Kinase D-interacting substrate

Overview
NameKinase D-interacting substrate
Smed IDSMED30003321
Length (bp)4096
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinase D-interacting substrate (SMED30003321) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinase D-interacting substrate (SMED30003321) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinase D-interacting substrate (SMED30003321) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinase D-interacting substrate (SMED30003321) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003321

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30003321SMESG000080369.1 Contig4640newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003321SMESG000080369.1 Contig4640uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003321SMESG000067208.1 Contig4640newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003321SMESG000067208.1 Contig4640uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30003321SMESG000080369.1 SmedASXL_017645SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30003321SMESG000080369.1 dd_Smed_v4_9630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30003321SMESG000080369.1 dd_Smed_v4_9630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30003321SMESG000080369.1 dd_Smed_v4_9630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30003321SMESG000080369.1 dd_Smed_v6_9630_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinase D-interacting substrate vs. Ensembl Human
Match: KIDINS220 (kinase D interacting substrate 220 [Source:HGNC Symbol;Acc:HGNC:29508])

HSP 1 Score: 60.077 bits (144), Expect = 3.467e-8
Identity = 27/68 (39.71%), Postives = 44/68 (64.71%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            D V   + QI+ + +  + +Y   IK+ N NG VLA C+ +EL+KE+ M+FGDWHLF + +  +++ E
Sbjct: 1194 DAVCEKLKQIEGLDQSMLPQYCTTIKKANINGRVLAQCNIDELKKEMNMNFGDWHLFRSTVLEMRNAE 1261          

HSP 2 Score: 55.8398 bits (133), Expect = 6.866e-7
Identity = 33/128 (25.78%), Postives = 64/128 (50.00%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQD-YGERKFKRICCLPTFVYFIGTLICVLGIGTILKV 1123
            + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +    +D  G++K+K+ CCLP+FV F+  + C++   T+L +
Sbjct:  552 ESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCLPSFVIFLFIIGCIISGITLLAI 679          
BLAST of Kinase D-interacting substrate vs. Ensembl Human
Match: KIDINS220 (kinase D interacting substrate 220 [Source:HGNC Symbol;Acc:HGNC:29508])

HSP 1 Score: 60.077 bits (144), Expect = 3.811e-8
Identity = 27/68 (39.71%), Postives = 44/68 (64.71%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            D V   + QI+ + +  + +Y   IK+ N NG VLA C+ +EL+KE+ M+FGDWHLF + +  +++ E
Sbjct: 1213 DAVCEKLKQIEGLDQSMLPQYCTTIKKANINGRVLAQCNIDELKKEMNMNFGDWHLFRSTVLEMRNAE 1280          

HSP 2 Score: 55.8398 bits (133), Expect = 6.876e-7
Identity = 33/128 (25.78%), Postives = 64/128 (50.00%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQD-YGERKFKRICCLPTFVYFIGTLICVLGIGTILKV 1123
            + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +    +D  G++K+K+ CCLP+FV F+  + C++   T+L +
Sbjct:  552 ESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCLPSFVIFLFIIGCIISGITLLAI 679          
BLAST of Kinase D-interacting substrate vs. Ensembl Human
Match: KIDINS220 (kinase D interacting substrate 220 [Source:HGNC Symbol;Acc:HGNC:29508])

HSP 1 Score: 59.6918 bits (143), Expect = 4.735e-8
Identity = 27/68 (39.71%), Postives = 44/68 (64.71%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            D V   + QI+ + +  + +Y   IK+ N NG VLA C+ +EL+KE+ M+FGDWHLF + +  +++ E
Sbjct:  903 DAVCEKLKQIEGLDQSMLPQYCTTIKKANINGRVLAQCNIDELKKEMNMNFGDWHLFRSTVLEMRNAE 970          

HSP 2 Score: 55.0694 bits (131), Expect = 1.202e-6
Identity = 33/128 (25.78%), Postives = 64/128 (50.00%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQD-YGERKFKRICCLPTFVYFIGTLICVLGIGTILKV 1123
            + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +    +D  G++K+K+ CCLP+FV F+  + C++   T+L +
Sbjct:  299 ESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCLPSFVIFLFIIGCIISGITLLAI 426          
BLAST of Kinase D-interacting substrate vs. Ensembl Human
Match: KIDINS220 (kinase D interacting substrate 220 [Source:HGNC Symbol;Acc:HGNC:29508])

HSP 1 Score: 59.3066 bits (142), Expect = 5.394e-8
Identity = 27/68 (39.71%), Postives = 44/68 (64.71%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            D V   + QI+ + +  + +Y   IK+ N NG VLA C+ +EL+KE+ M+FGDWHLF + +  +++ E
Sbjct: 1157 DAVCEKLKQIEGLDQSMLPQYCTTIKKANINGRVLAQCNIDELKKEMNMNFGDWHLFRSTVLEMRNAE 1224          

HSP 2 Score: 54.6842 bits (130), Expect = 1.695e-6
Identity = 33/128 (25.78%), Postives = 64/128 (50.00%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQD-YGERKFKRICCLPTFVYFIGTLICVLGIGTILKV 1123
            + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +    +D  G++K+K+ CCLP+FV F+  + C++   T+L +
Sbjct:  553 ESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCLPSFVIFLFIIGCIISGITLLAI 680          
BLAST of Kinase D-interacting substrate vs. Ensembl Human
Match: KIDINS220 (kinase D interacting substrate 220 [Source:HGNC Symbol;Acc:HGNC:29508])

HSP 1 Score: 59.3066 bits (142), Expect = 5.590e-8
Identity = 27/68 (39.71%), Postives = 44/68 (64.71%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            D V   + QI+ + +  + +Y   IK+ N NG VLA C+ +EL+KE+ M+FGDWHLF + +  +++ E
Sbjct: 1156 DAVCEKLKQIEGLDQSMLPQYCTTIKKANINGRVLAQCNIDELKKEMNMNFGDWHLFRSTVLEMRNAE 1223          

HSP 2 Score: 54.6842 bits (130), Expect = 1.655e-6
Identity = 33/128 (25.78%), Postives = 64/128 (50.00%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQD-YGERKFKRICCLPTFVYFIGTLICVLGIGTILKV 1123
            + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +    +D  G++K+K+ CCLP+FV F+  + C++   T+L +
Sbjct:  552 ESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCLPSFVIFLFIIGCIISGITLLAI 679          
BLAST of Kinase D-interacting substrate vs. Ensembl Fly
Match: CG42672 (gene:FBgn0261554 transcript:FBtr0302704)

HSP 1 Score: 58.9214 bits (141), Expect = 3.603e-8
Identity = 88/370 (23.78%), Postives = 170/370 (45.95%), Query Frame = 2
Query:  494 YAKFLRGQNIL--RLKDFIEKKYFSSTINNIKFRLTPFLSFTICF-LSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXYC-----QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQ-NYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKA----SLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSXXXXXXXXXXXXXXXXTVKIIFCVIHSPTHNLKGFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDLKVLMEFCSFCHVLLKNNNDITMCFLILIDNQIYSLAKSSE 1564
            YAK+  G++ L  +L+D  E   F+        R +  L F +C  ++++ G + GL  +W   + V   + F+L   ++L  +  YC      +W  ++Q G  L   +   +L L++ F +P   Q +  +  +RF +     ++ + +  A+A  + ++  +IE +Y     RL +A     L  D G R ++R+CC+P  + F   L+ V+  G  L V     +     + IL+    +A V+   I   L +  K+   +  S    LK  ++S     E++  T L +E   +  ++  LD + N  +S +V  +DA  + D + ++   +    LL + N     F++LI    + +AK++E
Sbjct:  488 YAKWGSGKSFLLNKLRD--EMNNFARQWAEPPIRTSGLL-FIVCLHVALLIGTIVGLS-TWSAVVGVSAAVGFLLLAYLLLAAVR-YCNYQMDMQWAYSVQHG--LEKRMTRLRLILQVAFCHPPGPQSDSQAKPVRFHFAEANSASPTGD-GAVAHMLAALLDAIESHYGWLATRLYRAFRPKCLKVDVGWR-WRRMCCIPIVLIFELALVTVV-TGISLTVAYFTFADEKEKEHILVALYVIAAVMGTLICTHLHVLAKVFVSLFTSHIRVLKRAVRS----SESAPLTMLGAEVAVMTDMVKCLDAFTN-QQSRLVGVIDALDSCDTERILTLLNAVQTLLSSPN---RPFVLLISVDPHVIAKAAE 839          
BLAST of Kinase D-interacting substrate vs. Ensembl Fly
Match: CG42672 (gene:FBgn0261554 transcript:FBtr0342885)

HSP 1 Score: 58.9214 bits (141), Expect = 4.016e-8
Identity = 88/370 (23.78%), Postives = 170/370 (45.95%), Query Frame = 2
Query:  494 YAKFLRGQNIL--RLKDFIEKKYFSSTINNIKFRLTPFLSFTICF-LSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXYC-----QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQ-NYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKA----SLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSXXXXXXXXXXXXXXXXTVKIIFCVIHSPTHNLKGFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDLKVLMEFCSFCHVLLKNNNDITMCFLILIDNQIYSLAKSSE 1564
            YAK+  G++ L  +L+D  E   F+        R +  L F +C  ++++ G + GL  +W   + V   + F+L   ++L  +  YC      +W  ++Q G  L   +   +L L++ F +P   Q +  +  +RF +     ++ + +  A+A  + ++  +IE +Y     RL +A     L  D G R ++R+CC+P  + F   L+ V+  G  L V     +     + IL+    +A V+   I   L +  K+   +  S    LK  ++S     E++  T L +E   +  ++  LD + N  +S +V  +DA  + D + ++   +    LL + N     F++LI    + +AK++E
Sbjct:  466 YAKWGSGKSFLLNKLRD--EMNNFARQWAEPPIRTSGLL-FIVCLHVALLIGTIVGLS-TWSAVVGVSAAVGFLLLAYLLLAAVR-YCNYQMDMQWAYSVQHG--LEKRMTRLRLILQVAFCHPPGPQSDSQAKPVRFHFAEANSASPTGD-GAVAHMLAALLDAIESHYGWLATRLYRAFRPKCLKVDVGWR-WRRMCCIPIVLIFELALVTVV-TGISLTVAYFTFADEKEKEHILVALYVIAAVMGTLICTHLHVLAKVFVSLFTSHIRVLKRAVRS----SESAPLTMLGAEVAVMTDMVKCLDAFTN-QQSRLVGVIDALDSCDTERILTLLNAVQTLLSSPN---RPFVLLISVDPHVIAKAAE 817          
BLAST of Kinase D-interacting substrate vs. Ensembl Fly
Match: CG42672 (gene:FBgn0261554 transcript:FBtr0302702)

HSP 1 Score: 58.9214 bits (141), Expect = 4.183e-8
Identity = 88/370 (23.78%), Postives = 170/370 (45.95%), Query Frame = 2
Query:  494 YAKFLRGQNIL--RLKDFIEKKYFSSTINNIKFRLTPFLSFTICF-LSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXYC-----QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQ-NYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKA----SLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSXXXXXXXXXXXXXXXXTVKIIFCVIHSPTHNLKGFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDLKVLMEFCSFCHVLLKNNNDITMCFLILIDNQIYSLAKSSE 1564
            YAK+  G++ L  +L+D  E   F+        R +  L F +C  ++++ G + GL  +W   + V   + F+L   ++L  +  YC      +W  ++Q G  L   +   +L L++ F +P   Q +  +  +RF +     ++ + +  A+A  + ++  +IE +Y     RL +A     L  D G R ++R+CC+P  + F   L+ V+  G  L V     +     + IL+    +A V+   I   L +  K+   +  S    LK  ++S     E++  T L +E   +  ++  LD + N  +S +V  +DA  + D + ++   +    LL + N     F++LI    + +AK++E
Sbjct:  466 YAKWGSGKSFLLNKLRD--EMNNFARQWAEPPIRTSGLL-FIVCLHVALLIGTIVGLS-TWSAVVGVSAAVGFLLLAYLLLAAVR-YCNYQMDMQWAYSVQHG--LEKRMTRLRLILQVAFCHPPGPQSDSQAKPVRFHFAEANSASPTGDG-AVAHMLAALLDAIESHYGWLATRLYRAFRPKCLKVDVGWR-WRRMCCIPIVLIFELALVTVV-TGISLTVAYFTFADEKEKEHILVALYVIAAVMGTLICTHLHVLAKVFVSLFTSHIRVLKRAVRS----SESAPLTMLGAEVAVMTDMVKCLDAFTN-QQSRLVGVIDALDSCDTERILTLLNAVQTLLSSPN---RPFVLLISVDPHVIAKAAE 817          
BLAST of Kinase D-interacting substrate vs. Ensembl Fly
Match: CG42672 (gene:FBgn0261554 transcript:FBtr0302706)

HSP 1 Score: 58.9214 bits (141), Expect = 4.451e-8
Identity = 88/370 (23.78%), Postives = 170/370 (45.95%), Query Frame = 2
Query:  494 YAKFLRGQNIL--RLKDFIEKKYFSSTINNIKFRLTPFLSFTICF-LSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXYC-----QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQ-NYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKA----SLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSXXXXXXXXXXXXXXXXTVKIIFCVIHSPTHNLKGFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDLKVLMEFCSFCHVLLKNNNDITMCFLILIDNQIYSLAKSSE 1564
            YAK+  G++ L  +L+D  E   F+        R +  L F +C  ++++ G + GL  +W   + V   + F+L   ++L  +  YC      +W  ++Q G  L   +   +L L++ F +P   Q +  +  +RF +     ++ + +  A+A  + ++  +IE +Y     RL +A     L  D G R ++R+CC+P  + F   L+ V+  G  L V     +     + IL+    +A V+   I   L +  K+   +  S    LK  ++S     E++  T L +E   +  ++  LD + N  +S +V  +DA  + D + ++   +    LL + N     F++LI    + +AK++E
Sbjct:  488 YAKWGSGKSFLLNKLRD--EMNNFARQWAEPPIRTSGLL-FIVCLHVALLIGTIVGLS-TWSAVVGVSAAVGFLLLAYLLLAAVR-YCNYQMDMQWAYSVQHG--LEKRMTRLRLILQVAFCHPPGPQSDSQAKPVRFHFAEANSASPTGD-GAVAHMLAALLDAIESHYGWLATRLYRAFRPKCLKVDVGWR-WRRMCCIPIVLIFELALVTVV-TGISLTVAYFTFADEKEKEHILVALYVIAAVMGTLICTHLHVLAKVFVSLFTSHIRVLKRAVRS----SESAPLTMLGAEVAVMTDMVKCLDAFTN-QQSRLVGVIDALDSCDTERILTLLNAVQTLLSSPN---RPFVLLISVDPHVIAKAAE 839          
BLAST of Kinase D-interacting substrate vs. Ensembl Fly
Match: CG42672 (gene:FBgn0261554 transcript:FBtr0302701)

HSP 1 Score: 58.5362 bits (140), Expect = 5.124e-8
Identity = 88/370 (23.78%), Postives = 170/370 (45.95%), Query Frame = 2
Query:  494 YAKFLRGQNIL--RLKDFIEKKYFSSTINNIKFRLTPFLSFTICF-LSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXYC-----QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQ-NYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKA----SLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSXXXXXXXXXXXXXXXXTVKIIFCVIHSPTHNLKGFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDLKVLMEFCSFCHVLLKNNNDITMCFLILIDNQIYSLAKSSE 1564
            YAK+  G++ L  +L+D  E   F+        R +  L F +C  ++++ G + GL  +W   + V   + F+L   ++L  +  YC      +W  ++Q G  L   +   +L L++ F +P   Q +  +  +RF +     ++ + +  A+A  + ++  +IE +Y     RL +A     L  D G R ++R+CC+P  + F   L+ V+  G  L V     +     + IL+    +A V+   I   L +  K+   +  S    LK  ++S     E++  T L +E   +  ++  LD + N  +S +V  +DA  + D + ++   +    LL + N     F++LI    + +AK++E
Sbjct:  466 YAKWGSGKSFLLNKLRD--EMNNFARQWAEPPIRTSGLL-FIVCLHVALLIGTIVGLS-TWSAVVGVSAAVGFLLLAYLLLAAVR-YCNYQMDMQWAYSVQHG--LEKRMTRLRLILQVAFCHPPGPQSDSQAKPVRFHFAEANSASPTGD-GAVAHMLAALLDAIESHYGWLATRLYRAFRPKCLKVDVGWR-WRRMCCIPIVLIFELALVTVV-TGISLTVAYFTFADEKEKEHILVALYVIAAVMGTLICTHLHVLAKVFVSLFTSHIRVLKRAVRS----SESAPLTMLGAEVAVMTDMVKCLDAFTN-QQSRLVGVIDALDSCDTERILTLLNAVQTLLSSPN---RPFVLLISVDPHVIAKAAE 817          
BLAST of Kinase D-interacting substrate vs. Ensembl Zebrafish
Match: kidins220b (kinase D-interacting substrate 220b [Source:NCBI gene;Acc:335881])

HSP 1 Score: 58.9214 bits (141), Expect = 5.007e-8
Identity = 26/59 (44.07%), Postives = 40/59 (67.80%), Query Frame = 2
Query: 2561 IDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            ID I +  I++Y   IK+ N NG VL+ C+ +EL+KE+ M+FGDW LF T +  ++ +E
Sbjct: 1173 IDGIDQNLISQYTATIKKANINGRVLSQCNIDELKKEMNMNFGDWQLFRTSVLEMRHVE 1231          

HSP 2 Score: 54.6842 bits (130), Expect = 1.044e-6
Identity = 35/135 (25.93%), Postives = 66/135 (48.89%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQD-YGERKFKRICCLPTFVYF---IGTLICVLGIGTILKVNETN 1135
            + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +    +D  G++K+K+ CC+P+FV F   +G LI  + +  + KV+  N
Sbjct:  561 ESWNWAWVISTRLARHIGYLELLLKLMFVNPPELPEQTTRALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCIPSFVIFLFILGCLIMGMALLAVFKVDGQN 695          
BLAST of Kinase D-interacting substrate vs. Ensembl Zebrafish
Match: kidins220a (kinase D-interacting substrate 220a [Source:ZFIN;Acc:ZDB-GENE-041014-170])

HSP 1 Score: 58.5362 bits (140), Expect = 7.174e-8
Identity = 36/136 (26.47%), Postives = 66/136 (48.53%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFI---GTLICVLGIGTILKVNETNLS 1141
            + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +   N +   +K+K+ CC+P+FV F+   G LI  + +  I KV+  NL+
Sbjct:  560 ESWSWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKNDEAQGKKWKKTCCVPSFVLFVLTSGCLITGMALLAIFKVDSENLT 695          

HSP 2 Score: 56.225 bits (134), Expect = 3.360e-7
Identity = 25/61 (40.98%), Postives = 38/61 (62.30%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLI 2716
            D V   + QI  +    + +Y   IK+ N NG VL+ C+ +EL+KE+ M+FGDWHLF + +
Sbjct: 1165 DGVCEKLRQIQGLDSSMLEQYIGTIKKANVNGRVLSQCNLDELKKEMNMNFGDWHLFRSTV 1225          
BLAST of Kinase D-interacting substrate vs. Ensembl Zebrafish
Match: kidins220a (kinase D-interacting substrate 220a [Source:ZFIN;Acc:ZDB-GENE-041014-170])

HSP 1 Score: 58.5362 bits (140), Expect = 7.207e-8
Identity = 36/136 (26.47%), Postives = 66/136 (48.53%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFI---GTLICVLGIGTILKVNETNLS 1141
            + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +   N +   +K+K+ CC+P+FV F+   G LI  + +  I KV+  NL+
Sbjct:  560 ESWSWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKNDEAQGKKWKKTCCVPSFVLFVLTSGCLITGMALLAIFKVDSENLT 695          

HSP 2 Score: 56.225 bits (134), Expect = 3.374e-7
Identity = 25/61 (40.98%), Postives = 38/61 (62.30%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLI 2716
            D V   + QI  +    + +Y   IK+ N NG VL+ C+ +EL+KE+ M+FGDWHLF + +
Sbjct: 1212 DGVCEKLRQIQGLDSSMLEQYIGTIKKANVNGRVLSQCNLDELKKEMNMNFGDWHLFRSTV 1272          
BLAST of Kinase D-interacting substrate vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 61.6178 bits (148), Expect = 1.067e-8
Identity = 55/224 (24.55%), Postives = 104/224 (46.43%), Query Frame = 2
Query:  494 YAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXX--XXYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKA-SLNQDYGERKFKRICCLPTFVYFIGTLICVLG---IGTILKVNETNLS 1141
            YA++  G++ L  K   E K F+       F+ +  + F I  L    G L    +  ++G++V  ++L VL+I    +        + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +     +  G++K+K+ CCLP+FV FI  ++C+     +  I KV+  N++
Sbjct:  466 YAQWGSGKSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLILMLCSTIGLLLSFTVDPKLGISVALSLLTVLYIFFAAVYFGGRREGENWNWAWVLSTRLARQIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKTEETQGKKKWKKTCCLPSFVIFIFIMLCIFAGVLLLAIFKVDPKNMT 689          

HSP 2 Score: 60.8474 bits (146), Expect = 2.025e-8
Identity = 30/88 (34.09%), Postives = 51/88 (57.95%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIEEASESSFFQEIIEPVSKVSP 2797
            D V   +  ID I +  + +Y   I++ N NG VL  C  +EL+KE+ M+FGDWHLF + +  ++S +   +    + + EP S+++P
Sbjct: 1201 DGVCEKLKGIDGIEQSMLPQYTATIRKANINGRVLTQCTMDELKKEMNMNFGDWHLFKSALHEMRSSDTQIQPEEGRMVGEP-SRMAP 1287          
BLAST of Kinase D-interacting substrate vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 61.6178 bits (148), Expect = 1.067e-8
Identity = 55/224 (24.55%), Postives = 104/224 (46.43%), Query Frame = 2
Query:  494 YAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXX--XXYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKA-SLNQDYGERKFKRICCLPTFVYFIGTLICVLG---IGTILKVNETNLS 1141
            YA++  G++ L  K   E K F+       F+ +  + F I  L    G L    +  ++G++V  ++L VL+I    +        + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +     +  G++K+K+ CCLP+FV FI  ++C+     +  I KV+  N++
Sbjct:  466 YAQWGSGKSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLILMLCSTIGLLLSFTVDPKLGISVALSLLTVLYIFFAAVYFGGRREGENWNWAWVLSTRLARQIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKTEETQGKKKWKKTCCLPSFVIFIFIMLCIFAGVLLLAIFKVDPKNMT 689          
BLAST of Kinase D-interacting substrate vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 61.6178 bits (148), Expect = 1.067e-8
Identity = 55/224 (24.55%), Postives = 104/224 (46.43%), Query Frame = 2
Query:  494 YAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXX--XXYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKA-SLNQDYGERKFKRICCLPTFVYFIGTLICVLG---IGTILKVNETNLS 1141
            YA++  G++ L  K   E K F+       F+ +  + F I  L    G L    +  ++G++V  ++L VL+I    +        + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +     +  G++K+K+ CCLP+FV FI  ++C+     +  I KV+  N++
Sbjct:  466 YAQWGSGKSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLILMLCSTIGLLLSFTVDPKLGISVALSLLTVLYIFFAAVYFGGRREGENWNWAWVLSTRLARQIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKTEETQGKKKWKKTCCLPSFVIFIFIMLCIFAGVLLLAIFKVDPKNMT 689          

HSP 2 Score: 60.8474 bits (146), Expect = 2.150e-8
Identity = 30/88 (34.09%), Postives = 51/88 (57.95%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIEEASESSFFQEIIEPVSKVSP 2797
            D V   +  ID I +  + +Y   I++ N NG VL  C  +EL+KE+ M+FGDWHLF + +  ++S +   +    + + EP S+++P
Sbjct: 1207 DGVCEKLKGIDGIEQSMLPQYTATIRKANINGRVLTQCTMDELKKEMNMNFGDWHLFKSALHEMRSSDTQIQPEEGRMVGEP-SRMAP 1293          
BLAST of Kinase D-interacting substrate vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 61.6178 bits (148), Expect = 1.068e-8
Identity = 55/224 (24.55%), Postives = 104/224 (46.43%), Query Frame = 2
Query:  494 YAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXX--XXYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKA-SLNQDYGERKFKRICCLPTFVYFIGTLICVLG---IGTILKVNETNLS 1141
            YA++  G++ L  K   E K F+       F+ +  + F I  L    G L    +  ++G++V  ++L VL+I    +        + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +     +  G++K+K+ CCLP+FV FI  ++C+     +  I KV+  N++
Sbjct:  466 YAQWGSGKSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLILMLCSTIGLLLSFTVDPKLGISVALSLLTVLYIFFAAVYFGGRREGENWNWAWVLSTRLARQIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKTEETQGKKKWKKTCCLPSFVIFIFIMLCIFAGVLLLAIFKVDPKNMT 689          

HSP 2 Score: 60.8474 bits (146), Expect = 2.207e-8
Identity = 30/88 (34.09%), Postives = 51/88 (57.95%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIEEASESSFFQEIIEPVSKVSP 2797
            D V   +  ID I +  + +Y   I++ N NG VL  C  +EL+KE+ M+FGDWHLF + +  ++S +   +    + + EP S+++P
Sbjct: 1217 DGVCEKLKGIDGIEQSMLPQYTATIRKANINGRVLTQCTMDELKKEMNMNFGDWHLFKSALHEMRSSDTQIQPEEGRMVGEP-SRMAP 1303          
BLAST of Kinase D-interacting substrate vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 61.6178 bits (148), Expect = 1.069e-8
Identity = 55/224 (24.55%), Postives = 104/224 (46.43%), Query Frame = 2
Query:  494 YAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXX--XXYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKA-SLNQDYGERKFKRICCLPTFVYFIGTLICVLG---IGTILKVNETNLS 1141
            YA++  G++ L  K   E K F+       F+ +  + F I  L    G L    +  ++G++V  ++L VL+I    +        + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +     +  G++K+K+ CCLP+FV FI  ++C+     +  I KV+  N++
Sbjct:  466 YAQWGSGKSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLILMLCSTIGLLLSFTVDPKLGISVALSLLTVLYIFFAAVYFGGRREGENWNWAWVLSTRLARQIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKTEETQGKKKWKKTCCLPSFVIFIFIMLCIFAGVLLLAIFKVDPKNMT 689          

HSP 2 Score: 60.8474 bits (146), Expect = 2.081e-8
Identity = 30/88 (34.09%), Postives = 51/88 (57.95%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIEEASESSFFQEIIEPVSKVSP 2797
            D V   +  ID I +  + +Y   I++ N NG VL  C  +EL+KE+ M+FGDWHLF + +  ++S +   +    + + EP S+++P
Sbjct: 1219 DGVCEKLKGIDGIEQSMLPQYTATIRKANINGRVLTQCTMDELKKEMNMNFGDWHLFKSALHEMRSSDTQIQPEEGRMVGEP-SRMAP 1305          
BLAST of Kinase D-interacting substrate vs. Ensembl Mouse
Match: Kidins220 (kinase D-interacting substrate 220 [Source:MGI Symbol;Acc:MGI:1924730])

HSP 1 Score: 69.3218 bits (168), Expect = 3.421e-11
Identity = 39/127 (30.71%), Postives = 73/127 (57.48%), Query Frame = 2
Query: 2357 FSDRSYSSKTNNCPIYPPNNTNEILLDSEKHLKTPKNVQKCIQNIKXXXXXXXXXXXXXDNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            F +R + +     P Y P  +  ++  S      P++    + ++    +SL+LS +++D V   + QI+ + +  + +Y   IK+ N NG VLA C+ +EL+KE+ M+FGDWHLF +++  ++S+E
Sbjct:  966 FYNRPFFAPYLYTPRYYPGGSQHLISRSSVKTSLPRDQNNGLASVPATGTSLLLSSMTVDIVCEKLRQIEGLDQGMLPQYCTTIKKANINGRVLAQCNIDELKKEMAMNFGDWHLFRSMVLEMRSVE 1092          

HSP 2 Score: 53.5286 bits (127), Expect = 2.566e-6
Identity = 31/128 (24.22%), Postives = 63/128 (49.22%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQD-YGERKFKRICCLPTFVYFIGTLICVLGIGTILKV 1123
            + W  A      L   I   +L  +L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +    +D  G++K+K+ CCLP+F+ F+  + C++   T+L +
Sbjct:  382 ESWNWAWALSTRLARHIGYLELLFKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDSQGKKKWKKTCCLPSFIIFLFIVGCIIAGITLLAI 509          
BLAST of Kinase D-interacting substrate vs. Ensembl Mouse
Match: Kidins220 (kinase D-interacting substrate 220 [Source:MGI Symbol;Acc:MGI:1924730])

HSP 1 Score: 63.5438 bits (153), Expect = 2.245e-9
Identity = 28/68 (41.18%), Postives = 46/68 (67.65%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            D V   + QI+ + +  + +Y   IK+ N NG VLA C+ +EL+KE+ M+FGDWHLF +++  ++S+E
Sbjct: 1206 DIVCEKLRQIEGLDQGMLPQYCTTIKKANINGRVLAQCNIDELKKEMAMNFGDWHLFRSMVLEMRSVE 1273          

HSP 2 Score: 54.299 bits (129), Expect = 1.331e-6
Identity = 31/128 (24.22%), Postives = 63/128 (49.22%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQD-YGERKFKRICCLPTFVYFIGTLICVLGIGTILKV 1123
            + W  A      L   I   +L  +L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +    +D  G++K+K+ CCLP+F+ F+  + C++   T+L +
Sbjct:  552 ESWNWAWALSTRLARHIGYLELLFKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDSQGKKKWKKTCCLPSFIIFLFIVGCIIAGITLLAI 679          
BLAST of Kinase D-interacting substrate vs. Ensembl Mouse
Match: Kidins220 (kinase D-interacting substrate 220 [Source:MGI Symbol;Acc:MGI:1924730])

HSP 1 Score: 63.5438 bits (153), Expect = 2.369e-9
Identity = 28/68 (41.18%), Postives = 46/68 (67.65%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            D V   + QI+ + +  + +Y   IK+ N NG VLA C+ +EL+KE+ M+FGDWHLF +++  ++S+E
Sbjct: 1236 DIVCEKLRQIEGLDQGMLPQYCTTIKKANINGRVLAQCNIDELKKEMAMNFGDWHLFRSMVLEMRSVE 1303          

HSP 2 Score: 54.299 bits (129), Expect = 1.334e-6
Identity = 31/128 (24.22%), Postives = 63/128 (49.22%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQD-YGERKFKRICCLPTFVYFIGTLICVLGIGTILKV 1123
            + W  A      L   I   +L  +L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +    +D  G++K+K+ CCLP+F+ F+  + C++   T+L +
Sbjct:  552 ESWNWAWALSTRLARHIGYLELLFKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDSQGKKKWKKTCCLPSFIIFLFIVGCIIAGITLLAI 679          
BLAST of Kinase D-interacting substrate vs. Ensembl Mouse
Match: Kidins220 (kinase D-interacting substrate 220 [Source:MGI Symbol;Acc:MGI:1924730])

HSP 1 Score: 63.5438 bits (153), Expect = 2.482e-9
Identity = 28/68 (41.18%), Postives = 46/68 (67.65%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            D V   + QI+ + +  + +Y   IK+ N NG VLA C+ +EL+KE+ M+FGDWHLF +++  ++S+E
Sbjct: 1115 DIVCEKLRQIEGLDQGMLPQYCTTIKKANINGRVLAQCNIDELKKEMAMNFGDWHLFRSMVLEMRSVE 1182          

HSP 2 Score: 53.1434 bits (126), Expect = 3.045e-6
Identity = 31/128 (24.22%), Postives = 63/128 (49.22%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQD-YGERKFKRICCLPTFVYFIGTLICVLGIGTILKV 1123
            + W  A      L   I   +L  +L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +    +D  G++K+K+ CCLP+F+ F+  + C++   T+L +
Sbjct:  510 ESWNWAWALSTRLARHIGYLELLFKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDSQGKKKWKKTCCLPSFIIFLFIVGCIIAGITLLAI 637          
BLAST of Kinase D-interacting substrate vs. UniProt/SwissProt
Match: sp|Q9EQG6|KDIS_RAT (Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus OX=10116 GN=Kidins220 PE=1 SV=2)

HSP 1 Score: 62.3882 bits (150), Expect = 3.840e-8
Identity = 27/68 (39.71%), Postives = 46/68 (67.65%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            D V   + QI+ + +  + +Y   IK+ N NG VL+ C+ +EL+KE+ M+FGDWHLF +++  ++S+E
Sbjct: 1205 DVVCEKLRQIEGLDQSMMPQYCTTIKKANINGRVLSQCNIDELKKEMAMNFGDWHLFRSMVLEMRSVE 1272          
BLAST of Kinase D-interacting substrate vs. UniProt/SwissProt
Match: sp|Q9ULH0|KDIS_HUMAN (Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220 PE=1 SV=3)

HSP 1 Score: 60.077 bits (144), Expect = 1.830e-7
Identity = 27/68 (39.71%), Postives = 44/68 (64.71%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            D V   + QI+ + +  + +Y   IK+ N NG VLA C+ +EL+KE+ M+FGDWHLF + +  +++ E
Sbjct: 1213 DAVCEKLKQIEGLDQSMLPQYCTTIKKANINGRVLAQCNIDELKKEMNMNFGDWHLFRSTVLEMRNAE 1280          

HSP 2 Score: 55.8398 bits (133), Expect = 3.302e-6
Identity = 33/128 (25.78%), Postives = 64/128 (50.00%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQD-YGERKFKRICCLPTFVYFIGTLICVLGIGTILKV 1123
            + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +    +D  G++K+K+ CCLP+FV F+  + C++   T+L +
Sbjct:  552 ESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCLPSFVIFLFIIGCIISGITLLAI 679          
BLAST of Kinase D-interacting substrate vs. UniProt/SwissProt
Match: sp|Q7T163|KDISB_DANRE (Kinase D-interacting substrate of 220 kDa B OS=Danio rerio OX=7955 GN=kidins220b PE=1 SV=3)

HSP 1 Score: 58.9214 bits (141), Expect = 3.780e-7
Identity = 26/59 (44.07%), Postives = 40/59 (67.80%), Query Frame = 2
Query: 2561 IDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            ID I +  I++Y   IK+ N NG VL+ C+ +EL+KE+ M+FGDW LF T +  ++ +E
Sbjct: 1173 IDGIDQNLISQYTATIKKANINGRVLSQCNIDELKKEMNMNFGDWQLFRTSVLEMRHVE 1231          

HSP 2 Score: 54.6842 bits (130), Expect = 7.878e-6
Identity = 35/135 (25.93%), Postives = 66/135 (48.89%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQD-YGERKFKRICCLPTFVYF---IGTLICVLGIGTILKVNETN 1135
            + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +    +D  G++K+K+ CC+P+FV F   +G LI  + +  + KV+  N
Sbjct:  561 ESWNWAWVISTRLARHIGYLELLLKLMFVNPPELPEQTTRALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCIPSFVIFLFILGCLIMGMALLAVFKVDGQN 695          
BLAST of Kinase D-interacting substrate vs. TrEMBL
Match: A0A0R3VV22 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS1211 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.827e-11
Identity = 58/246 (23.58%), Postives = 112/246 (45.53%), Query Frame = 2
Query:  407 FTGECFETLIDSVLLCQTNYSFIIGIFFKYAKFLRGQNILRLKDFIEKKY--FSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQD-YGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETN 1135
            F   C   L D ++   T    +IG+F +     R     +L  +++  Y   +     ++ +     +     L+++  Y+CGLI  W+ GL +G T + +    + ++L G   + WR+A +A   L    RS++L + + F  P + QN     +R +   L L      + A+ +  E +W +    Y+   + L  AS +    G+R+ ++ CC+P    FI  ++ +L   T L+V+ T+
Sbjct:  139 FQRRCVHALADMIVSPYTTLPALIGVFLRPDGTKRSTFNKQLSVYLKAAYRRIAKKPKGLQSKSDIPATLLPTVLAMLFSYICGLIFGWQFGLTIGLTSITLYLAFLCVVLYGGLVRRWRLAQRAAETLLRYARSWRLIVDILFYRPPK-QNLVPTNVRLLPVSLKLGVSETPWDAVLRLSEKMWEAASSKYSTTAVYLQYASEDTSCQGKRRCRKACCIPALGCFILWILSLLTWSTALRVHMTS 383          
BLAST of Kinase D-interacting substrate vs. TrEMBL
Match: A0A4S2LEA8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008201 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 9.932e-11
Identity = 91/360 (25.28%), Postives = 161/360 (44.72%), Query Frame = 2
Query:  404 NFTGECFETLIDSVLLCQTNYSFIIGIFFKYAKFLRGQNILRLKDFIEKKY-FSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXYCQEWRMALQAGIVLCNAIRSFKLWLRLF----FLNPSQGQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSXXXXXXXXXXXXXXXXTVKIIFCVIHSPTHNLK----GFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDK-YENDHRSFIVTFVDATGTTDLKVL 1453
            N        L D      TN+   +GIF +  K         L D   + +  +S ++    +  P L     F+S   GYL G++ SW+VGL++G   +F+  I +++I+ G+   +   A++    L + +  F LWLRL     F  P+Q  +  S+ +R I  +  L   S    A+   ++ +W+ + + +    IRL++AS        ++KR+CCLP F+  I   I  +    +L+ N   L  + +   I+I F  ++ ++F+ I+  L    ++I  +  SP   L+     FL        A T   L S    V QLL+++   ++ + R  +   V    +T LK L
Sbjct:   71 NHGANTVRALADMFTCRMTNFPLTVGIFNQQNKNDH------LSDLASELHNINSLMDPTTLKFNPLLFLFPLFISTTLGYLFGMVSSWQVGLSIGHLAMFMQIIFLVVIITGSRIFQKNFAIR----LSHKVAEFLLWLRLVLNVCFCYPTQRLDKTSS-VRTIVVYHRLFPSSTPTVALFSILDKMWTGLTRLHGEIPIRLLRASPLPREPRYRYKRVCCLPAFLVVIVFWIVFIVGTAVLRDNSGQLKVLLSRATIMITFVAMSSIMFLTILGSLPSIYRLIRGLAVSPIKPLRTALADFLSDETTSSAAGTAVGLASAGEDVDQLLNKIKPDFQKNRRGTVNEGVQLGTSTSLKNL 419          
BLAST of Kinase D-interacting substrate vs. TrEMBL
Match: A0A419Q125 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_4307s PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.512e-10
Identity = 90/360 (25.00%), Postives = 161/360 (44.72%), Query Frame = 2
Query:  404 NFTGECFETLIDSVLLCQTNYSFIIGIFFKYAKFLRGQNILRLKDFIEKKY-FSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXYCQEWRMALQAGIVLCNAIRSFKLWLRLF----FLNPSQGQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSXXXXXXXXXXXXXXXXTVKIIFCVIHSPTHNLK----GFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDK-YENDHRSFIVTFVDATGTTDLKVL 1453
            N        L D      T++   +GIF +  K         L D   + +  +S ++    +  P L     F+S   GYL G++ SW+VGL++G   +F+  I +++I+ G+   +   A++    L + +  F LWLRL     F  P+Q  +  S+ +R I  +  L   S    A+   ++ +W+ + + +    IRL++AS        ++KR+CCLP F+  I   I  +    +L+ N   L  + +   I+I F  ++ ++F+ I+  L    ++I  +  SP   L+     FL        A T   L S    V QLL+++   ++ + R  +   V    +T LK L
Sbjct:   63 NHGANTVRALADMFTCRMTHFPLTVGIFNQQNKNDH------LSDLASELHNINSLMDPTTLKFNPLLFLFPLFISTTLGYLIGMVSSWQVGLSIGHLAMFIQIIFLVVIITGSRIFQKTFAIR----LSHKVAEFLLWLRLVLNVCFCYPTQQLDKKSS-VRTIVVYHRLFPSSTPTVALFSILDKMWTGLIRLHGEIPIRLLRASPVPREPRHRYKRVCCLPAFLVVIVFWIAFIVGTAVLRDNSGQLKMLLSRAAIMITFVAMSSIMFLTILGSLPSIYRLIRGLAVSPIKPLRTALADFLSDETSSSAAGTTVGLASAGEDVDQLLNKIKPDFQKNRRGTVNEGVQLGTSTSLKNL 411          
BLAST of Kinase D-interacting substrate vs. TrEMBL
Match: G7Y9Z9 (Kinase D-interacting substrate of 220 kDa OS=Clonorchis sinensis OX=79923 GN=CLF_103593 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.558e-10
Identity = 90/360 (25.00%), Postives = 161/360 (44.72%), Query Frame = 2
Query:  404 NFTGECFETLIDSVLLCQTNYSFIIGIFFKYAKFLRGQNILRLKDFIEKKY-FSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXYCQEWRMALQAGIVLCNAIRSFKLWLRLF----FLNPSQGQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSXXXXXXXXXXXXXXXXTVKIIFCVIHSPTHNLK----GFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDK-YENDHRSFIVTFVDATGTTDLKVL 1453
            N        L D      T++   +GIF +  K         L D   + +  +S ++    +  P L     F+S   GYL G++ SW+VGL++G   +F+  I +++I+ G+   +   A++    L + +  F LWLRL     F  P+Q  +  S+ +R I  +  L   S    A+   ++ +W+ + + +    IRL++AS        ++KR+CCLP F+  I   I  +    +L+ N   L  + +   I+I F  ++ ++F+ I+  L    ++I  +  SP   L+     FL        A T   L S    V QLL+++   ++ + R  +   V    +T LK L
Sbjct:   63 NHGANTVRALADMFTCRMTHFPLTVGIFNQQNKNDH------LSDLASELHNINSLMDPTTLKFNPLLFLFPLFISTTLGYLIGMVSSWQVGLSIGHLAMFIQIIFLVVIITGSRIFQKTFAIR----LSHKVAEFLLWLRLVLNVCFCYPTQQLDKKSS-VRTIVVYHRLFPSSTPTVALFSILDKMWTGLIRLHGEIPIRLLRASPVPREPRHRYKRVCCLPAFLVVIVFWIAFIVGTAVLRDNSGQLKMLLSRAAIMITFVAMSSIMFLTILGSLPSIYRLIRGLAVSPIKPLRTALADFLSDETSSSAAGTTVGLASAGEDVDQLLNKIKPDFQKNRRGTVNEGVQLGTSTSLKNL 411          
BLAST of Kinase D-interacting substrate vs. TrEMBL
Match: A0A3P6RPZ2 (Uncharacterized protein (Fragment) OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS1573 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.376e-10
Identity = 29/69 (42.03%), Postives = 46/69 (66.67%), Query Frame = 2
Query: 2537 NVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIEEA 2743
            +V  +++ I ++   N   YQ ++++ N  GLVL+ CD  +LR E+QM+FGDW LF TL+ YL+ +E A
Sbjct:   24 DVCELLAAIADLPTSNCTMYQSRMRQQNITGLVLSVCDLEKLRTEMQMNFGDWQLFRTLVLYLRQLEGA 92          
BLAST of Kinase D-interacting substrate vs. Ensembl Cavefish
Match: kidins220a (kinase D-interacting substrate of 220 kDa [Source:NCBI gene;Acc:103043425])

HSP 1 Score: 58.5362 bits (140), Expect = 6.268e-8
Identity = 35/136 (25.74%), Postives = 66/136 (48.53%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICV---LGIGTILKVNETNLS 1141
            + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +   N +   +K+K+ CC+P+FV F  TL C+   + +  I KV  +N++
Sbjct:  560 ESWSWAWNISTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFMATRLFRVFKNDESQGKKWKKTCCVPSFVLFALTLACLVTGMALLAIFKVEPSNIT 695          

HSP 2 Score: 58.151 bits (139), Expect = 8.565e-8
Identity = 24/62 (38.71%), Postives = 38/62 (61.29%), Query Frame = 2
Query: 2552 ISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            +  ID +    + +Y   +K+ N NG VL  C+ +ELRKE+ M+FGDWHLF  ++   + +E
Sbjct: 1159 LRHIDGLDDSMLEQYTTTVKKANINGRVLCQCNLDELRKEMNMNFGDWHLFKAVVLEQRQVE 1220          
BLAST of Kinase D-interacting substrate vs. Ensembl Cavefish
Match: kidins220a (kinase D-interacting substrate of 220 kDa [Source:NCBI gene;Acc:103043425])

HSP 1 Score: 58.5362 bits (140), Expect = 6.275e-8
Identity = 35/136 (25.74%), Postives = 66/136 (48.53%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICV---LGIGTILKVNETNLS 1141
            + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +   N +   +K+K+ CC+P+FV F  TL C+   + +  I KV  +N++
Sbjct:  560 ESWSWAWNISTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFMATRLFRVFKNDESQGKKWKKTCCVPSFVLFALTLACLVTGMALLAIFKVEPSNIT 695          

HSP 2 Score: 57.7658 bits (138), Expect = 8.943e-8
Identity = 24/62 (38.71%), Postives = 38/62 (61.29%), Query Frame = 2
Query: 2552 ISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            +  ID +    + +Y   +K+ N NG VL  C+ +ELRKE+ M+FGDWHLF  ++   + +E
Sbjct: 1169 LRHIDGLDDSMLEQYTTTVKKANINGRVLCQCNLDELRKEMNMNFGDWHLFKAVVLEQRQVE 1230          
BLAST of Kinase D-interacting substrate vs. Ensembl Cavefish
Match: kidins220a (kinase D-interacting substrate of 220 kDa [Source:NCBI gene;Acc:103043425])

HSP 1 Score: 58.5362 bits (140), Expect = 6.293e-8
Identity = 35/136 (25.74%), Postives = 66/136 (48.53%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICV---LGIGTILKVNETNLS 1141
            + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +   N +   +K+K+ CC+P+FV F  TL C+   + +  I KV  +N++
Sbjct:  560 ESWSWAWNISTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFMATRLFRVFKNDESQGKKWKKTCCVPSFVLFALTLACLVTGMALLAIFKVEPSNIT 695          

HSP 2 Score: 58.151 bits (139), Expect = 8.745e-8
Identity = 24/62 (38.71%), Postives = 38/62 (61.29%), Query Frame = 2
Query: 2552 ISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            +  ID +    + +Y   +K+ N NG VL  C+ +ELRKE+ M+FGDWHLF  ++   + +E
Sbjct: 1198 LRHIDGLDDSMLEQYTTTVKKANINGRVLCQCNLDELRKEMNMNFGDWHLFKAVVLEQRQVE 1259          
BLAST of Kinase D-interacting substrate vs. Ensembl Cavefish
Match: kidins220a (kinase D-interacting substrate of 220 kDa [Source:NCBI gene;Acc:103043425])

HSP 1 Score: 58.5362 bits (140), Expect = 6.299e-8
Identity = 35/136 (25.74%), Postives = 66/136 (48.53%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICV---LGIGTILKVNETNLS 1141
            + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +   N +   +K+K+ CC+P+FV F  TL C+   + +  I KV  +N++
Sbjct:  560 ESWSWAWNISTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFMATRLFRVFKNDESQGKKWKKTCCVPSFVLFALTLACLVTGMALLAIFKVEPSNIT 695          

HSP 2 Score: 57.7658 bits (138), Expect = 9.365e-8
Identity = 24/62 (38.71%), Postives = 38/62 (61.29%), Query Frame = 2
Query: 2552 ISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            +  ID +    + +Y   +K+ N NG VL  C+ +ELRKE+ M+FGDWHLF  ++   + +E
Sbjct: 1208 LRHIDGLDDSMLEQYTTTVKKANINGRVLCQCNLDELRKEMNMNFGDWHLFKAVVLEQRQVE 1269          
BLAST of Kinase D-interacting substrate vs. Ensembl Cavefish
Match: kidins220b (kinase D interacting substrate 220 [Source:NCBI gene;Acc:103040274])

HSP 1 Score: 58.151 bits (139), Expect = 7.570e-8
Identity = 27/68 (39.71%), Postives = 42/68 (61.76%), Query Frame = 2
Query: 2534 DNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            D V   +  ID + +  +A+Y   IK+ N NG VL+ C+ +EL+KE+ M+FGDW LF   +  ++ IE
Sbjct: 1208 DMVCERLKVIDGMDQAMLAQYTATIKKANVNGRVLSQCNLDELKKEMSMNFGDWQLFRGTVMEMRHIE 1275          

HSP 2 Score: 55.8398 bits (133), Expect = 3.574e-7
Identity = 35/135 (25.93%), Postives = 67/135 (49.63%), Query Frame = 2
Query:  749 QEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQD-YGERKFKRICCLPTFVYFIGTLICV---LGIGTILKVNETN 1135
            + W  A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +    +D  G++K+K+ CC+P+FV F+  L+C+   + +  I KV+  N
Sbjct:  560 ESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTRALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFMASRLFRVFKTEDTQGKKKWKKTCCIPSFVIFLFILVCLITGMALLAIFKVDGEN 694          
BLAST of Kinase D-interacting substrate vs. Ensembl Medaka
Match: ENSORLT00000022722.2 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 58.9214 bits (141), Expect = 3.892e-8
Identity = 77/388 (19.85%), Postives = 157/388 (40.46%), Query Frame = 2
Query:   95 MINVSQMKNNEIIQMLLDDGESKAVPHQIKENPRTLALR---------------HGNCVEKKIKSNND-------HKRSSSE---SKKDFYPTEKDGDLFSKLVDNGTEKGSTISEKFPNGVSISKELNFTGECFETLIDSVLLCQTNYSFI-IGIFFKYAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFT--ICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXY------CQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICV---LGIGTILKVNETNLS 1141
            +I  ++M+N EI+++LLD G   +   +  + P  +A+R                G  + +  K+          H++S        K   PTE DGD+                                 + + + +  +L   T    I +G+   YA++  G++ L  K   E K F+        ++ P   F+  + FL+++   +  +++ + V   +   +   L   + +  +  Y       + WR A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +  +N +   +K+K+ CC+P+FV F  T+ C+   + +  I KV+  N++
Sbjct:  347 LIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCTHQKSILTQIFGAKHLSPTESDGDMLGY------------------------------DLYSSALADILSEPTMQPPICVGL---YAQWGSGKSFLLKKLEDEMKTFAGQ------QIEPLFQFSWLVIFLTLLLSGMVAVVLGFTVDHKLAIAVSLSLLALLYIFFVLVYFGSRRERESWRWAWLISTRLARQIGYLELLLKLMFVNPLELPEQTTRALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFMNDEIKGQKWKKTCCIPSFVLFSLTVCCLITGMALLVIFKVDPENMT 695          

HSP 2 Score: 53.9138 bits (128), Expect = 1.313e-6
Identity = 23/55 (41.82%), Postives = 35/55 (63.64%), Query Frame = 2
Query: 2552 ISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLI 2716
            + Q D I    + +Y   IK+ N NG VL  C+ +EL+KE++M+FGDW LF  ++
Sbjct: 1170 LKQTDGIDPNMLPQYTATIKKANINGRVLLHCNLDELKKEMEMNFGDWQLFRGMV 1224          
BLAST of Kinase D-interacting substrate vs. Ensembl Medaka
Match: ENSORLT00000018863.2 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 58.9214 bits (141), Expect = 4.089e-8
Identity = 77/388 (19.85%), Postives = 157/388 (40.46%), Query Frame = 2
Query:   95 MINVSQMKNNEIIQMLLDDGESKAVPHQIKENPRTLALR---------------HGNCVEKKIKSNND-------HKRSSSE---SKKDFYPTEKDGDLFSKLVDNGTEKGSTISEKFPNGVSISKELNFTGECFETLIDSVLLCQTNYSFI-IGIFFKYAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFT--ICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXY------CQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICV---LGIGTILKVNETNLS 1141
            +I  ++M+N EI+++LLD G   +   +  + P  +A+R                G  + +  K+          H++S        K   PTE DGD+                                 + + + +  +L   T    I +G+   YA++  G++ L  K   E K F+        ++ P   F+  + FL+++   +  +++ + V   +   +   L   + +  +  Y       + WR A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +  +N +   +K+K+ CC+P+FV F  T+ C+   + +  I KV+  N++
Sbjct:  347 LIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCTHQKSILTQIFGAKHLSPTESDGDMLGY------------------------------DLYSSALADILSEPTMQPPICVGL---YAQWGSGKSFLLKKLEDEMKTFAGQ------QIEPLFQFSWLVIFLTLLLSGMVAVVLGFTVDHKLAIAVSLSLLALLYIFFVLVYFGSRRERESWRWAWLISTRLARQIGYLELLLKLMFVNPLELPEQTTRALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFMNDEIKGQKWKKTCCIPSFVLFSLTVCCLITGMALLVIFKVDPENMT 695          

HSP 2 Score: 53.9138 bits (128), Expect = 1.311e-6
Identity = 23/55 (41.82%), Postives = 35/55 (63.64%), Query Frame = 2
Query: 2552 ISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLI 2716
            + Q D I    + +Y   IK+ N NG VL  C+ +EL+KE++M+FGDW LF  ++
Sbjct: 1159 LKQTDGIDPNMLPQYTATIKKANINGRVLLHCNLDELKKEMEMNFGDWQLFRGMV 1213          
BLAST of Kinase D-interacting substrate vs. Ensembl Medaka
Match: ENSORLT00000018862.2 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 58.9214 bits (141), Expect = 4.133e-8
Identity = 77/388 (19.85%), Postives = 157/388 (40.46%), Query Frame = 2
Query:   95 MINVSQMKNNEIIQMLLDDGESKAVPHQIKENPRTLALR---------------HGNCVEKKIKSNND-------HKRSSSE---SKKDFYPTEKDGDLFSKLVDNGTEKGSTISEKFPNGVSISKELNFTGECFETLIDSVLLCQTNYSFI-IGIFFKYAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFT--ICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXY------CQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICV---LGIGTILKVNETNLS 1141
            +I  ++M+N EI+++LLD G   +   +  + P  +A+R                G  + +  K+          H++S        K   PTE DGD+                                 + + + +  +L   T    I +G+   YA++  G++ L  K   E K F+        ++ P   F+  + FL+++   +  +++ + V   +   +   L   + +  +  Y       + WR A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +  +N +   +K+K+ CC+P+FV F  T+ C+   + +  I KV+  N++
Sbjct:  347 LIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCTHQKSILTQIFGAKHLSPTESDGDMLGY------------------------------DLYSSALADILSEPTMQPPICVGL---YAQWGSGKSFLLKKLEDEMKTFAGQ------QIEPLFQFSWLVIFLTLLLSGMVAVVLGFTVDHKLAIAVSLSLLALLYIFFVLVYFGSRRERESWRWAWLISTRLARQIGYLELLLKLMFVNPLELPEQTTRALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFMNDEIKGQKWKKTCCIPSFVLFSLTVCCLITGMALLVIFKVDPENMT 695          

HSP 2 Score: 53.9138 bits (128), Expect = 1.314e-6
Identity = 23/55 (41.82%), Postives = 35/55 (63.64%), Query Frame = 2
Query: 2552 ISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLI 2716
            + Q D I    + +Y   IK+ N NG VL  C+ +EL+KE++M+FGDW LF  ++
Sbjct: 1179 LKQTDGIDPNMLPQYTATIKKANINGRVLLHCNLDELKKEMEMNFGDWQLFRGMV 1233          
BLAST of Kinase D-interacting substrate vs. Ensembl Medaka
Match: ENSORLT00000033617.1 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 58.9214 bits (141), Expect = 4.505e-8
Identity = 77/388 (19.85%), Postives = 157/388 (40.46%), Query Frame = 2
Query:   95 MINVSQMKNNEIIQMLLDDGESKAVPHQIKENPRTLALR---------------HGNCVEKKIKSNND-------HKRSSSE---SKKDFYPTEKDGDLFSKLVDNGTEKGSTISEKFPNGVSISKELNFTGECFETLIDSVLLCQTNYSFI-IGIFFKYAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFT--ICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXY------CQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICV---LGIGTILKVNETNLS 1141
            +I  ++M+N EI+++LLD G   +   +  + P  +A+R                G  + +  K+          H++S        K   PTE DGD+                                 + + + +  +L   T    I +G+   YA++  G++ L  K   E K F+        ++ P   F+  + FL+++   +  +++ + V   +   +   L   + +  +  Y       + WR A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +  +N +   +K+K+ CC+P+FV F  T+ C+   + +  I KV+  N++
Sbjct:  347 LIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCTHQKSILTQIFGAKHLSPTESDGDMLGY------------------------------DLYSSALADILSEPTMQPPICVGL---YAQWGSGKSFLLKKLEDEMKTFAGQ------QIEPLFQFSWLVIFLTLLLSGMVAVVLGFTVDHKLAIAVSLSLLALLYIFFVLVYFGSRRERESWRWAWLISTRLARQIGYLELLLKLMFVNPLELPEQTTRALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFMNDEIKGQKWKKTCCIPSFVLFSLTVCCLITGMALLVIFKVDPENMT 695          

HSP 2 Score: 53.9138 bits (128), Expect = 1.316e-6
Identity = 23/55 (41.82%), Postives = 35/55 (63.64%), Query Frame = 2
Query: 2552 ISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLI 2716
            + Q D I    + +Y   IK+ N NG VL  C+ +EL+KE++M+FGDW LF  ++
Sbjct: 1197 LKQTDGIDPNMLPQYTATIKKANINGRVLLHCNLDELKKEMEMNFGDWQLFRGMV 1251          
BLAST of Kinase D-interacting substrate vs. Ensembl Medaka
Match: ENSORLT00000022720.2 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 58.9214 bits (141), Expect = 4.590e-8
Identity = 77/388 (19.85%), Postives = 157/388 (40.46%), Query Frame = 2
Query:   95 MINVSQMKNNEIIQMLLDDGESKAVPHQIKENPRTLALR---------------HGNCVEKKIKSNND-------HKRSSSE---SKKDFYPTEKDGDLFSKLVDNGTEKGSTISEKFPNGVSISKELNFTGECFETLIDSVLLCQTNYSFI-IGIFFKYAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFT--ICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXY------CQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQ--GQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICV---LGIGTILKVNETNLS 1141
            +I  ++M+N EI+++LLD G   +   +  + P  +A+R                G  + +  K+          H++S        K   PTE DGD+                                 + + + +  +L   T    I +G+   YA++  G++ L  K   E K F+        ++ P   F+  + FL+++   +  +++ + V   +   +   L   + +  +  Y       + WR A      L   I   +L L+L F+NP +   Q   +  +RF++T     +      ++A+ I ++  + E+ +     RL +  +N +   +K+K+ CC+P+FV F  T+ C+   + +  I KV+  N++
Sbjct:  347 LIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCTHQKSILTQIFGAKHLSPTESDGDMLGY------------------------------DLYSSALADILSEPTMQPPICVGL---YAQWGSGKSFLLKKLEDEMKTFAGQ------QIEPLFQFSWLVIFLTLLLSGMVAVVLGFTVDHKLAIAVSLSLLALLYIFFVLVYFGSRRERESWRWAWLISTRLARQIGYLELLLKLMFVNPLELPEQTTRALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFMNDEIKGQKWKKTCCIPSFVLFSLTVCCLITGMALLVIFKVDPENMT 695          

HSP 2 Score: 53.9138 bits (128), Expect = 1.318e-6
Identity = 23/55 (41.82%), Postives = 35/55 (63.64%), Query Frame = 2
Query: 2552 ISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLI 2716
            + Q D I    + +Y   IK+ N NG VL  C+ +EL+KE++M+FGDW LF  ++
Sbjct: 1217 LKQTDGIDPNMLPQYTATIKKANINGRVLLHCNLDELKKEMEMNFGDWQLFRGMV 1271          
BLAST of Kinase D-interacting substrate vs. Planmine SMEST
Match: SMESG000080369.1 (SMESG000080369.1)

HSP 1 Score: 2318.12 bits (6006), Expect = 0.000e+0
Identity = 1280/1285 (99.61%), Postives = 1282/1285 (99.77%), Query Frame = 2
Query:   95 MINVSQMKNNEIIQMLLDDGESKAVPHQIKENPRTLALRHGNCVEKKIKSNNDHKRSSSESKKDFYPTEKDGDLFSKLVDNGTEKGSTISEKFPNGVSISKELNFTGECFETLIDSVLLCQTNYSFIIGIFFKYAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSXXXXXXXXXXXXXXXXTVKIIFCVIHSPTHNLKGFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDLKVLMEFCSFCHVLLKNNNDITMCFLILIDNQIYSLAKSSEEIINFIKFXXXXXXXXHFNDCTTMGSFNSNLNDVPLKPDQKVMKINDKAQIFDNIHYIGVNANCERFKPELIIQKLYKSIDENPNDSLEEMNIQNISDYLIIKSKLSDFNVTYVKELVITSMFSYKLSQLQNINTDIYKLIDLVTFYYHWPFLYSWMTLFIVNNIYVLKKSLSLRKLYENIMRNMLQSMIEEQFXXXXXXXXXXXXXXXSMMMHNYIGELTIEEFLILTHACHLQNIPMQNFLKNAVKKNEMKKTKCTNSLYDGFSDRSYSSKTNNCPIYPPNNTNEILLDSEKHLKTPKNVQKCIQNIKXXXXXXXXXXXXXDNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIEEASESSFFQEIIEPVSKVSPYNPXXXXXXXXXXXIDMXXXXXXXXXXXXXXGKLCDKCYISQKININSDTDSIWKRKICNHNSSLGKDNFLXXXXXXXXXXXXCLGNSLIQTNSSRSYQQPSNELSNLFPPRDIEINPSLDNDPFLQRTKSLPREASFDSTTTFSTQLSSPRNSKCLYDMDSKSRTYTLPTDKSKRASLVKVKHNIGCQSYNHLQSQFFSEHLGNISPENVAVLIDAPPSKFQTYLQKSDRSYHSSLFEINNNLDKTITHDKPYKKHYTETKKSYSQSNIHKQLSKRKQTNKQEENAAIIVKPIAPNSIESHSRENINSYSYYNTREIEPDIIFRSKYYSNGIESVNPKLNKKKRDEKPHXXXXXXXXXXXXXXXXXINKYGEGINYEISHSEI 3949
            MINVSQMKNNEIIQMLLDDGESKAVPHQIKENPRTLALRHGNCVEKKIKSNNDHKRSSSESKKDFYPTEKDGDLFSKLVDNGTEK STISEKFPNGVSISKELNFTGECFETLIDSVLLCQTNYSFIIGIFFKYAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVGFTILFVLFIGIILILIGTYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQNYNSNELRFIYTHL+LSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSFLAIVLFICIIILLFLTVKIIFCVIHSPTHNLKGFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDLKVLMEFCSFCHVLLKNNNDITMCFLILIDNQIYSLAKSSEEIINFIKFSKLLSLSLHFNDCTTMGSFNSNLNDV LKPDQKVMKINDKAQIFDNIHYIGVNANCERFKPELIIQKLYKSIDENPNDSLEEMNIQNISDYLIIKSKLSDFNVTYVKELVITSMFSYKLSQLQNINTDIYKLIDLVTFYYHWPFLYSWMTLFIVNNIYVLKKSLSLRKLYENIMRNMLQSMIEEQFLLELSKLDLDLNVLESMMMHNYIGELTIEEFLILTHACHLQNIPMQNFLKNAVKKNEMKKTKCTNSLYDGFSDRSYSSKTNNCPIYPPNNTNEILLDSEKHLKTPKNVQKCIQNIKELFSSLILSEISLDNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIEEASESSFFQEIIEPVSKVSPYNPLLLLEKKTSLLIDMNEENSNEIISEESNGKLCDKCYISQKININSDTDSIWKRKICNHNSSLGKDNFLSPMSKSPISSPKCLGNSLIQTNSSRSYQQPSNELSNLF P+DIEINPSLDNDPFLQRTKSLPREASFDSTTTFSTQLSSPRNSKCLYDMDSKSRTYTLPTDKSKRASLVKVKHNIGCQSYNHLQSQFFSEHLGNISPENVAVLIDAPPSKFQTYLQKSDRSYHSSLFEINNNLDKTITHDKPYKKHYTETKKSYSQSNIHKQLSKRKQTNKQEENAAIIVKPIAPNSIESHSRENINSYSYYNTREIEPDIIFRSKYYSNGIESVNPKLNKKKRDEKPHHEKSSGKEKPKKPTKHKINKYGEGINYEISHSEI
Sbjct:    1 MINVSQMKNNEIIQMLLDDGESKAVPHQIKENPRTLALRHGNCVEKKIKSNNDHKRSSSESKKDFYPTEKDGDLFSKLVDNGTEKSSTISEKFPNGVSISKELNFTGECFETLIDSVLLCQTNYSFIIGIFFKYAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVGFTILFVLFIGIILILIGTYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQNYNSNELRFIYTHLILSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSFLAIVLFICIIILLFLTVKIIFCVIHSPTHNLKGFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDLKVLMEFCSFCHVLLKNNNDITMCFLILIDNQIYSLAKSSEEIINFIKFSKLLSLSLHFNDCTTMGSFNSNLNDVTLKPDQKVMKINDKAQIFDNIHYIGVNANCERFKPELIIQKLYKSIDENPNDSLEEMNIQNISDYLIIKSKLSDFNVTYVKELVITSMFSYKLSQLQNINTDIYKLIDLVTFYYHWPFLYSWMTLFIVNNIYVLKKSLSLRKLYENIMRNMLQSMIEEQFLLELSKLDLDLNVLESMMMHNYIGELTIEEFLILTHACHLQNIPMQNFLKNAVKKNEMKKTKCTNSLYDGFSDRSYSSKTNNCPIYPPNNTNEILLDSEKHLKTPKNVQKCIQNIKELFSSLILSEISLDNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIEEASESSFFQEIIEPVSKVSPYNPLLLLEKKTSLLIDMNEENSNEIISEESNGKLCDKCYISQKININSDTDSIWKRKICNHNSSLGKDNFLSPMSKSPISSPKCLGNSLIQTNSSRSYQQPSNELSNLFSPKDIEINPSLDNDPFLQRTKSLPREASFDSTTTFSTQLSSPRNSKCLYDMDSKSRTYTLPTDKSKRASLVKVKHNIGCQSYNHLQSQFFSEHLGNISPENVAVLIDAPPSKFQTYLQKSDRSYHSSLFEINNNLDKTITHDKPYKKHYTETKKSYSQSNIHKQLSKRKQTNKQEENAAIIVKPIAPNSIESHSRENINSYSYYNTREIEPDIIFRSKYYSNGIESVNPKLNKKKRDEKPHHEKSSGKEKPKKPTKHKINKYGEGINYEISHSEI 1285          
BLAST of Kinase D-interacting substrate vs. Planmine SMEST
Match: SMESG000080369.1 (SMESG000080369.1)

HSP 1 Score: 2308.1 bits (5980), Expect = 0.000e+0
Identity = 1274/1279 (99.61%), Postives = 1276/1279 (99.77%), Query Frame = 2
Query:  113 MKNNEIIQMLLDDGESKAVPHQIKENPRTLALRHGNCVEKKIKSNNDHKRSSSESKKDFYPTEKDGDLFSKLVDNGTEKGSTISEKFPNGVSISKELNFTGECFETLIDSVLLCQTNYSFIIGIFFKYAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSXXXXXXXXXXXXXXXXTVKIIFCVIHSPTHNLKGFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDLKVLMEFCSFCHVLLKNNNDITMCFLILIDNQIYSLAKSSEEIINFIKFXXXXXXXXHFNDCTTMGSFNSNLNDVPLKPDQKVMKINDKAQIFDNIHYIGVNANCERFKPELIIQKLYKSIDENPNDSLEEMNIQNISDYLIIKSKLSDFNVTYVKELVITSMFSYKLSQLQNINTDIYKLIDLVTFYYHWPFLYSWMTLFIVNNIYVLKKSLSLRKLYENIMRNMLQSMIEEQFXXXXXXXXXXXXXXXSMMMHNYIGELTIEEFLILTHACHLQNIPMQNFLKNAVKKNEMKKTKCTNSLYDGFSDRSYSSKTNNCPIYPPNNTNEILLDSEKHLKTPKNVQKCIQNIKXXXXXXXXXXXXXDNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIEEASESSFFQEIIEPVSKVSPYNPXXXXXXXXXXXIDMXXXXXXXXXXXXXXGKLCDKCYISQKININSDTDSIWKRKICNHNSSLGKDNFLXXXXXXXXXXXXCLGNSLIQTNSSRSYQQPSNELSNLFPPRDIEINPSLDNDPFLQRTKSLPREASFDSTTTFSTQLSSPRNSKCLYDMDSKSRTYTLPTDKSKRASLVKVKHNIGCQSYNHLQSQFFSEHLGNISPENVAVLIDAPPSKFQTYLQKSDRSYHSSLFEINNNLDKTITHDKPYKKHYTETKKSYSQSNIHKQLSKRKQTNKQEENAAIIVKPIAPNSIESHSRENINSYSYYNTREIEPDIIFRSKYYSNGIESVNPKLNKKKRDEKPHXXXXXXXXXXXXXXXXXINKYGEGINYEISHSEI 3949
            MKNNEIIQMLLDDGESKAVPHQIKENPRTLALRHGNCVEKKIKSNNDHKRSSSESKKDFYPTEKDGDLFSKLVDNGTEK STISEKFPNGVSISKELNFTGECFETLIDSVLLCQTNYSFIIGIFFKYAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVGFTILFVLFIGIILILIGTYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQNYNSNELRFIYTHL+LSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSFLAIVLFICIIILLFLTVKIIFCVIHSPTHNLKGFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDLKVLMEFCSFCHVLLKNNNDITMCFLILIDNQIYSLAKSSEEIINFIKFSKLLSLSLHFNDCTTMGSFNSNLNDV LKPDQKVMKINDKAQIFDNIHYIGVNANCERFKPELIIQKLYKSIDENPNDSLEEMNIQNISDYLIIKSKLSDFNVTYVKELVITSMFSYKLSQLQNINTDIYKLIDLVTFYYHWPFLYSWMTLFIVNNIYVLKKSLSLRKLYENIMRNMLQSMIEEQFLLELSKLDLDLNVLESMMMHNYIGELTIEEFLILTHACHLQNIPMQNFLKNAVKKNEMKKTKCTNSLYDGFSDRSYSSKTNNCPIYPPNNTNEILLDSEKHLKTPKNVQKCIQNIKELFSSLILSEISLDNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIEEASESSFFQEIIEPVSKVSPYNPLLLLEKKTSLLIDMNEENSNEIISEESNGKLCDKCYISQKININSDTDSIWKRKICNHNSSLGKDNFLSPMSKSPISSPKCLGNSLIQTNSSRSYQQPSNELSNLF P+DIEINPSLDNDPFLQRTKSLPREASFDSTTTFSTQLSSPRNSKCLYDMDSKSRTYTLPTDKSKRASLVKVKHNIGCQSYNHLQSQFFSEHLGNISPENVAVLIDAPPSKFQTYLQKSDRSYHSSLFEINNNLDKTITHDKPYKKHYTETKKSYSQSNIHKQLSKRKQTNKQEENAAIIVKPIAPNSIESHSRENINSYSYYNTREIEPDIIFRSKYYSNGIESVNPKLNKKKRDEKPHHEKSSGKEKPKKPTKHKINKYGEGINYEISHSEI
Sbjct:    1 MKNNEIIQMLLDDGESKAVPHQIKENPRTLALRHGNCVEKKIKSNNDHKRSSSESKKDFYPTEKDGDLFSKLVDNGTEKSSTISEKFPNGVSISKELNFTGECFETLIDSVLLCQTNYSFIIGIFFKYAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVGFTILFVLFIGIILILIGTYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQNYNSNELRFIYTHLILSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSFLAIVLFICIIILLFLTVKIIFCVIHSPTHNLKGFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDLKVLMEFCSFCHVLLKNNNDITMCFLILIDNQIYSLAKSSEEIINFIKFSKLLSLSLHFNDCTTMGSFNSNLNDVTLKPDQKVMKINDKAQIFDNIHYIGVNANCERFKPELIIQKLYKSIDENPNDSLEEMNIQNISDYLIIKSKLSDFNVTYVKELVITSMFSYKLSQLQNINTDIYKLIDLVTFYYHWPFLYSWMTLFIVNNIYVLKKSLSLRKLYENIMRNMLQSMIEEQFLLELSKLDLDLNVLESMMMHNYIGELTIEEFLILTHACHLQNIPMQNFLKNAVKKNEMKKTKCTNSLYDGFSDRSYSSKTNNCPIYPPNNTNEILLDSEKHLKTPKNVQKCIQNIKELFSSLILSEISLDNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIEEASESSFFQEIIEPVSKVSPYNPLLLLEKKTSLLIDMNEENSNEIISEESNGKLCDKCYISQKININSDTDSIWKRKICNHNSSLGKDNFLSPMSKSPISSPKCLGNSLIQTNSSRSYQQPSNELSNLFSPKDIEINPSLDNDPFLQRTKSLPREASFDSTTTFSTQLSSPRNSKCLYDMDSKSRTYTLPTDKSKRASLVKVKHNIGCQSYNHLQSQFFSEHLGNISPENVAVLIDAPPSKFQTYLQKSDRSYHSSLFEINNNLDKTITHDKPYKKHYTETKKSYSQSNIHKQLSKRKQTNKQEENAAIIVKPIAPNSIESHSRENINSYSYYNTREIEPDIIFRSKYYSNGIESVNPKLNKKKRDEKPHHEKSSGKEKPKKPTKHKINKYGEGINYEISHSEI 1279          
BLAST of Kinase D-interacting substrate vs. Planmine SMEST
Match: SMESG000079991.1 (SMESG000079991.1)

HSP 1 Score: 116.316 bits (290), Expect = 9.057e-26
Identity = 107/373 (28.69%), Postives = 186/373 (49.87%), Query Frame = 2
Query:  425 ETLIDSVLLCQTNYSFIIGIFFKYAKFLRGQNILRLKDFIEKKYFSST-INNIKFRLTPFLSFTI-CFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSXXXXXXXXXXXXXXXXTVKIIFCVIHSPTHNLKGFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDLKVLMEFCSFCHVLLKNNNDITMCFLILIDNQ 1537
            + L D ++   TN+   IG+F +    +R  ++ +L D    +  S T INN K      L F    FL ++ G + GL  +W VG+++G ++  + F+ I +I+ G+  + W  AL+A   L +  +S +L+L + F  P + +   +  L  I TH  LSNYS+  H     +E +W ++EK Y+    RL  +  N +    KFK ICC+P FV  I     ++   T+  +   N   +F NK +L  F  +  ++F+CI   L L  + I  ++ SP+  LK F++S NI  +AS  T + +E   + Q++S  + Y N  +  +  F+DA  T   + L       + LL+ +++  +  ++  D Q
Sbjct:   93 QALADMLVCPNTNFPISIGLFSRVGAGIRTTHLEKLSD----ELISLTKINNQKTLQPSLLLFMFPVFLFIVVGIIVGLGTNWIVGVSLGASLSLMSFLLIEIIIFGSNHKRWGKALRAARWLASFTQSLQLFLDILFRYPHENE-LTTKPLSIIITHHNLSNYSSASHMNLSIVEKLWKAVEKKYSCLLSRLQISCKNPE-SSTKFKNICCIPIFVLVIIFFSAIIINATLFTIYNKNPMDIFVNKGLLPLFVIMTCIVFLCIFGTLPLVCRTITFLVRSPSRQLKQFMESENIDFQAS-DTLVKNELLKLCQIISIFEAYLNSEKIRMFVFIDAADTESREKLANSIYLVNGLLQMSSNAPIALILAADFQ 458          

HSP 2 Score: 76.6406 bits (187), Expect = 1.141e-13
Identity = 39/96 (40.62%), Postives = 68/96 (70.83%), Query Frame = 2
Query: 2453 KTPKNVQKCIQNIKXXXXXXXXXXXXXDNVIWMISQIDEIS-KENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIE 2737
            KTP  +++C+  +K+ +    LS++    +  ++ QI+ +S +ENI KY+EK+ ++N  GLVL+ CD ++L+ E++M+FGDW LF TLI +L+S+E
Sbjct:  801 KTPIAIKRCMVKLKDGYPGKDLSQLDKYEIGILMCQIEGLSSEENIEKYKEKLIQLNVTGLVLSVCDMDQLQNEMEMNFGDWQLFKTLIYHLRSVE 896          
BLAST of Kinase D-interacting substrate vs. Planmine SMEST
Match: SMESG000051607.1 (SMESG000051607.1)

HSP 1 Score: 90.8929 bits (224), Expect = 5.326e-18
Identity = 80/329 (24.32%), Postives = 159/329 (48.33%), Query Frame = 2
Query: 1832 EMNIQNISDYLIIKSKLSDFNVTYVKELVITSMFSYKLSQLQNINTDIYKLIDLVTFYYHWPFLYSWMTLFIVNNIYVLKKSLSLRKLYENIMRNMLQSMIEEQFXXXXXXXXXXXXXXXSMMMHNYIGELTIEEFLILTHACHLQNIPMQNFLKNAVKKNEMKKTKCTNSLYDGFSDRSYSSKTNNCPIYPPN--NTNEILLDSEKH-----LKTPKNVQKCIQNIKXXXXXXXXXXXXXDNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIEEASESSFFQEIIEPVSKVSP 2797
            + +++ I    + K  L + N   +K+L+I+++F  K+ ++  I     +LID +    +WPF  + +  F+++    +    SL+KL+++I+       +  +  L L++ D  +++  + +       L+I +  I +      N  +Q+ +              T    +  S + YSS+  +    P     TN   ++S  +     LKTP  V+KC   +K+      LS++S   VI +++ ID +    + +YQ ++ ++N  GLVL+ CD + L++EL+M+FGD+ +F  LI YL+ +E     S      E + ++SP
Sbjct:  541 DYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSII--------------TEIYLEHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMISLTDS--EDIGELSP 853          

HSP 2 Score: 79.337 bits (194), Expect = 1.659e-14
Identity = 84/343 (24.49%), Postives = 155/343 (45.19%), Query Frame = 2
Query:  464 YSFIIGIFFKYAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSXXXXXXXXXXXXXXXXTVKIIFCVIHSPTHNLKGFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDLKVLMEFCSFCHVLLKN 1492
            +   +GIF +    +R  ++ +L +  E  +  +  N I  + +  L    C  S+I G++ G+ I+W  G+ +G   + ++F  I +IL G+  +    AL A   L   +    L L++ F  PS     N   +  I TH  L++Y +  H     +ESIW ++EK Y     RL  +  + D  E +FK++CC+PTFV  I   + ++   T+L +      T+F +  +L  F  +  ++F+     L +  K++  +  SP   +   +K+      +     +  E   V  L+S  + Y+   +  I   V++T   + + L      C  LL+N
Sbjct:   84 HPLYVGIFNRTTPGIRTTHLNKLAE--EISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRSSKALFASKKLAKFMERVDLLLQILFCYPSDTDLINKPIVPIILTH-NLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTD-SESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISE-MKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLAN----CVYLLQN 417          
BLAST of Kinase D-interacting substrate vs. Planmine SMEST
Match: SMESG000051607.1 (SMESG000051607.1)

HSP 1 Score: 90.1225 bits (222), Expect = 9.387e-18
Identity = 80/323 (24.77%), Postives = 157/323 (48.61%), Query Frame = 2
Query: 1832 EMNIQNISDYLIIKSKLSDFNVTYVKELVITSMFSYKLSQLQNINTDIYKLIDLVTFYYHWPFLYSWMTLFIVNNIYVLKKSLSLRKLYENIMRNMLQSMIEEQFXXXXXXXXXXXXXXXSMMMHNYIGELTIEEFLILTHACHLQNIPMQNFLKNAVKKNEMKKTKCTNSLYDGFSDRSYSS-KTNNCPIYPPNNTNEILLDSEKHLKTPKNVQKCIQNIKXXXXXXXXXXXXXDNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIEEASESSFFQEIIEPVSKVSP 2797
            + +++ I    + K  L + N   +K+L+I+++F  K+ ++  I     +LID +    +WPF  + +  F+++    +    SL+KL+++I+       +  +  L L++ D  +++  + +       L+I +  I +      N  +Q+ +       E    K  +S      D   +  +TN   I   +N N       + LKTP  V+KC   +K+      LS++S   VI +++ ID +    + +YQ ++ ++N  GLVL+ CD + L++EL+M+FGD+ +F  LI YL+ +E     S      E + ++SP
Sbjct:  541 DYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSII------TEHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNING------ETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMISLTDS--EDIGELSP 849          

HSP 2 Score: 79.337 bits (194), Expect = 1.881e-14
Identity = 84/343 (24.49%), Postives = 155/343 (45.19%), Query Frame = 2
Query:  464 YSFIIGIFFKYAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVXXXXXXXXXXXXXXXXXXXYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSXXXXXXXXXXXXXXXXTVKIIFCVIHSPTHNLKGFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDLKVLMEFCSFCHVLLKN 1492
            +   +GIF +    +R  ++ +L +  E  +  +  N I  + +  L    C  S+I G++ G+ I+W  G+ +G   + ++F  I +IL G+  +    AL A   L   +    L L++ F  PS     N   +  I TH  L++Y +  H     +ESIW ++EK Y     RL  +  + D  E +FK++CC+PTFV  I   + ++   T+L +      T+F +  +L  F  +  ++F+     L +  K++  +  SP   +   +K+      +     +  E   V  L+S  + Y+   +  I   V++T   + + L      C  LL+N
Sbjct:   84 HPLYVGIFNRTTPGIRTTHLNKLAE--EISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRSSKALFASKKLAKFMERVDLLLQILFCYPSDTDLINKPIVPIILTH-NLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTD-SESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISE-MKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLAN----CVYLLQN 417          
The following BLAST results are available for this feature:
BLAST of Kinase D-interacting substrate vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIDINS2203.467e-839.71kinase D interacting substrate 220 [Source:HGNC Sy... [more]
KIDINS2203.811e-839.71kinase D interacting substrate 220 [Source:HGNC Sy... [more]
KIDINS2204.735e-839.71kinase D interacting substrate 220 [Source:HGNC Sy... [more]
KIDINS2205.394e-839.71kinase D interacting substrate 220 [Source:HGNC Sy... [more]
KIDINS2205.590e-839.71kinase D interacting substrate 220 [Source:HGNC Sy... [more]
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG426723.603e-823.78gene:FBgn0261554 transcript:FBtr0302704[more]
CG426724.016e-823.78gene:FBgn0261554 transcript:FBtr0342885[more]
CG426724.183e-823.78gene:FBgn0261554 transcript:FBtr0302702[more]
CG426724.451e-823.78gene:FBgn0261554 transcript:FBtr0302706[more]
CG426725.124e-823.78gene:FBgn0261554 transcript:FBtr0302701[more]
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kidins220b5.007e-844.07kinase D-interacting substrate 220b [Source:NCBI g... [more]
kidins220a7.174e-826.47kinase D-interacting substrate 220a [Source:ZFIN;A... [more]
kidins220a7.207e-826.47kinase D-interacting substrate 220a [Source:ZFIN;A... [more]
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab4b1.067e-824.55RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
rab4b1.067e-824.55RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
rab4b1.067e-824.55RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
rab4b1.068e-824.55RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
rab4b1.069e-824.55RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Kidins2203.421e-1130.71kinase D-interacting substrate 220 [Source:MGI Sym... [more]
Kidins2202.245e-941.18kinase D-interacting substrate 220 [Source:MGI Sym... [more]
Kidins2202.369e-941.18kinase D-interacting substrate 220 [Source:MGI Sym... [more]
Kidins2202.482e-941.18kinase D-interacting substrate 220 [Source:MGI Sym... [more]
back to top
BLAST of Kinase D-interacting substrate vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9EQG6|KDIS_RAT3.840e-839.71Kinase D-interacting substrate of 220 kDa OS=Rattu... [more]
sp|Q9ULH0|KDIS_HUMAN1.830e-739.71Kinase D-interacting substrate of 220 kDa OS=Homo ... [more]
sp|Q7T163|KDISB_DANRE3.780e-744.07Kinase D-interacting substrate of 220 kDa B OS=Dan... [more]
back to top
BLAST of Kinase D-interacting substrate vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3VV224.827e-1123.58Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A4S2LEA89.932e-1125.28Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A419Q1252.512e-1025.00Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
G7Y9Z92.558e-1025.00Kinase D-interacting substrate of 220 kDa OS=Clono... [more]
A0A3P6RPZ24.376e-1042.03Uncharacterized protein (Fragment) OS=Dibothriocep... [more]
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kidins220a6.268e-825.74kinase D-interacting substrate of 220 kDa [Source:... [more]
kidins220a6.275e-825.74kinase D-interacting substrate of 220 kDa [Source:... [more]
kidins220a6.293e-825.74kinase D-interacting substrate of 220 kDa [Source:... [more]
kidins220a6.299e-825.74kinase D-interacting substrate of 220 kDa [Source:... [more]
kidins220b7.570e-839.71kinase D interacting substrate 220 [Source:NCBI ge... [more]
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000022722.23.892e-819.85kinase D interacting substrate 220 [Source:NCBI ge... [more]
ENSORLT00000018863.24.089e-819.85kinase D interacting substrate 220 [Source:NCBI ge... [more]
ENSORLT00000018862.24.133e-819.85kinase D interacting substrate 220 [Source:NCBI ge... [more]
ENSORLT00000033617.14.505e-819.85kinase D interacting substrate 220 [Source:NCBI ge... [more]
ENSORLT00000022720.24.590e-819.85kinase D interacting substrate 220 [Source:NCBI ge... [more]
back to top
BLAST of Kinase D-interacting substrate vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080369.10.000e+099.61SMESG000080369.1[more]
SMESG000080369.10.000e+099.61SMESG000080369.1[more]
SMESG000079991.19.057e-2628.69SMESG000079991.1[more]
SMESG000051607.15.326e-1824.32SMESG000051607.1[more]
SMESG000051607.19.387e-1824.77SMESG000051607.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003321 ID=SMED30003321|Name=Kinase D-interacting substrate|organism=Schmidtea mediterranea sexual|type=transcript|length=4096bp
TAAAAATAGAAATATTTCTTTAGTTCGAATTTGATTGGTCAGAAAATCCA
AACAAGAAAAATTTCGAGAATTTATTGTGCTCTTTTGCTTCTGGATGATC
AATGTTTCCCAGATGAAGAACAATGAAATTATTCAAATGCTTTTAGATGA
TGGAGAATCGAAAGCCGTTCCGCATCAAATTAAAGAAAACCCAAGAACTC
TAGCTCTTCGACACGGAAATTGCGTGGAGAAGAAAATCAAATCCAACAAT
GATCACAAGCGATCTAGTAGTGAATCAAAAAAAGATTTTTATCCAACAGA
AAAAGACGGTGATCTTTTCAGCAAACTCGTCGACAATGGCACAGAGAAAG
GTTCAACAATTTCCGAGAAGTTTCCCAATGGTGTTAGTATAAGCAAAGAG
CTCAATTTCACGGGAGAATGCTTTGAAACGTTGATTGATAGTGTTCTACT
TTGCCAGACGAATTATTCCTTCATTATTGGGATATTTTTTAAATATGCTA
AATTTCTCAGAGGGCAAAATATTCTCAGATTAAAAGATTTCATTGAGAAA
AAGTATTTTTCATCTACGATAAATAACATCAAATTTAGATTGACACCTTT
CTTATCCTTCACAATTTGTTTCCTATCTGTTATATGTGGATATTTATGTG
GATTAATCATTTCATGGGAGGTCGGTTTAGCTGTGGGATTCACAATATTA
TTCGTTCTCTTTATTGGCATAATTTTAATTCTCATCGGAACCTACTGTCA
AGAATGGAGAATGGCCCTTCAGGCTGGTATTGTTCTTTGCAATGCAATAA
GATCTTTCAAATTATGGTTAAGATTATTTTTCCTAAATCCATCTCAGGGT
CAAAATTACAATTCTAACGAATTAAGATTTATATATACTCATTTAGTATT
AAGTAATTATTCTAATAATTTCCATGCGATTGCAAAATTTATTGAAAGTA
TTTGGAGTTCTATTGAAAAGAATTACAACAACTTTTTTATTCGGCTTATG
AAAGCTTCTTTAAATCAAGATTACGGTGAACGAAAGTTCAAAAGGATCTG
TTGTCTCCCAACATTTGTGTACTTCATAGGTACCTTAATATGCGTCCTTG
GCATTGGAACCATTCTGAAAGTCAATGAAACGAATCTATCAACCGTTTTT
AACAACAAGCTGATTTTGATAGGATTTAGTTTTCTTGCCATTGTTTTATT
TATCTGCATAATTATATTATTATTTTTGACGGTAAAAATTATATTCTGTG
TCATCCATTCCCCGACTCATAATCTCAAAGGATTCCTGAAATCCTACAAC
ATTTACGGTGAGGCATCAACGCAAACTTTCCTAATGTCCGAATTTAACAG
CGTTCTTCAATTGTTGTCACAATTGGATAAATATGAAAATGATCACCGGT
CTTTTATTGTGACTTTTGTCGATGCAACTGGCACGACTGACTTAAAAGTA
TTAATGGAGTTTTGCTCATTTTGCCACGTGCTGCTGAAAAACAATAACGA
TATAACAATGTGTTTTCTCATTCTTATAGATAATCAGATTTACTCTTTGG
CCAAATCGTCTGAAGAAATAATTAATTTCATTAAATTCTCCAAGCTTCTT
TCACTTTCTTTGCACTTCAACGATTGCACTACAATGGGAAGTTTTAATTC
AAACTTGAATGATGTTCCATTGAAACCCGATCAAAAGGTCATGAAGATCA
ATGATAAGGCGCAAATTTTCGACAATATTCACTATATCGGAGTCAACGCG
AACTGTGAACGCTTCAAGCCAGAGTTGATAATTCAGAAGTTGTACAAAAG
TATTGATGAGAATCCCAATGACTCCCTTGAAGAGATGAATATACAAAATA
TTTCAGATTATTTAATAATCAAAAGCAAATTATCCGACTTCAACGTTACT
TACGTAAAAGAGTTGGTGATAACGTCGATGTTTTCATACAAACTATCCCA
ATTGCAAAATATCAACACTGACATCTATAAACTAATTGACCTCGTCACCT
TCTATTACCACTGGCCGTTTCTCTATTCCTGGATGACATTGTTCATTGTC
AATAACATTTACGTTTTGAAAAAGTCTCTATCATTGAGAAAACTCTATGA
AAACATTATGAGAAATATGCTGCAGTCAATGATAGAAGAACAATTTTTAT
TGGAACTATCAAAATTGGACTTGGACTTGAATGTGCTAGAATCCATGATG
ATGCACAACTATATCGGTGAGCTCACGATTGAGGAGTTCCTCATTTTGAC
TCACGCGTGTCATCTGCAGAATATTCCCATGCAAAACTTCCTCAAAAATG
CGGTCAAGAAGAATGAAATGAAGAAAACTAAATGTACAAATTCTTTATAC
GATGGATTTTCCGACCGAAGTTATTCCTCAAAAACCAACAACTGCCCAAT
TTATCCGCCGAATAATACCAATGAAATATTACTCGATTCTGAAAAGCATT
TAAAAACTCCAAAGAATGTTCAAAAATGTATTCAGAACATCAAAGAATTG
TTTTCATCCCTAATTTTGAGCGAGATCAGTCTTGACAATGTGATTTGGAT
GATCTCTCAAATAGATGAGATCTCTAAAGAGAATATTGCCAAATATCAAG
AAAAGATCAAGGAAATCAATGCAAATGGCTTGGTCCTAGCCACTTGTGAT
CCGAATGAGTTGAGGAAGGAATTGCAAATGTCTTTCGGAGATTGGCATTT
ATTTTATACTTTAATATCGTACTTGAAATCTATTGAAGAAGCTAGTGAAT
CAAGTTTCTTTCAAGAAATCATTGAACCAGTGAGTAAAGTTTCCCCATAT
AATCCATTGCTCCTCTTGGAAAAGAAAACCTCTCTGCTTATTGATATGAA
TGAAGAAAATAGTAATGAGATCATTTCTGAAGAATCTAATGGTAAACTTT
GTGATAAATGCTATATCAGTCAGAAAATTAATATCAATTCCGACACTGAT
TCTATATGGAAACGAAAGATTTGCAACCACAACTCTTCATTAGGAAAAGA
TAATTTTCTTTCTCCAATGTCTAAATCTCCAATTTCTAGTCCGAAATGTT
TAGGAAATTCGCTCATTCAAACAAATTCTTCTAGATCCTATCAACAACCT
TCTAACGAACTGTCTAATCTATTTCCCCCTAGAGACATTGAAATAAATCC
ATCATTAGACAATGATCCCTTTCTTCAAAGAACAAAATCTTTACCTAGAG
AAGCAAGTTTTGATTCTACAACAACGTTTTCTACTCAATTATCGTCTCCA
AGAAATTCCAAATGCTTATATGACATGGATAGCAAAAGCAGAACGTACAC
TTTACCAACTGACAAAAGCAAACGAGCTTCTCTTGTTAAGGTGAAGCATA
ACATCGGCTGTCAAAGCTACAATCATCTTCAATCACAGTTTTTCTCCGAA
CATCTCGGAAATATCTCTCCAGAAAACGTAGCAGTTCTCATCGATGCACC
TCCATCGAAATTTCAAACCTATTTGCAGAAATCTGATAGATCTTATCATT
CTAGCTTATTTGAAATCAACAACAACTTAGACAAAACAATCACTCATGAC
AAACCGTATAAAAAGCATTACACCGAAACGAAAAAGTCTTACTCCCAATC
AAATATCCACAAACAGCTTTCCAAGAGAAAACAAACGAACAAACAAGAGG
AGAACGCAGCAATCATAGTCAAACCGATTGCTCCAAATAGCATCGAGAGC
CATTCAAGGGAAAATATCAACAGTTATAGCTATTACAATACCAGAGAAAT
AGAGCCCGACATCATATTTCGCTCGAAGTACTATTCAAACGGCATCGAGT
CTGTGAATCCAAAGTTGAATAAAAAGAAAAGAGATGAGAAGCCCCATCAC
GAGAAGTCATCGGGGAAAGAGAAACCGAAAAAGCCAACGAAGCATAAAAT
TAACAAATACGGTGAAGGCATCAATTATGAAATTTCCCACAGTGAAATTT
GAAATCTGTAAATTCTTCATTCTGAAACTTTCCTATTGTTAATTGACGAT
TTTAGATTTTTTTGTAACATTTGAAAATTATTTTTAATTTTTTTTGTGAA
TAGCTCAGTTAGTCAATATAATGTATTATCTGTATCTGAAATAGAG
back to top

protein sequence of SMED30003321-orf-1

>SMED30003321-orf-1 ID=SMED30003321-orf-1|Name=SMED30003321-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1286bp
MINVSQMKNNEIIQMLLDDGESKAVPHQIKENPRTLALRHGNCVEKKIKS
NNDHKRSSSESKKDFYPTEKDGDLFSKLVDNGTEKGSTISEKFPNGVSIS
KELNFTGECFETLIDSVLLCQTNYSFIIGIFFKYAKFLRGQNILRLKDFI
EKKYFSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVGFT
ILFVLFIGIILILIGTYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPS
QGQNYNSNELRFIYTHLVLSNYSNNFHAIAKFIESIWSSIEKNYNNFFIR
LMKASLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLST
VFNNKLILIGFSFLAIVLFICIIILLFLTVKIIFCVIHSPTHNLKGFLKS
YNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDL
KVLMEFCSFCHVLLKNNNDITMCFLILIDNQIYSLAKSSEEIINFIKFSK
LLSLSLHFNDCTTMGSFNSNLNDVPLKPDQKVMKINDKAQIFDNIHYIGV
NANCERFKPELIIQKLYKSIDENPNDSLEEMNIQNISDYLIIKSKLSDFN
VTYVKELVITSMFSYKLSQLQNINTDIYKLIDLVTFYYHWPFLYSWMTLF
IVNNIYVLKKSLSLRKLYENIMRNMLQSMIEEQFLLELSKLDLDLNVLES
MMMHNYIGELTIEEFLILTHACHLQNIPMQNFLKNAVKKNEMKKTKCTNS
LYDGFSDRSYSSKTNNCPIYPPNNTNEILLDSEKHLKTPKNVQKCIQNIK
ELFSSLILSEISLDNVIWMISQIDEISKENIAKYQEKIKEINANGLVLAT
CDPNELRKELQMSFGDWHLFYTLISYLKSIEEASESSFFQEIIEPVSKVS
PYNPLLLLEKKTSLLIDMNEENSNEIISEESNGKLCDKCYISQKININSD
TDSIWKRKICNHNSSLGKDNFLSPMSKSPISSPKCLGNSLIQTNSSRSYQ
QPSNELSNLFPPRDIEINPSLDNDPFLQRTKSLPREASFDSTTTFSTQLS
SPRNSKCLYDMDSKSRTYTLPTDKSKRASLVKVKHNIGCQSYNHLQSQFF
SEHLGNISPENVAVLIDAPPSKFQTYLQKSDRSYHSSLFEINNNLDKTIT
HDKPYKKHYTETKKSYSQSNIHKQLSKRKQTNKQEENAAIIVKPIAPNSI
ESHSRENINSYSYYNTREIEPDIIFRSKYYSNGIESVNPKLNKKKRDEKP
HHEKSSGKEKPKKPTKHKINKYGEGINYEISHSEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 824..844
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1239..1260
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1236..1285
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1161..1186
NoneNo IPR availablePANTHERPTHR24116FAMILY NOT NAMEDcoord: 596..963
NoneNo IPR availableTMHMMTMhelixcoord: 636..658
NoneNo IPR availableTMHMMTMhelixcoord: 319..341
NoneNo IPR availableTMHMMTMhelixcoord: 195..217
NoneNo IPR availableTMHMMTMhelixcoord: 169..191
NoneNo IPR availableTMHMMTMhelixcoord: 356..378