH AA  GS  +I  LL   A I A++  G T    A    ++ V+Q L+R+
Sbjct:   31 SPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLRT 187          

HSP 3 Score: 66.6254 bits (161), Expect = 8.264e-13
Identity = 47/165 (28.48%), Postives = 85/165 (51.52%), Query Frame = 3
Query:  606 DTFGNTPLHYAAEDGENNLLTLLLQNGANSD---SQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQ--NQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            D  G +PLHYA      +++ +LL  GA+ D   S  I    P++ A +   I + + LL  G +VN+ +    TALH+A R+G + ++ +LL+ D ++D    ++   T L  A       +++ L+    ++  +D   G TA H+A R+    +++ LL+ G
Sbjct:   26 DADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLR-DGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKD-NDGFTAFHLAAREGEEEVLQTLLRTG 188          

HSP 4 Score: 57.7658 bits (138), Expect = 9.434e-10
Identity = 38/126 (30.16%), Postives = 66/126 (52.38%), Query Frame = 3
Query:  732 KATRSGRIGAVKRLL-GVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWG---LTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYI 1097
            +A R GR   V++LL G   N+N  D +  + LHYA      D++ MLL   A +D +       + P++ A  ++     ++L+R+  D+   +   G TALH A R+ +  +VE+LL+ G+  +
Sbjct:    1 QACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCY-GQTALHHATRRGHSKMVELLLRDGQMDV 125          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 73.559 bits (179), Expect = 2.067e-14
Identity = 58/244 (23.77%), Postives = 107/244 (43.85%), Query Frame = 3
Query:  288 SPALLFYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQN-GANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTG 1016
            +  ++F  A+ + D+D+++K++        AK  ++   N   L  +H       F ++  L+  G  ++      +   LH AA    +  ++ LI  G  + A +  G  PL  A E+   +LLT  ++N G + D      +  ++   +S         L   C    KDK E +ALH A+ +G   +I +LL+    I+A++    TPL  A  + Q+   ++L  +  D   R+   G
Sbjct:   48 NSGIVFLSAVSSGDVDEVKKLL--------AKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWT-SLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQS--------WLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNKMVG 274          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 135.191 bits (339), Expect = 8.473e-33
Identity = 93/293 (31.74%), Postives = 143/293 (48.81%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNF-GESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +F G+ +I+  L+Q G   N S   +   PLH A+ +     +Q L+    Q+DA+     TPLH AA  G   L+ LLL + AN DS      TPL  A R G I  ++ LL  G       K   T LH A++ G  D+  +LL+  A  +A  + GLTPL  AV ++   VV++L+ SK        R G T LH+A ++N + +  +LL+ G      N  +  G + +H A    R ++V + +    N +     L +    +P  LV + GH+ +A  L
Sbjct:  403 LTPLHVAAFMGHLNIVKNLLQRGASPNASNVKV-ETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV-SKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGA---SPNCESLQGITPLHLASQEGRPDMVAMLISKQANVN-----LGNKNGLTPLHLVAQEGHVGIADTL 685          

HSP 2 Score: 113.235 bits (282), Expect = 1.188e-25
Identity = 73/235 (31.06%), Postives = 118/235 (50.21%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNN 1115
            K   P+H+ S  G   +   L++ G + N +       PLH A   + L   +LL++ GG   +    G TPLH AA+  +  + ++LLQNGA+ + + +   TPL  A++ GR   V  L+    NVN+ +KN  T LH  A++G   +   L+K  A + A ++ G TPL  A  Y    +V+ L++ +  +  +  R G T LH A ++ +  +V +LLK G    E   N 
Sbjct:  533 KGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGL-TPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAK-TRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNG 765          

HSP 3 Score: 112.849 bits (281), Expect = 1.550e-25
Identity = 85/295 (28.81%), Postives = 141/295 (47.80%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGE---SFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ +  G+  +   L+  G   N      F  PLH A   + +    LL+     ++A    G TPLH AA  G  N++  LLQ GA+ ++ ++  +TPL  A+R+G     + LL     V+ + K++ T LH AAR G  +L+ +LL + A  D+    G TPL  A        ++IL+ +     K   + G T LHVA +   V + E+LL+ G      N N  G+   + +H AV +N  ++V+L +    +    A+        +P  +  ++  +E+A VL
Sbjct:  337 LTPLHVAAHCGHHRMAKVLLDKGAKANARALNGF-TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKM-TKKGFTPLHVASKYGKVDVAELLLERGA-----NPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARN-----GYTPLHIAAKQNQIEVASVL 619          

HSP 4 Score: 103.605 bits (257), Expect = 1.346e-22
Identity = 84/287 (29.27%), Postives = 124/287 (43.21%), Query Frame = 3
Query:  525 PLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK---------------------AGKWYIEYNFNNFG----------ESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            PLH AA    +S +QLL+N G  ++     G TPLH A+  G   ++ LLL  GA  D+Q     TPL  A R+G +  ++ LL  G  +  K KN  + +H AA+    D +  LL+Y+A ID      LTPL  A       + ++L+        R    G T LH+A +KN++  +++LLK                      G   I  N    G          E+ +H A     CE+ +  L +    D  AK      +++P       GH EL K+L
Sbjct:  207 PLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARAL-NGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKD-----DQTPLHCAARMGHKELVKLL 487          

HSP 5 Score: 103.219 bits (256), Expect = 1.634e-22
Identity = 80/326 (24.54%), Postives = 142/326 (43.56%), Query Frame = 3
Query:  414 DLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRS---------------------------------GRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +L P+H  +  G+  I+  L++ G  + Q+ T     P+H AA    + C + L+    +ID       TPLH AA  G + +  +LL  GA ++++ +   TPL  A +                                  G +  VK LL  G + N  +   +T LH A+R G  ++   LL+  A++DA+ +   TPL  A     + +V++L+  K +        G T LH+A R+ ++H + +LL AG   ++     F  + +H A  Y + ++  L L    N +   K        +P  + +   +L++ K+L
Sbjct:  270 ELTPLHCAARNGHVRIIEILLEHGAPI-QAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKAN-PDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGF--TPLHVASKYGKVDVAELLLERGANPNAAGKN-----GLTPLHVAVHHNNLDVVKLL 586          

HSP 6 Score: 99.7525 bits (247), Expect = 2.092e-21
Identity = 92/329 (27.96%), Postives = 143/329 (43.47%), Query Frame = 3
Query:  402 SNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDL------------------------------YKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            +N   L  +HL S +G+  ++  L+ SG+++ ++TT      LH AA++ Q      L+N G  ++A+   G +PL+ AA++    ++  LL+NGAN         TPL  A + G    V  L+    N   K K    ALH AAR        +LL+ D   D  ++ G TPL  A  Y   SV Q+L+    ++                               + D +T D  T LH A R  +V ++E+LL+ G   I+    N G S +H A   +  + VR  L +N   D       +    +P  +    GH  +AKVL
Sbjct:   39 ANQNGLNGLHLASKEGHVKMVLELLHSGIEL-EATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGA-PIQAKTKN-GLSPIHMAAQGDHMDCVRQLLQYNAEIDD-----ITLDHLTPLHVAAHCGHHRMAKVL 355          

HSP 7 Score: 92.4337 bits (228), Expect = 4.627e-19
Identity = 90/346 (26.01%), Postives = 150/346 (43.35%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVD---------------------------VNQSTTTLFRQP-LHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGD--TALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAK-VLSRVCCYWSKNSNTVK 1337
            V   +HK   P+++ + + +  ++ +L+++G +                           +N  T    R P LH AA +     + +L+      D     G TPLH AA     ++  LLL  GAN +       TPL  A+R G +  V+ LL  G  ++ + K+E T LH AAR G   +I +LL++ A I A+ + GL+P+  A        V+ L++   ++   D  T D  T LHVA    +  + ++LL  G        N F  + +H A   N    + L L H+ + +       + +  +P  +    GHL + K +L R     S N++ VK
Sbjct:  102 VNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGF--TPLHIACKKNHMRSMDLLLKHSASLEA-----VTESGLTPLHVAAFMGHLNIVKNLLQRGA---SPNASNVK 434          

HSP 8 Score: 75.485 bits (184), Expect = 8.937e-14
Identity = 54/183 (29.51%), Postives = 87/183 (47.54%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
            P+H+ + +    +   L+Q+G   N  +      PLH A+   +     +LI+    ++  +  G TPLH  A++G   +   L++ GA+  +      TPL  A   G I  VK LL    +VN K +   T LH AA+QG  D++ +LLK+ A  +     G +PL  A      SV+ +L
Sbjct:  603 PLHIAAKQNQIEVASVLLQNGASPNCESLQGI-TPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVL 784          

HSP 9 Score: 55.0694 bits (131), Expect = 1.754e-7
Identity = 38/137 (27.74%), Postives = 67/137 (48.91%), Query Frame = 3
Query:  675 LQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            ++NG N +  +      L  A++ G +  V  LL  G  +    K  +TALH AA  G   ++  L+ Y A ++AQ+  G +PL  A   +   VV+ L+ +  +        G T L VA+++ + ++V +L+  G
Sbjct:   30 IKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGAN-QSLPTEDGFTPLAVALQQGHENVVALLINYG 165          

HSP 10 Score: 53.5286 bits (127), Expect = 5.562e-7
Identity = 32/122 (26.23%), Postives = 66/122 (54.10%), Query Frame = 3
Query:  720 TPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            T  ++A RSG +      +  G N+N+ ++N    LH A+++G   +++ LL     ++A  + G T L  A    Q+ VV  L+    ++  + ++ G + L++A ++N++ +V+ LL+ G
Sbjct:   12 TSFLRAARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHK-GFSPLYMAAQENHLEVVKFLLENG 132          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 134.035 bits (336), Expect = 1.980e-32
Identity = 92/292 (31.51%), Postives = 143/292 (48.97%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H+ SF G+ +I+  L+Q G   + S   +   PLH A+ S     ++ L+     +DAK     TPLH AA  G   L+ LLL++ AN +S      +PL  A R G +  V+ LL +        K   T LH A++ G  D+  +LL+  A  +A  + GLTPL  AV ++   VV +L+ SK        R G TALH+A ++N V +   LL+ G      +    G + +H A    R ++V L +    N +     L + +  +P  LV + GH+ +A +L
Sbjct:  343 LTPLHVASFMGHLNIVKILLQKGASPSASNVKV-ETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLV-SKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQ--GVTPLHLASQEGRPDIVSLLISKQANVN-----LGNKSGLTPLHLVAQEGHVGIADIL 625          

HSP 2 Score: 110.153 bits (274), Expect = 1.080e-24
Identity = 80/258 (31.01%), Postives = 127/258 (49.22%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGE---SFVHDAVWYNRCELVRLFL 1181
            L P+H+ +  G+  +   L+  G   N      F  PLH A   + L    LL+     I+A    G TPLH A+  G  N++ +LLQ GA+  + ++  +TPL  A+RSG     + LL     V+ K K++ T LH AAR G  +L+ +LL++ A  ++    G +PL  A        V++L+  +    K   + G T LHVA +   V + E+LL+ G      N N  G+   + +H AV +N  ++V L +
Sbjct:  277 LTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGF-TPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKM-TKKGFTPLHVASKYGKVDVAELLLERGA-----NPNAAGKNGLTPLHVAVHHNNLDVVNLLV 527          

HSP 3 Score: 95.9005 bits (237), Expect = 3.604e-20
Identity = 80/292 (27.40%), Postives = 131/292 (44.86%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
              P+H+ +     ++   L+  G   N   T     PLH AA +      ++L++ G  I AK   G +P+H AA+    + +  LLQ  A  D   + + TPL  A   G     K LL  G   N +  N  T LH A ++    ++ +LLK+ A I+A  + GLTPL  A      ++V+IL++        + +  +T LH+A R  +  + E LL+          ++  ++ +H A      ELV+L L H  N   P     +G   SP  +    GH++  ++L
Sbjct:  184 FTPLHIAAHYENLNVAQLLLNRGA--NDELT-----PLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKV-ETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDD--QTPLHCAARMGHKELVKLLLEHKAN---PNSTTTAG--HSPLHIAAREGHVQTVRLL 460          

HSP 4 Score: 93.2041 bits (230), Expect = 2.400e-19
Identity = 76/305 (24.92%), Postives = 128/305 (41.97%), Query Frame = 3
Query:  399 RSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRS---------------------------------GRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAK 1214
            R  + +L P+H  +  G+F I+  L+ +G  + Q+ T     P+H AA    + C + L+    +ID       TPLH AA  G + +  +LL  GA  +S+ +   TPL  A +                                  G +  VK LL  G + +  +   +T LH A+R G  ++   LL+  A +DA+ +   TPL  A     + +V++L+  K +        G + LH+A R+ +V  V +LL       +     F  + +H A  Y + ++  L L    N +   K
Sbjct:  205 RGANDELTPLHCAARNGHFRIIEILLDNGAPI-QAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKAN-PNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGF--TPLHVASKYGKVDVAELLLERGANPNAAGK 505          

HSP 5 Score: 89.7373 bits (221), Expect = 3.281e-18
Identity = 57/194 (29.38%), Postives = 98/194 (50.52%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDL 992
            K   P+H+ S  G   +   L++ G + N +       PLH A   + L    LL++ GG   +    G T LH AA+  +  +   LLQ+GA+++++ +   TPL  A++ GR   V  L+    NVN+ +K+  T LH  A++G   +  +L+K  A + A  + G TPL  A  Y    +V+ L++ + ++
Sbjct:  473 KGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGL-TPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANV 665          

HSP 6 Score: 81.2629 bits (199), Expect = 1.475e-15
Identity = 77/284 (27.11%), Postives = 125/284 (44.01%), Query Frame = 3
Query:  474 IQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDA----RIDAQNQW-------GLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            I++G+D+N +        LH A+    +     L++ G  ++     GNT LH AA  G+  ++T L+  G N ++Q     TPL  A +   +  VK LL  G N ++  ++  T L  A +QG  +++ +L+ Y      R+ A   +       G TPL  A  Y   +V Q+L+        R      T LH A R  +  ++E+LL  G   I+    N G S +H A   +  + V+  L +N   D       +    +P  +    GH  +AKVL
Sbjct:   27 IKNGIDINTANQNGLNA-LHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLL-------NRGANDELTPLHCAARNGHFRIIEILLDNGA-PIQAKTKN-GLSPIHMAAQGDHMDCVKQLLQYNAEIDD-----ITLDHLTPLHVAAHCGHHRMAKVL 295          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 114.775 bits (286), Expect = 4.319e-26
Identity = 84/295 (28.47%), Postives = 140/295 (47.46%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            L P+H+ +F G+ +I+  L+Q+G   + S        LH AA + Q    + L+  G  +DA+     TPLH A+  G+  ++ LLLQ+ A+ D+      TPL  + R G++     LL  G + ++  K   T LH  ++ GS D+  +LL+  A  D+  + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +KN + +  +LL+ G    E N     G + +H A      ++  L +      + P K   SG   +   L  +   + +A++L R
Sbjct:  425 LTPIHVAAFMGHLNIVLLLLQNGASPDVSNIR-GETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHT-TAKNGYTPLHIAAKKNQMDIATVLLQYGA---ETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTK---SGL--TALHLAAQEDRVAVAEILVR 709          

HSP 2 Score: 103.99 bits (258), Expect = 9.728e-23
Identity = 78/292 (26.71%), Postives = 138/292 (47.26%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L  +H+ +  G++ +   L+    + N      F  PLH A   +++   +LL+  G  I A    G TP+H AA  G  N++ LLLQNGA+ D  +I  +T L  A R+G+   V+ LL  G  V+ + + + T LH A+R G  +++ +LL++ A  DA    G TPL  +    Q     +L+ +    +    + G T LHV  +   + + ++LL+  +     +    G + +H A  Y+  ++  L L    +    AK        +P  +  ++  +++A VL
Sbjct:  359 LTALHVAAHCGHYRVTKLLLDKRANPNARALNGF-TPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGAS-HSLATKKGFTPLHVVSKYGSLDVAKLLLQ--RQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKN-----GYTPLHIAAKKNQMDIATVL 641          

HSP 3 Score: 99.3673 bits (246), Expect = 3.217e-21
Identity = 72/258 (27.91%), Postives = 118/258 (45.74%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLT-----------------------------LLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK 1079
            V  S  K    +H+ S  G   ++  L++ G D+N  +   F  PL+ AA  + L   + L+  GG        G TPL  A + G N +++                             LLLQN  N+D Q  +  TPL  A   G +     LL  G  V+   +N  T LH A+++G+ +++ +LL   ++IDA+ + GLTPL  A     ++ V++L+     L  R  + G + LH+A + ++V  V+ LL+
Sbjct:   91 VDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGF-TPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLAR-TKNGLSPLHMAAQGDHVECVKHLLQ 346          

HSP 4 Score: 98.5969 bits (244), Expect = 5.445e-21
Identity = 66/225 (29.33%), Postives = 110/225 (48.89%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            K   P+H+VS  G   +   L+Q     + +       PLH AA       + LL++ G         G TPLH AA+  + ++ T+LLQ GA +++      TPL  A++ G       L+  G  +NV  K+  TALH AA++    +  +L++  A +D Q + G TPL+ A  Y    +V  L+++   +  +  + G T LH A ++   H++ +LL+ G
Sbjct:  555 KGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGL-TPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAK-TKNGYTPLHQAAQQGNTHIINVLLQHG 777          

HSP 5 Score: 94.3597 bits (233), Expect = 1.271e-19
Identity = 76/262 (29.01%), Postives = 125/262 (47.71%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFD 1202
            L  +H+ + K        L+Q+  + +  + + F  PLH AA    ++ + LL+N G  +D     G TPLH A++ G  N++ LLL  G+  D++     TPL  A RSG   +V+ LL  G  +  + KN  + LH AA+    + +  LL++ A +D      LT L  A       V ++L+  + +   R    G T LH+A +KN V ++E+L+K G           G + +H A +     +V L L +  + D
Sbjct:  194 LPALHIAARKDDTKSAALLLQNDHNADVQSKSGF-TPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARAL-NGFTPLHIACKKNRVKVMELLVKYGASI--QAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPD 451          

HSP 6 Score: 89.3521 bits (220), Expect = 4.983e-18
Identity = 65/183 (35.52%), Postives = 92/183 (50.27%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
            P+H+ + K    I   L+Q G + N + T     PLH A+       + LL++ G QI+     G T LH AA++    +  +L++NGAN D Q     TPL+ A   G    V  LL  G +VN K KN  T LH AA+QG+  +I +LL++ A+ +A    G T L  A      SVV  L
Sbjct:  625 PLHIAAKKNQMDIATVLLQYGAETN-ALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 806          

HSP 7 Score: 87.0409 bits (214), Expect = 2.109e-17
Identity = 75/292 (25.68%), Postives = 130/292 (44.52%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H  +  G+ + +  L++ G  +   T      PLH AA    + C + L+     +D       T LH AA  G   +  LLL   AN +++ +   TPL  A +  R+  ++ L+  G ++    ++  T +H AA  G  +++++LL+  A  D  N  G T L  A    Q  VV+ L+R+   +  R  R   T LH+A R     +V++LL+          N +  + +H +    + E   + L    +     KK       +P  +V + G L++AK+L
Sbjct:  293 LTPLHCAARSGHEASVEVLLEKGAPLLARTKNGL-SPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDAR-AREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQLETASVLLEAGASHSLATKK-----GFTPLHVVSKYGSLDVAKLL 575          

HSP 8 Score: 75.485 bits (184), Expect = 8.979e-14
Identity = 66/240 (27.50%), Postives = 104/240 (43.33%), Query Frame = 3
Query:  459 ILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNV-----------------------------NVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDY--RTGDTALHVAVRKNYVHLVEMLLKAG 1085
            +L YL + GVD++          LH AA    +   Q L++ G  +D+    GNT LH ++  G+  ++  L++ GA+ ++Q     TPL  A +   +  V+ LL  G N                              + K K    ALH AAR+       +LL+ D   D Q++ G TPL  A  Y   +V  +L+     +   D+  R G T LHVA ++   ++V +LL  G
Sbjct:   48 VLEYL-KGGVDISTCNQNGLNA-LHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAV---DFTARNGITPLHVASKRGNTNMVRLLLDRG 282          

HSP 9 Score: 60.4622 bits (145), Expect = 4.824e-9
Identity = 60/233 (25.75%), Postives = 107/233 (45.92%), Query Frame = 3
Query:  603 KDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK---AGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            K +  NT    AA  G  + +   L+ G +  + +      L  A + G +  V+ LL  G  V+   K  +TALH ++  G A+++  L+K  A I+AQ+Q G TPL  A   +   VV+ L+ +  +        G T L +A+++ +  +V +LL+    GK  +           +H A   +  +   L L +++N D  +K   SG   +P  +    G++ +A +L
Sbjct:   28 KKSDSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGN-QSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRL---------PALHIAARKDDTKSAALLLQNDHNADVQSK---SGF--TPLHIAAHYGNVNVATLL 245          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 114.39 bits (285), Expect = 5.503e-26
Identity = 84/295 (28.47%), Postives = 140/295 (47.46%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYN-FNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSR 1298
            L P+H+ +F G+ +I+  L+Q+G   + S        LH AA + Q    + L+  G  +DA+     TPLH A+  G+  ++ LLLQ+ A+ D+      TPL  + R G++     LL  G + ++  K   T LH  ++ GS D+  +LL+  A  D+  + GLTPL  A  Y  Q V  +L+      +    + G T LH+A +KN + +  +LL+ G    E N     G + +H A      ++  L +      + P K   SG   +   L  +   + +A++L R
Sbjct:  440 LTPIHVAAFMGHLNIVLLLLQNGASPDVSNIR-GETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHT-TAKNGYTPLHIAAKKNQMDIATVLLQYGA---ETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTK---SGL--TALHLAAQEDRVAVAEILVR 724          

HSP 2 Score: 103.99 bits (258), Expect = 1.183e-22
Identity = 78/292 (26.71%), Postives = 138/292 (47.26%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L  +H+ +  G++ +   L+    + N      F  PLH A   +++   +LL+  G  I A    G TP+H AA  G  N++ LLLQNGA+ D  +I  +T L  A R+G+   V+ LL  G  V+ + + + T LH A+R G  +++ +LL++ A  DA    G TPL  +    Q     +L+ +    +    + G T LHV  +   + + ++LL+  +     +    G + +H A  Y+  ++  L L    +    AK        +P  +  ++  +++A VL
Sbjct:  374 LTALHVAAHCGHYRVTKLLLDKRANPNARALNGF-TPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGAS-HSLATKKGFTPLHVVSKYGSLDVAKLLLQ--RQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKN-----GYTPLHIAAKKNQMDIATVL 656          

HSP 3 Score: 98.9821 bits (245), Expect = 3.645e-21
Identity = 72/258 (27.91%), Postives = 118/258 (45.74%), Query Frame = 3
Query:  393 VRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLT-----------------------------LLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK 1079
            V  S  K    +H+ S  G   ++  L++ G D+N  +   F  PL+ AA  + L   + L+  GG        G TPL  A + G N +++                             LLLQN  N+D Q  +  TPL  A   G +     LL  G  V+   +N  T LH A+++G+ +++ +LL   ++IDA+ + GLTPL  A     ++ V++L+     L  R  + G + LH+A + ++V  V+ LL+
Sbjct:  106 VDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGF-TPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLAR-TKNGLSPLHMAAQGDHVECVKHLLQ 361          

HSP 4 Score: 98.2117 bits (243), Expect = 6.501e-21
Identity = 66/225 (29.33%), Postives = 110/225 (48.89%), Query Frame = 3
Query:  411 KDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            K   P+H+VS  G   +   L+Q     + +       PLH AA       + LL++ G         G TPLH AA+  + ++ T+LLQ GA +++      TPL  A++ G       L+  G  +NV  K+  TALH AA++    +  +L++  A +D Q + G TPL+ A  Y    +V  L+++   +  +  + G T LH A ++   H++ +LL+ G
Sbjct:  570 KGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGL-TPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAK-TKNGYTPLHQAAQQGNTHIINVLLQHG 792          

HSP 5 Score: 93.9745 bits (232), Expect = 1.464e-19
Identity = 76/262 (29.01%), Postives = 125/262 (47.71%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFD 1202
            L  +H+ + K        L+Q+  + +  + + F  PLH AA    ++ + LL+N G  +D     G TPLH A++ G  N++ LLL  G+  D++     TPL  A RSG   +V+ LL  G  +  + KN  + LH AA+    + +  LL++ A +D      LT L  A       V ++L+  + +   R    G T LH+A +KN V ++E+L+K G           G + +H A +     +V L L +  + D
Sbjct:  209 LPALHIAARKDDTKSAALLLQNDHNADVQSKSGF-TPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARAL-NGFTPLHIACKKNRVKVMELLVKYGASI--QAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPD 466          

HSP 6 Score: 88.9669 bits (219), Expect = 5.541e-18
Identity = 65/183 (35.52%), Postives = 92/183 (50.27%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQIL 971
            P+H+ + K    I   L+Q G + N + T     PLH A+       + LL++ G QI+     G T LH AA++    +  +L++NGAN D Q     TPL+ A   G    V  LL  G +VN K KN  T LH AA+QG+  +I +LL++ A+ +A    G T L  A      SVV  L
Sbjct:  640 PLHIAAKKNQMDIATVLLQYGAETN-ALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          

HSP 7 Score: 87.0409 bits (214), Expect = 2.470e-17
Identity = 75/292 (25.68%), Postives = 130/292 (44.52%), Query Frame = 3
Query:  417 LCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            L P+H  +  G+ + +  L++ G  +   T      PLH AA    + C + L+     +D       T LH AA  G   +  LLL   AN +++ +   TPL  A +  R+  ++ L+  G ++    ++  T +H AA  G  +++++LL+  A  D  N  G T L  A    Q  VV+ L+R+   +  R  R   T LH+A R     +V++LL+          N +  + +H +    + E   + L    +     KK       +P  +V + G L++AK+L
Sbjct:  308 LTPLHCAARSGHEASVEVLLEKGAPLLARTKNGL-SPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDAR-AREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQLETASVLLEAGASHSLATKK-----GFTPLHVVSKYGSLDVAKLL 590          

HSP 8 Score: 75.485 bits (184), Expect = 1.050e-13
Identity = 66/240 (27.50%), Postives = 104/240 (43.33%), Query Frame = 3
Query:  459 ILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNV-----------------------------NVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDY--RTGDTALHVAVRKNYVHLVEMLLKAG 1085
            +L YL + GVD++          LH AA    +   Q L++ G  +D+    GNT LH ++  G+  ++  L++ GA+ ++Q     TPL  A +   +  V+ LL  G N                              + K K    ALH AAR+       +LL+ D   D Q++ G TPL  A  Y   +V  +L+     +   D+  R G T LHVA ++   ++V +LL  G
Sbjct:   63 VLEYL-KGGVDISTCNQNGLNA-LHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAV---DFTARNGITPLHVASKRGNTNMVRLLLDRG 297          

HSP 9 Score: 60.8474 bits (146), Expect = 3.578e-9
Identity = 38/124 (30.65%), Postives = 68/124 (54.84%), Query Frame = 3
Query:  714 NKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAG 1085
            + T  ++A R+G I  V   L  G +++  ++N   ALH AA++G  DL+  LL   A +D+  + G T L  +    Q  VV+ L++   D+  +  + G T L++A ++N++ +V  LL+ G
Sbjct:   47 SNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQS-QNGFTPLYMAAQENHLDVVRYLLENG 169          

HSP 10 Score: 59.3066 bits (142), Expect = 9.257e-9
Identity = 59/228 (25.88%), Postives = 105/228 (46.05%), Query Frame = 3
Query:  618 NTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK---AGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            NT    AA  G  + +   L+ G +  + +      L  A + G +  V+ LL  G  V+   K  +TALH ++  G A+++  L+K  A I+AQ+Q G TPL  A   +   VV+ L+ +  +        G T L +A+++ +  +V +LL+    GK  +           +H A   +  +   L L +++N D  +K   SG   +P  +    G++ +A +L
Sbjct:   48 NTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGN-QSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRL---------PALHIAARKDDTKSAALLLQNDHNADVQSK---SGF--TPLHIAAHYGNVNVATLL 260          
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Medaka
Match: ankrd6b (ankyrin repeat domain 6 [Source:NCBI gene;Acc:101160867])

HSP 1 Score: 110.923 bits (276), Expect = 3.588e-25
Identity = 83/256 (32.42%), Postives = 126/256 (49.22%), Query Frame = 3
Query:  432 LVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNF 1199
            + + KG    +  LI  G  V  + T   R PLH AA    L    +L+ AG  +D +D    T LH AA  G  +++  L+Q G   D QD    T L +    G   +VK L+  G NV+ K+K  +TALH A + G A    +LL    R D++N  G T L  A  Y+  ++++IL+ + C + +++   GDT LHVA   N+   V +LL+AG     +  NN G++ +  A  +N  E+  L      +F
Sbjct:   18 IAAHKGQADNVVQLINKGAKV--ALTKYGRSPLHLAAHKGHLEVVHILLKAGCDLDIEDDGEQTALHRAAVVGNTDVIGALIQEGCALDRQDKDGNTALHEVAWHGFSQSVKLLVKAGANVHAKNKAGNTALHLACQNGHAQSSKVLLLGGCRPDSKNTAGDTCLHVAARYNHVAMIRILLGAFCSVSEKNL-VGDTPLHVAAALNHKKTVRLLLEAG--ADSHVCNNAGQTALDQARDHNNPEVALLLTKAPQSF 268          

HSP 2 Score: 78.9518 bits (193), Expect = 5.314e-15
Identity = 63/219 (28.77%), Postives = 97/219 (44.29%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVN--------------------------QSTTTLFRQ------PLHHAAMSHQLSCS-QLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRS 980
            P+HL + KG+  ++H L+++G D++                          Q    L RQ       LH  A  H  S S +LL+ AG  + AK+  GNT LH A ++G      +LL  G   DS++    T L  A R   +  ++ LLG  C+V+ K+   DT LH AA       + +LL+  A     N  G T L +A  ++   V  +L ++
Sbjct:   47 PLHLAAHKGHLEVVHILLKAGCDLDIEDDGEQTALHRAAVVGNTDVIGALIQEGCALDRQDKDGNTALHEVAW-HGFSQSVKLLVKAGANVHAKNKAGNTALHLACQNGHAQSSKVLLLGGCRPDSKNTAGDTCLHVAARYNHVAMIRILLGAFCSVSEKNLVGDTPLHVAAALNHKKTVRLLLEAGADSHVCNNAGQTALDQARDHNNPEVALLLTKA 264          
BLAST of Ankyrin repeat-containing, putative vs. Planmine SMEST
Match: SMESG000034407.1 (SMESG000034407.1)

HSP 1 Score: 882.093 bits (2278), Expect = 0.000e+0
Identity = 421/421 (100.00%), Postives = 421/421 (100.00%), Query Frame = 3
Query:  255 MASSPCNNAPTSPALLFYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKRIEFQELEEVKSLRQWCRKVIRRQLGFHIYEKLQKINLPPALIEYIQLEDIKWGPKMSVK 1517
            MASSPCNNAPTSPALLFYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKRIEFQELEEVKSLRQWCRKVIRRQLGFHIYEKLQKINLPPALIEYIQLEDIKWGPKMSVK
Sbjct:    1 MASSPCNNAPTSPALLFYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKRIEFQELEEVKSLRQWCRKVIRRQLGFHIYEKLQKINLPPALIEYIQLEDIKWGPKMSVK 421          
BLAST of Ankyrin repeat-containing, putative vs. Planmine SMEST
Match: SMESG000032664.1 (SMESG000032664.1)

HSP 1 Score: 127.872 bits (320), Expect = 1.464e-30
Identity = 79/311 (25.40%), Postives = 154/311 (49.52%), Query Frame = 3
Query:  378 AKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK------AGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            A+F  +   +     P+H    +G    +  LI +  D+N +     +QP+H+A  +      Q+LIN    IDA+D  G  P+HYA   G   ++ +L+ N  + +++D  +K P+  A + G+   ++ L+   C++N +D+ +   +HYA + G  +L+ +L+     I+A+++  + P+  A    +  +++ILI +KCD+  RD   G   +H A+ +    +VE+L+       A  W         G+  +H A   ++ E+V++ +  N   D  A+  A    K P    ++RG+ E+ ++L
Sbjct:  791 AQFSLINERDEDGKHPIHYAIDRGNPETVQILINNKCDIN-ALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARD-EDGKQPIHYAIDRGNPEIVEILINNKCDIDARDW--------LGKQPIHYACKGDKPEIVQILI--NNKCDIDARDRAG---KQPIHYAIDRGNPEMVQIL 1086          

HSP 2 Score: 126.716 bits (317), Expect = 3.232e-30
Identity = 76/290 (26.21%), Postives = 148/290 (51.03%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            P+H     G   +L  LI +  D++       +QP+H+A         Q+LIN    I+A+D     P+HYA + G+  LL LL+ N  + +++D  +K P+  A + G+   ++ L+   C++N +D+     +HYA + G  +L+ +L+     IDA+++ G  P+  A+      +V+ILI +KCD+  RD+  G   +H A + +   +V++L+   K  I+   +  G+  +H A+     E+V++ + +  + D   ++        P    ++RG+ E+ ++L
Sbjct:  839 PIHYACKAGNPELLQILINNKCDIDARDRD-GKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDW-LGKQPIHYACKGDKPEIVQILIN-NKCDIDAR-DRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWM-----QPIHYAIDRGNPEMVQIL 1119          

HSP 3 Score: 120.553 bits (301), Expect = 3.374e-28
Identity = 80/325 (24.62%), Postives = 157/325 (48.31%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKRIEFQE--LEEVKSLRQWCR 1391
            P+H    +G   I+  LI +  D+N +   L +QP+H+A    +    Q+LIN    I+A+D  G  P+HYA + G   ++ +L+ N  +  + D   K P+  A + G+   V+ L+   C++N +D++    +HYA  +G+ +++ +L+     + A ++ G  P+  A    +  +VQILI +KCD+  RD   G   +H A+ +    +V++L+      +    +  G+  +H A    + E+V++ +  N   D  A+       K P     + G  EL ++L    C  +       R+      ++ ++++++W R
Sbjct: 1202 PIHYACERGKPEIVQILINNKCDIN-ARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARD-EDGKQPIHYAIDRGNPEMVQILINNKCDLVA--CDRLGKQPIHYACKGGKPEIVQILI--NNKCDIHARDWDG---KQPIHYACKGGKPELIQLLINNKCDINARDELYLRMASSPFIMQSIEAIQKWFR 1517          

HSP 4 Score: 120.553 bits (301), Expect = 4.107e-28
Identity = 75/290 (25.86%), Postives = 143/290 (49.31%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            P+H    +G   ++  LI +  D++ +    + QP+H+A         Q+LIN    I A+D     P+HYA +DG+  ++ +L+ N  + D+ D   K P+  +   G    V+ L+   C++N  DK+    +HYA  +G  +++ +L+     I+A+++ G  P+  A    +  +VQILI +KCD+  RD   G   +H A+ +    +V++L+      +    +  G+  +H A    + E+V++ +  N   D  A+       K P    ++RG+ E+ ++L
Sbjct: 1070 PIHYAIDRGNPEMVQILINNKCDID-ACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARD-EDGKQPIHYAIDRGNPEMVQILINNKCDLVA--CDRLGKQPIHYACKGGKPEIVQILI--NNKCDINAR---DEDGKQPIHYAIDRGNPEMVQIL 1350          

HSP 5 Score: 119.783 bits (299), Expect = 6.900e-28
Identity = 79/310 (25.48%), Postives = 153/310 (49.35%), Query Frame = 3
Query:  363 KFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            K D+NA+       +  D  P+H     G   +L  LI +  D+N +    + QP+H+A    +    ++LIN    IDA+D  G  P+HYA + G   ++ +L+ N  + D++D   K P+  A +  +   V+ L+   C+++ +D+     +HYA  +G+ +++ +L+     IDA ++  + P+  A+      +VQILI +KCD++ RD +     +H A +     +V++L+   K  I+   +  G+  +H ++     E+V++ + +  + +   K       K P     ERG  E+ ++L
Sbjct:  925 KCDINAR-------DRLDKQPIHYACKGGKPELLQLLINNKCDIN-ARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWM-QPIHYACKDGKPEIVQILIN-NKCDIDA-CDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDK-----DGKQPIHYACERGKPEIVQIL 1218          

HSP 6 Score: 114.39 bits (285), Expect = 3.169e-26
Identity = 64/238 (26.89%), Postives = 125/238 (52.52%), Query Frame = 3
Query:  363 KFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLL 1076
            K D+NA+  + ++       P+H    +G   ++  LI +  D+  +   L +QP+H+A    +    Q+LIN    I+A+D  G  P+HYA + G   ++ +L+ N  +  + D   K P+  A + G+   V+ L+   C++N +D++    +HYA  +G+ +++ +L+     + A ++ G  P+  A    +  +VQILI +KCD++ RD+  G   +H A +     L+++L+
Sbjct: 1255 KCDINARDEDGKQ-------PIHYAIDRGNPEMVQILINNKCDL-VACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDIHARDW-DGKQPIHYACKGGKPELIQLLI 1483          

HSP 7 Score: 112.079 bits (279), Expect = 2.181e-25
Identity = 70/259 (27.03%), Postives = 127/259 (49.03%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLL----------KAGKWYIEYNFNNFGESFVHDAVWYNRCELV 1169
            P+H    +G   ++  LI +  D+N +     +QP+H+A    +    Q+LIN    I+A+D  G  P+HYA + G+  ++ +L+ N  + +++D   K P+  A   G    V+ L+   C++   D+     +HYA + G  +++ +L+     I+A+++ G  P+  A+      +VQILI +KCDL   D R G   +H A +     +V++L+          + GK  I Y  +      V   +  N+C+LV
Sbjct: 1169 PIHYSMDRGNPEMVQILINNKCDIN-ALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACD-RLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILI-NNKCDLV 1424          
BLAST of Ankyrin repeat-containing, putative vs. Planmine SMEST
Match: SMESG000032664.1 (SMESG000032664.1)

HSP 1 Score: 127.872 bits (320), Expect = 1.615e-30
Identity = 79/311 (25.40%), Postives = 154/311 (49.52%), Query Frame = 3
Query:  378 AKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK------AGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            A+F  +   +     P+H    +G    +  LI +  D+N +     +QP+H+A  +      Q+LIN    IDA+D  G  P+HYA   G   ++ +L+ N  + +++D  +K P+  A + G+   ++ L+   C++N +D+ +   +HYA + G  +L+ +L+     I+A+++  + P+  A    +  +++ILI +KCD+  RD   G   +H A+ +    +VE+L+       A  W         G+  +H A   ++ E+V++ +  N   D  A+  A    K P    ++RG+ E+ ++L
Sbjct:  791 AQFSLINERDEDGKHPIHYAIDRGNPETVQILINNKCDIN-ALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARD-EDGKQPIHYAIDRGNPEIVEILINNKCDIDARDW--------LGKQPIHYACKGDKPEIVQILI--NNKCDIDARDRAG---KQPIHYAIDRGNPEMVQIL 1086          

HSP 2 Score: 126.716 bits (317), Expect = 4.080e-30
Identity = 76/290 (26.21%), Postives = 148/290 (51.03%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            P+H     G   +L  LI +  D++       +QP+H+A         Q+LIN    I+A+D     P+HYA + G+  LL LL+ N  + +++D  +K P+  A + G+   ++ L+   C++N +D+     +HYA + G  +L+ +L+     IDA+++ G  P+  A+      +V+ILI +KCD+  RD+  G   +H A + +   +V++L+   K  I+   +  G+  +H A+     E+V++ + +  + D   ++        P    ++RG+ E+ ++L
Sbjct:  839 PIHYACKAGNPELLQILINNKCDIDARDRD-GKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDW-LGKQPIHYACKGDKPEIVQILIN-NKCDIDAR-DRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWM-----QPIHYAIDRGNPEMVQIL 1119          

HSP 3 Score: 120.168 bits (300), Expect = 4.328e-28
Identity = 89/349 (25.50%), Postives = 159/349 (45.56%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLL----------KAGKWYIEYN------------FNN---------FGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVCCYWSKNSNTVKRIEFQELEEVKSL 1376
            P+H    +G   I+  LI +  D+N +   L +QP+H+A    +    Q+LIN    I+A+D  G  P+HYA + G   ++ +L+ N  +  + D   K P+  A + G+   V+ L+   C++N +D++    +HYA  +G+ +++ +L+     + A ++ G  P+  A    +  +VQILI +KCD+  RD   G   +H A+ +    +V++L+          + GK  I Y              NN          G+  +H A    + EL++L +  N   D  A+       K P    + RG+ E+ ++L    C    + N + +  F  L   K L
Sbjct: 1202 PIHYACERGKPEIVQILINNKCDIN-ARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARD-EDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLI--NNKCDINARDEDG---KQPIHYAINRGNPEMVQILINNKC----DINALDKTGFSHLNYAKGL 1539          

HSP 4 Score: 120.168 bits (300), Expect = 4.649e-28
Identity = 75/290 (25.86%), Postives = 143/290 (49.31%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            P+H    +G   ++  LI +  D++ +    + QP+H+A         Q+LIN    I A+D     P+HYA +DG+  ++ +L+ N  + D+ D   K P+  +   G    V+ L+   C++N  DK+    +HYA  +G  +++ +L+     I+A+++ G  P+  A    +  +VQILI +KCD+  RD   G   +H A+ +    +V++L+      +    +  G+  +H A    + E+V++ +  N   D  A+       K P    ++RG+ E+ ++L
Sbjct: 1070 PIHYAIDRGNPEMVQILINNKCDID-ACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARD-EDGKQPIHYAIDRGNPEMVQILINNKCDLVA--CDRLGKQPIHYACKGGKPEIVQILI--NNKCDINARDEDG---KQPIHYAIDRGNPEMVQIL 1350          

HSP 5 Score: 119.398 bits (298), Expect = 7.809e-28
Identity = 79/310 (25.48%), Postives = 153/310 (49.35%), Query Frame = 3
Query:  363 KFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            K D+NA+       +  D  P+H     G   +L  LI +  D+N +    + QP+H+A    +    ++LIN    IDA+D  G  P+HYA + G   ++ +L+ N  + D++D   K P+  A +  +   V+ L+   C+++ +D+     +HYA  +G+ +++ +L+     IDA ++  + P+  A+      +VQILI +KCD++ RD +     +H A +     +V++L+   K  I+   +  G+  +H ++     E+V++ + +  + +   K       K P     ERG  E+ ++L
Sbjct:  925 KCDINAR-------DRLDKQPIHYACKGGKPELLQLLINNKCDIN-ARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWM-QPIHYACKDGKPEIVQILIN-NKCDIDA-CDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDK-----DGKQPIHYACERGKPEIVQIL 1218          

HSP 6 Score: 115.546 bits (288), Expect = 1.608e-26
Identity = 72/278 (25.90%), Postives = 138/278 (49.64%), Query Frame = 3
Query:  363 KFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLL----------KAGKWYIEYNFNNFGESFVHDAVWYNRCEL 1166
            K D+NA+  + ++       P+H    +G   ++  LI +  D+  +   L +QP+H+A    +    Q+LIN    I+A+D  G  P+HYA + G   ++ +L+ N  +  + D   K P+  A + G+   V+ L+   C++N +D++    +HYA  +G+ +++ +L+     + A ++ G  P+  A    +  +VQILI +KCD++ RD+  G   +H A +     L+++L+          + GK  I Y  N      V   +  N+C++
Sbjct: 1255 KCDINARDEDGKQ-------PIHYAIDRGNPEMVQILINNKCDL-VACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDIHARDW-DGKQPIHYACKGGKPELIQLLINNKCDINARDEDGKQPIHYAINRGNPEMVQILI-NNKCDI 1522          

HSP 7 Score: 111.694 bits (278), Expect = 2.717e-25
Identity = 70/259 (27.03%), Postives = 127/259 (49.03%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLL----------KAGKWYIEYNFNNFGESFVHDAVWYNRCELV 1169
            P+H    +G   ++  LI +  D+N +     +QP+H+A    +    Q+LIN    I+A+D  G  P+HYA + G+  ++ +L+ N  + +++D   K P+  A   G    V+ L+   C++   D+     +HYA + G  +++ +L+     I+A+++ G  P+  A+      +VQILI +KCDL   D R G   +H A +     +V++L+          + GK  I Y  +      V   +  N+C+LV
Sbjct: 1169 PIHYSMDRGNPEMVQILINNKCDIN-ALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACD-RLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILI-NNKCDLV 1424          

HSP 8 Score: 106.301 bits (264), Expect = 1.302e-23
Identity = 64/225 (28.44%), Postives = 119/225 (52.89%), Query Frame = 3
Query:  363 KFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVA 1037
            K D+NA+  + ++       P+H    +G   ++  LI +  D+  +   L +QP+H+A    +    Q+LIN    I+A+D  G  P+HYA + G   ++ +L+ N  +  + D   K P+  A + G+   V+ L+   C+++ +D +    +HYA + G  +LI +L+     I+A+++ G  P+  A++     +VQILI +KCD+   D +TG + L+ A
Sbjct: 1321 KCDINARDEDGKQ-------PIHYAIDRGNPEMVQILINNKCDL-VACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLINNKCDINARDEDGKQPIHYAINRGNPEMVQILINNKCDINALD-KTGFSHLNYA 1536          
BLAST of Ankyrin repeat-containing, putative vs. Planmine SMEST
Match: SMESG000032664.1 (SMESG000032664.1)

HSP 1 Score: 127.872 bits (320), Expect = 1.622e-30
Identity = 79/311 (25.40%), Postives = 154/311 (49.52%), Query Frame = 3
Query:  378 AKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLK------AGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            A+F  +   +     P+H    +G    +  LI +  D+N +     +QP+H+A  +      Q+LIN    IDA+D  G  P+HYA   G   ++ +L+ N  + +++D  +K P+  A + G+   ++ L+   C++N +D+ +   +HYA + G  +L+ +L+     I+A+++  + P+  A    +  +++ILI +KCD+  RD   G   +H A+ +    +VE+L+       A  W         G+  +H A   ++ E+V++ +  N   D  A+  A    K P    ++RG+ E+ ++L
Sbjct:  791 AQFSLINERDEDGKHPIHYAIDRGNPETVQILINNKCDIN-ALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARD-EDGKQPIHYAIDRGNPEIVEILINNKCDIDARDW--------LGKQPIHYACKGDKPEIVQILI--NNKCDIDARDRAG---KQPIHYAIDRGNPEMVQIL 1086          

HSP 2 Score: 126.716 bits (317), Expect = 3.815e-30
Identity = 76/290 (26.21%), Postives = 148/290 (51.03%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            P+H     G   +L  LI +  D++       +QP+H+A         Q+LIN    I+A+D     P+HYA + G+  LL LL+ N  + +++D  +K P+  A + G+   ++ L+   C++N +D+     +HYA + G  +L+ +L+     IDA+++ G  P+  A+      +V+ILI +KCD+  RD+  G   +H A + +   +V++L+   K  I+   +  G+  +H A+     E+V++ + +  + D   ++        P    ++RG+ E+ ++L
Sbjct:  839 PIHYACKAGNPELLQILINNKCDIDARDRD-GKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDW-LGKQPIHYACKGDKPEIVQILIN-NKCDIDAR-DRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWM-----QPIHYAIDRGNPEMVQIL 1119          

HSP 3 Score: 120.168 bits (300), Expect = 4.978e-28
Identity = 75/290 (25.86%), Postives = 143/290 (49.31%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            P+H    +G   ++  LI +  D++ +    + QP+H+A         Q+LIN    I A+D     P+HYA +DG+  ++ +L+ N  + D+ D   K P+  +   G    V+ L+   C++N  DK+    +HYA  +G  +++ +L+     I+A+++ G  P+  A    +  +VQILI +KCD+  RD   G   +H A+ +    +V++L+      +    +  G+  +H A    + E+V++ +  N   D  A+       K P    ++RG+ E+ ++L
Sbjct: 1070 PIHYAIDRGNPEMVQILINNKCDID-ACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARD-EDGKQPIHYAIDRGNPEMVQILINNKCDLVA--CDRLGKQPIHYACKGGKPEIVQILI--NNKCDINARDEDG---KQPIHYAIDRGNPEMVQIL 1350          

HSP 4 Score: 119.398 bits (298), Expect = 7.378e-28
Identity = 79/310 (25.48%), Postives = 153/310 (49.35%), Query Frame = 3
Query:  363 KFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            K D+NA+       +  D  P+H     G   +L  LI +  D+N +    + QP+H+A    +    ++LIN    IDA+D  G  P+HYA + G   ++ +L+ N  + D++D   K P+  A +  +   V+ L+   C+++ +D+     +HYA  +G+ +++ +L+     IDA ++  + P+  A+      +VQILI +KCD++ RD +     +H A +     +V++L+   K  I+   +  G+  +H ++     E+V++ + +  + +   K       K P     ERG  E+ ++L
Sbjct:  925 KCDINAR-------DRLDKQPIHYACKGGKPELLQLLINNKCDIN-ARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWM-QPIHYACKDGKPEIVQILIN-NKCDIDA-CDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDK-----DGKQPIHYACERGKPEIVQIL 1218          

HSP 5 Score: 117.472 bits (293), Expect = 3.886e-27
Identity = 62/218 (28.44%), Postives = 116/218 (53.21%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLL 1076
            P+H    +G   I+  LI +  D+N +   L +QP+H+A    +    Q+LIN    I+A+D  G  P+HYA + G   ++ +L+ N  +  + D   K P+  A + G+   V+ L+   C++N +D++    +HYA  +G+ +++ +L+     + A ++ G  P+  A    +  +VQILI +KCD+  RD   G   +H A+ +    +V++L+
Sbjct: 1202 PIHYACERGKPEIVQILINNKCDIN-ARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARD-EDGKQPIHYAIDRGNPEMVQILI 1417          

HSP 6 Score: 111.694 bits (278), Expect = 2.689e-25
Identity = 70/259 (27.03%), Postives = 127/259 (49.03%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLL----------KAGKWYIEYNFNNFGESFVHDAVWYNRCELV 1169
            P+H    +G   ++  LI +  D+N +     +QP+H+A    +    Q+LIN    I+A+D  G  P+HYA + G+  ++ +L+ N  + +++D   K P+  A   G    V+ L+   C++   D+     +HYA + G  +++ +L+     I+A+++ G  P+  A+      +VQILI +KCDL   D R G   +H A +     +V++L+          + GK  I Y  +      V   +  N+C+LV
Sbjct: 1169 PIHYSMDRGNPEMVQILINNKCDIN-ALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACD-RLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILI-NNKCDLV 1424          

HSP 7 Score: 96.6709 bits (239), Expect = 1.691e-20
Identity = 55/194 (28.35%), Postives = 96/194 (49.48%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRD 1004
            P+H     G   I+  LI +  D+N       +QP+H+A         Q+LIN    + A D  G  P+HYA + G+  ++ +L+ N  + +++D   K P+  A   G    V+ L+   C++   D+     +HYA + G  +++ +L+     I+A+++ G  P+  A+      +VQILI +KCDL   D
Sbjct: 1235 PIHYACKGGKPEIVQILINNKCDINARDED-GKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACD 1427          

HSP 8 Score: 60.8474 bits (146), Expect = 2.501e-9
Identity = 35/129 (27.13%), Postives = 61/129 (47.29%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDK 809
            P+H     G   I+  LI +  D+N       +QP+H+A         Q+LIN    + A D  G  P+HYA + G+  ++ +L+ N  + +++D   K P+  A   G    V+ L+   C++   D+
Sbjct: 1301 PIHYACKGGKPEIVQILINNKCDINARDED-GKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDR 1428          
BLAST of Ankyrin repeat-containing, putative vs. Planmine SMEST
Match: SMESG000026756.1 (SMESG000026756.1)

HSP 1 Score: 126.716 bits (317), Expect = 2.711e-30
Identity = 81/301 (26.91%), Postives = 150/301 (49.83%), Query Frame = 3
Query:  390 EVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL 1292
            ++   +  D+ P+H  S  G+  +L  L+    +VN +     + P+H+AA +  +    LL+     I+A D F   P+HYA ++G  N++ LL+  G + +  D   + P+  A ++  +  VK LL   CN+   DKN    +HYA   G+ +++ +L+     +DA++  G  P+  A  Y    +V+IL+  +C++  +D  +G  A+H A  + ++++VEMLL A    I     N+    +H A     CE+V+L +  +Y  D   K++    + +P       G+ ++  VL
Sbjct:  156 QIESLDKHDMMPLHYASQNGHCGVLELLLSRVSNVN-AVDKRSQSPIHYAAQNGHVDAVSLLLKHNSAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNDHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISSQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKDSG-RAIHYACCRGHLNIVEMLL-AQSCEINAGDKNYRRP-IHHACQNGHCEIVKLLV--SYKCD---KEVRDENKLTPIHYACFYGYFDVMTVL 447          

HSP 2 Score: 102.064 bits (253), Expect = 2.253e-22
Identity = 77/310 (24.84%), Postives = 144/310 (46.45%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRV-CCYWSKNSNTVKRIEF 1349
            P+H     G   ++  L+    DV        ++P+H+A  S      +LL++    I+  D     P+HYA ++G + ++ LLL N A+ +++D  N  PL  A RSG    V+ LL   C++ V DK+    +HYA   GS  ++ ML+    +I++ ++  + PL  A       V+++L+    ++   D R+  + +H A +  +V  V +LLK     IE   + F    +H A       +VRL +    + +     +    ++ P     +  H+E+ K+L +  C   + + N ++ I +
Sbjct:    3 PIHYACQYGQLDLVKMLLMGMCDVEVFCKN-DKRPIHYACESGDYDIVKLLLSYKCNIEVCDINLMRPIHYACQNGYHKIVELLLSNQADKEAKDKNNGRPLHHACRSGHANVVELLLNYYCDIEVHDKSNLRPIHYACLSGSYQIVEMLID-RCQIESLDKHDMMPLHYASQNGHCGVLELLLSRVSNVNAVDKRS-QSPIHYAAQNGHVDAVSLLLKHNSA-IEAP-DKFDRCPIHYACQNGHLNVVRLLISEGCSIE-----ICDKDKRKPIHFACQNDHVEIVKLLLKSKCNLEASDKNGLRPIHY 302          

HSP 3 Score: 91.6633 bits (226), Expect = 4.269e-19
Identity = 74/280 (26.43%), Postives = 125/280 (44.64%), Query Frame = 3
Query:  522 QPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNF---GESFVHDAVWYNRCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVL-SRVCCYWSKNSNTVKRIEF 1349
            +P+H+A    QL   ++L+     ++        P+HYA E G+ +++ LLL    N +  DI    P+  A ++G    V+ LL    +   KDKN    LH+A R G A+++ +LL Y   I+  ++  L P+  A       +V++LI  +C +   D +     LH A +  +  ++E+LL         N N      +S +H A      + V L L HN   + P K      ++ P     + GHL + ++L S  C     + +  K I F
Sbjct:    2 RPIHYACQYGQLDLVKMLLMGMCDVEVFCKNDKRPIHYACESGDYDIVKLLLSYKCNIEVCDINLMRPIHYACQNGYHKIVELLLSNQADKEAKDKNNGRPLHHACRSGHANVVELLLNYYCDIEVHDKSNLRPIHYACLSGSYQIVEMLI-DRCQIESLD-KHDMMPLHYASQNGHCGVLELLLSRVS-----NVNAVDKRSQSPIHYAAQNGHVDAVSLLLKHNSAIEAPDK-----FDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHF 269          

HSP 4 Score: 90.1225 bits (222), Expect = 1.212e-18
Identity = 54/218 (24.77%), Postives = 108/218 (49.54%), Query Frame = 3
Query:  423 PVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEMLL 1076
            P+H      +  I+  L++S  ++  S     R P+H+A     +   +LLI++   +DA+   G+ P+H+A+  G + ++ +LL    N + QD  +   +  A   G +  V+ LL   C +N  DKN    +H+A + G  +++ +L+ Y    + +++  LTP+  A  Y    V+ +L+ +   +   D   G   +H A    ++H+V++L+
Sbjct:  266 PIHFACQNDHVEIVKLLLKSKCNLEASDKNGLR-PIHYACFHGNVEIVKLLISSQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKDSGRAIHYACCRGHLNIVEMLLAQSCEINAGDKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDG-RPIHYACFFGHLHIVKILI 481          

HSP 5 Score: 89.7373 bits (221), Expect = 1.894e-18
Identity = 63/241 (26.14%), Postives = 118/241 (48.96%), Query Frame = 3
Query:  351 VEIYKFDLNAKFPEVRRSNHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQLSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQDITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSADLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVHLVEML 1073
            VEI K  L +K   +  S+   L P+H   F G   I+  LI S   ++  + T  R P+H A+        ++L++    I+ +D      +HYA   G  N++ +LL      ++ D   + P+  A ++G    VK L+   C+  V+D+N+ T +HYA   G  D++ +LL  + +++  ++    P+  A  +    +V+ILI   C++ +   +   + L +A +K +  +VE+L
Sbjct:  276 VEIVKLLLKSKC-NLEASDKNGLRPIHYACFHGNVEIVKLLISSQCCLDAESLTGSR-PIHFASFYGHDEIVKILLSERCNIELQDKDSGRAIHYACCRGHLNIVEMLLAQSCEINAGDKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNI-EACTKENWSPLDLASQKGFSQIVELL 513          
The following BLAST results are available for this feature:
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK11.227e-2931.16ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK11.647e-2931.16ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK11.738e-2931.16ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK38.125e-2930.03ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK31.101e-2830.03ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
back to top
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-443.964e-2627.76AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-443.964e-2627.76AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.141e-2627.76AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.141e-2627.76AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.798e-2627.76AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank24.890e-2828.05gene:FBgn0261788 transcript:FBtr0303119[more]
Ank4.964e-2829.78gene:FBgn0011747 transcript:FBtr0089172[more]
Ank4.964e-2829.78gene:FBgn0011747 transcript:FBtr0300497[more]
Ank4.964e-2829.78gene:FBgn0011747 transcript:FBtr0089171[more]
Ank4.964e-2829.78gene:FBgn0011747 transcript:FBtr0089173[more]
back to top
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b8.639e-3231.51ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1a1.007e-3130.82ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b1.188e-3131.29ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b1.245e-3131.29ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b3.399e-3130.95ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK17.288e-2829.79ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK17.320e-2829.79ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK17.892e-2829.79ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK18.058e-2829.79ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK18.968e-2829.79ankyrin 1 [Source:NCBI gene;Acc:613080][more]
back to top
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank31.516e-2930.38ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank31.558e-2930.38ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank31.635e-2930.38ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank31.849e-2930.38ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank31.866e-2930.38ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of Ankyrin repeat-containing, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16157|ANK1_HUMAN8.347e-2931.16Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=... [more]
sp|G5E8K5|ANK3_MOUSE1.556e-2830.38Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|O70511|ANK3_RAT3.260e-2830.03Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
sp|Q12955|ANK3_HUMAN6.117e-2830.03Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
sp|Q4UMH6|Y381_RICFE1.798e-2731.89Putative ankyrin repeat protein RF_0381 OS=Rickett... [more]
back to top
BLAST of Ankyrin repeat-containing, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FMI30.000e+064.13Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FMN20.000e+064.13Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8I5G81.554e-17468.96ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A1I8GY032.269e-17469.16ANK_REP_REGION domain-containing protein OS=Macros... [more]
G7YRI61.895e-17053.23Putative ankyrin repeat protein RF_0381 OS=Clonorc... [more]
back to top
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b1.043e-3231.97ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ankrd52a1.958e-2830.24ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
ank3b5.820e-2729.35ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ENSAMXT00000017800.28.718e-2629.59pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
ankrd6b2.327e-2533.73ankyrin repeat domain 6b [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.15.677e-2929.11pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.11.273e-2828.77pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000007446.14.524e-2629.41pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000007449.16.659e-2629.41pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000002048.12.664e-2425.07pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 g... [more]
back to top
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AKR12.839e-1329.44Palmitoyl transferase involved in protein palmitoy... [more]
AKR21.289e-827.14Ankyrin repeat-containing protein; member of a fam... [more]
AVO27.086e-830.16Component of a complex containing the Tor2p kinase... [more]
NAS61.693e-725.00Evolutionarily conserved 19S regulatory particle a... [more]
PHO812.514e-624.23Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
back to top
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494852.713e-2333.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387257.428e-1630.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391121.920e-1528.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391139.541e-1529.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436902.067e-1423.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ankyrin repeat-containing, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b8.473e-3331.74ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ank1a1.980e-3231.51ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
ENSORLT00000039458.14.319e-2628.47ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000031565.15.503e-2628.47ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ankrd6b3.588e-2532.42ankyrin repeat domain 6 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Ankyrin repeat-containing, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034407.10.000e+0100.00SMESG000034407.1[more]
SMESG000032664.11.464e-3025.40SMESG000032664.1[more]
SMESG000032664.11.615e-3025.40SMESG000032664.1[more]
SMESG000032664.11.622e-3025.40SMESG000032664.1[more]
SMESG000026756.12.711e-3026.91SMESG000026756.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003330 ID=SMED30003330|Name=Ankyrin repeat-containing, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=1693bp
GAGAATTTGAGGATATGAAGCAATTTGTTGAATACCTTGTCCAATGGCAG
CGATTTTCTGGTATGGAAATTATTATTTCTCCTATTTCAGGATAGGAAAA
TTTCTGATTTACTTTCCATAGTTTAATTTGTTAATATTACAATGTTTTGT
TATGATATTTTCATCATCATCAATTACATTTTCATTCAATAAATATTTAA
CAATTTGTTTAATCGTTTCAAATTGAAACTTTGGTTAATTTATTTTTTAT
TTAAATGGCTTCGTCTCCATGTAACAATGCTCCAACTAGTCCAGCCTTAT
TGTTCTACGATGCCATTATTAATAATGATATTGATAAATTGCGTAAAATG
GTGGAAATATATAAATTCGATCTTAATGCCAAATTTCCTGAGGTACGGAG
ATCTAATCACAAAGATCTTTGTCCAGTTCATTTAGTTTCTTTCAAAGGGT
ATTTTTCTATTTTGCACTACCTAATTCAGTCTGGAGTCGATGTCAATCAA
TCCACGACCACCCTTTTCCGACAGCCTTTGCACCATGCTGCCATGTCTCA
TCAACTATCTTGCTCTCAGTTACTGATAAATGCCGGCGGTCAAATTGACG
CGAAAGATACATTTGGCAATACCCCTCTTCATTACGCGGCAGAAGACGGG
GAGAACAATTTATTAACTCTTCTATTGCAAAACGGGGCAAATTCGGATTC
ACAGGATATAACAAACAAAACTCCTCTGATGAAAGCTACCAGAAGTGGCC
GCATTGGTGCAGTTAAAAGACTTCTCGGTGTCGGATGCAATGTCAATGTT
AAGGATAAAAATGAAGACACTGCACTACACTACGCAGCTAGACAGGGTTC
AGCAGATTTAATTATAATGCTTTTAAAATACGATGCCAGAATAGATGCTC
AGAATCAGTGGGGTCTCACCCCCCTTATGGAGGCGGTGTCATACAGCCAG
CAATCTGTCGTTCAAATTCTCATCCGCAGCAAGTGTGATCTGTATAAGCG
AGACTATAGAACAGGGGACACTGCATTGCATGTAGCGGTGAGAAAGAATT
ATGTCCATTTAGTTGAAATGCTTTTGAAAGCTGGCAAGTGGTACATAGAA
TATAATTTCAATAACTTCGGAGAATCTTTTGTCCACGACGCTGTCTGGTA
CAATAGATGTGAACTCGTTCGTCTGTTCCTGATGCATAATTATAATTTCG
ATTATCCCGCCAAGAAGTTGGCATCCGGTACCGAAAAATCTCCATTCCAG
CTTGTTCTAGAACGGGGACATTTGGAACTTGCAAAAGTGCTGTCTCGCGT
GTGTTGTTATTGGAGCAAAAATTCTAACACCGTCAAACGAATAGAGTTTC
AGGAACTTGAAGAGGTTAAAAGTTTGAGACAGTGGTGCAGAAAAGTAATC
CGAAGGCAATTAGGATTTCATATTTATGAAAAACTGCAAAAAATCAATCT
GCCCCCCGCGCTCATTGAATACATTCAATTAGAAGATATCAAATGGGGCC
CGAAAATGTCTGTCAAGTGATTTTGCCTACATATCTGACATATTTTATTT
TATTTTTGAGTTTCACAGTGATTTTTCGATTAATATGTTGTATTTCGAGT
GTATTTTATTGCATAGCAACACGGACCGAGAGGGGGGTCACCTAGTAGTT
GCAAGTCTGCAGTGCATGAGCCGATATTTTTGATTGAGATTCA
back to top

protein sequence of SMED30003330-orf-1

>SMED30003330-orf-1 ID=SMED30003330-orf-1|Name=SMED30003330-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=422bp
MASSPCNNAPTSPALLFYDAIINNDIDKLRKMVEIYKFDLNAKFPEVRRS
NHKDLCPVHLVSFKGYFSILHYLIQSGVDVNQSTTTLFRQPLHHAAMSHQ
LSCSQLLINAGGQIDAKDTFGNTPLHYAAEDGENNLLTLLLQNGANSDSQ
DITNKTPLMKATRSGRIGAVKRLLGVGCNVNVKDKNEDTALHYAARQGSA
DLIIMLLKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRD
YRTGDTALHVAVRKNYVHLVEMLLKAGKWYIEYNFNNFGESFVHDAVWYN
RCELVRLFLMHNYNFDYPAKKLASGTEKSPFQLVLERGHLELAKVLSRVC
CYWSKNSNTVKRIEFQELEEVKSLRQWCRKVIRRQLGFHIYEKLQKINLP
PALIEYIQLEDIKWGPKMSVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR036036SOCS_box-like_dom_sf
IPR002110Ankyrin_rpt
IPR001496SOCS_box
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0031625ubiquitin protein ligase binding
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0016567protein ubiquitination
Vocabulary: cellular component
TermDefinition
GO:0000151ubiquitin ligase complex
GO:0005634nucleus
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 121..136
score: 42.23
coord: 169..183
score: 34.04
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 288..317
e-value: 13.0
score: 14.7
coord: 53..82
e-value: 110.0
score: 11.7
coord: 253..283
e-value: 0.0044
score: 26.2
coord: 186..215
e-value: 4.1E-4
score: 29.7
coord: 120..149
e-value: 6.8E-4
score: 28.9
coord: 219..248
e-value: 2.8
score: 16.9
coord: 153..182
e-value: 0.53
score: 19.3
coord: 87..116
e-value: 2.2
score: 17.3
coord: 326..357
e-value: 1900.0
score: 2.9
IPR002110Ankyrin repeatPFAMPF00023Ankcoord: 186..217
e-value: 0.0013
score: 19.1
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 186..218
score: 11.701
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 87..119
score: 9.217
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 253..277
score: 10.553
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 219..251
score: 8.683
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 53..85
score: 9.11
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 120..152
score: 13.998
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 153..185
score: 10.846
IPR001496SOCS box domainSMARTSM00969SOCS_box_2coord: 371..410
e-value: 6.4E-6
score: 35.7
IPR001496SOCS box domainPFAMPF07525SOCS_boxcoord: 371..408
e-value: 2.3E-7
score: 31.1
IPR001496SOCS box domainPROSITEPS50225SOCScoord: 370..413
score: 10.452
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 163..250
e-value: 5.1E-24
score: 86.4
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 251..363
e-value: 4.0E-12
score: 48.0
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 6..162
e-value: 3.3E-31
score: 110.6
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 254..346
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 17..277
NoneNo IPR availablePFAMPF13637Ank_4coord: 221..274
e-value: 2.0E-7
score: 31.4
NoneNo IPR availablePANTHERPTHR24178FAMILY NOT NAMEDcoord: 77..315
NoneNo IPR availablePANTHERPTHR24178:SF9ANKYRIN REPEAT AND SOCS BOX PROTEIN 3coord: 56..241
NoneNo IPR availablePANTHERPTHR24178FAMILY NOT NAMEDcoord: 56..241
NoneNo IPR availablePANTHERPTHR24178:SF9ANKYRIN REPEAT AND SOCS BOX PROTEIN 3coord: 77..315
NoneNo IPR availableCDDcd03587SOCScoord: 370..410
e-value: 4.66226E-8
score: 46.6945
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 92..184
e-value: 8.1E-16
score: 58.4
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 53..346
score: 68.124
IPR036036SOCS box-like domain superfamilySUPERFAMILYSSF158235SOCS box-likecoord: 369..412