SMED30003316

Overview
NameSMED30003316
Smed IDSMED30003316
Length (bp)988
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30003316 (SMED30003316) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30003316 (SMED30003316) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30003316 (SMED30003316) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30003316 (SMED30003316) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003316

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30003316SMESG000075349.1 dd_Smed_v4_3126_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003316SMESG000075349.1 dd_Smed_v4_3126_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003316SMESG000075349.1 dd_Smed_v4_3126_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003316SMESG000075349.1 dd_Smed_v4_3126_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003316SMESG000075349.1 Contig52685uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003316SMESG000075349.1 Contig52685newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003316SMESG000075349.1 Contig26396uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003316SMESG000075349.1 Contig26396newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30003316 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001557:6354..25255 +4911
Homology
BLAST of SMED30003316 vs. TrEMBL
Match: A0A3P8S0K1 (2',3'-cyclic nucleotide 3' phosphodiesterase OS=Amphiprion percula OX=161767 GN=CNP PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 7.698e-8
Identity = 55/212 (25.94%), Postives = 97/212 (45.75%), Query Frame = 1
Query:  373 QEFDMPTFSGWFWNNHLQKKMHSFSRKCFKEI-------LNVGDCNSQLEKELRADKLENYWIKQKKRLHITAAYIGNKEPQEQAQYL-NKVFKQFYMTT-KVSVTGLLLTPRTISCHAVVNDREIWLFDQSLKEKFHLL----THVTVRTAPGVSPVESGPDELKIQEMILSKKIPKQTFETRLGTVQDWGNCCFYMMLKKHYKYDLMFLS 969
            +E D+P F GWF  + +Q+K+   S    K +        ++ D   + EKE+    LE Y+ K K  LH T  +    + +   +Y  N   K  Y +  ++S+T L +TPRT+     + D ++ L+    ++   L      H+T+  A GV PV++G D L I  +    +  +   E  LG++  +G   + + L++       F S
Sbjct:  413 EEVDLPLFFGWFLLSSVQEKVRCTSMDFLKTLDTLEAFKKHLADFTGKAEKEV---DLEQYF-KPKGALHCTTKFCNYGKAEGAKEYAENPAVKALYGSAFELSLTALFVTPRTVGARVSLTDEQLQLWPADAEQSSSLPPGSRAHITLGCAEGVEPVQTGLDLLDILALQQDGQQGEPAEEMELGSLTYYGEGRWLLSLREPIGAPACFSS 620          
BLAST of SMED30003316 vs. TrEMBL
Match: A0A3Q1B665 (2',3'-cyclic nucleotide 3' phosphodiesterase OS=Amphiprion ocellaris OX=80972 GN=CNP PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.030e-7
Identity = 55/212 (25.94%), Postives = 97/212 (45.75%), Query Frame = 1
Query:  373 QEFDMPTFSGWFWNNHLQKKMHSFSRKCFKEI-------LNVGDCNSQLEKELRADKLENYWIKQKKRLHITAAYIGNKEPQEQAQYL-NKVFKQFYMTT-KVSVTGLLLTPRTISCHAVVNDREIWLFDQSLKEKFHLL----THVTVRTAPGVSPVESGPDELKIQEMILSKKIPKQTFETRLGTVQDWGNCCFYMMLKKHYKYDLMFLS 969
            +E D+P F GWF  + +Q+K+   S    K +        ++ D   + EKE+    LE Y+ K K  LH T  +    + +   +Y  N   K  Y +  ++S+T L +TPRT+     + D ++ L+    ++   L      H+T+  A GV PV++G D L I  +    +  +   E  LG++  +G   + + L++       F S
Sbjct:  443 EEVDLPLFFGWFLLSSVQEKVRCTSMDFLKTLDTLEAFKKHLADFTGKAEKEV---DLEQYF-KPKGALHCTTKFCNYGKAEGAKEYAENPAVKALYGSAFELSLTALFVTPRTVGARVSLTDEQLQLWPADAEQSSSLPPGSRAHITLGCAEGVEPVQTGLDLLDILALQQDGQQGEPAEEMELGSLTYYGEGRWLLSLREPIGAPACFSS 650          
BLAST of SMED30003316 vs. TrEMBL
Match: A0A3B3Q739 (Uncharacterized protein OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.763e-6
Identity = 57/213 (26.76%), Postives = 101/213 (47.42%), Query Frame = 1
Query:  376 EFDMPTFSGWFWNNHLQKKMHSFSRKCFKEILN-------VGDCNSQLEKELRADKLENYWIKQKKRLHITAAYIGNKEPQEQAQYLNK--VFKQFYMTTKVSVTGLLLTPRTISCHAVVNDREIWLF-DQSLKEKFHLLT--HVTVRTAPGVSPVESGPDELKIQEMILSKKIPKQTFETR---LGTVQDWGNCCFYMMLKKHYKYDLMFLS 969
            E  +P F GWF ++  Q K+ S +    K + N       +GD +   EK +    LE Y+   K  LH T  +    + Q   +Y+ K  V + +   +++ +T L +TPRT      +++ ++ L+ + S KE     +  HVT+  A GV PV++G   L + E+I  KK  ++  + +   LG +  +G   + + LK+  +    F S
Sbjct:  360 ETSVPFFFGWFLSSSYQDKLRSMASDFLKILGNLDAFKKHIGDFSGDPEKGV---DLEQYF-SDKGVLHCTTKFCDYGKEQGAKEYMEKQEVCESYGRASELELTALFITPRTAGAQVSLSEAQLQLWPEDSEKEDLPRGSRAHVTLGCAEGVEPVQTG---LDLLEIIAQKKQGEEGEKIQDLDLGALTYYGKGAWMLSLKEPIRAQSCFSS 565          
BLAST of SMED30003316 vs. TrEMBL
Match: A0A3Q1FLM1 (2',3'-cyclic nucleotide 3' phosphodiesterase OS=Acanthochromis polyacanthus OX=80966 GN=CNP PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 2.013e-6
Identity = 53/207 (25.60%), Postives = 92/207 (44.44%), Query Frame = 1
Query:  373 QEFDMPTFSGWFWNNHLQKKMHSFSRKCFKEILNVGDCNSQLEKELRADKLENYWIKQKKRLHITAAYIGNKEPQEQAQYL-NKVFKQFYMTT-KVSVTGLLLTPRTISCHAVVNDREI--WLFDQSLKEKFHL----LTHVTVRTAPGVSPVESGPDELKIQEMILSKKIPKQTFETRLGTVQDWGNCCFYMMLKKHYKYDLMFLS 969
            +E D+P F GWF  + +Q+K+   S    K +  +    ++   E   D LE Y+ K    LH T  +    + +   +Y  N V    Y +  ++S+T L +TPRT+     + D ++  W  D        L      H+T+  A GV PV++G D L+I  +    +  +   E  LG++  +G   + + L++       F S
Sbjct:  233 EEVDLPLFFGWFLLSSVQEKVRCTSMDFLKTLDTLEAFKNRRISENEVD-LEQYF-KPTGALHCTTKFCNYGKAEGAKEYAENPVRNSLYGSAFELSLTALFVTPRTVGARVSLTDEQLKLWPADAEQSSAASLPPGSRAHITLGCAEGVEPVQTGVDLLEILALQQDGQQGEPAEEMELGSLTYYGEGRWLLNLREPIGAPACFSS 437          
BLAST of SMED30003316 vs. TrEMBL
Match: A0A1W0WMG9 (Putative 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Hypsibius dujardini OX=232323 GN=BV898_09631 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 5.383e-6
Identity = 55/209 (26.32%), Postives = 92/209 (44.02%), Query Frame = 1
Query:  385 MPTFSGWFWNNHLQKKMHSFSRKCFKEILNVGDCNSQLEKEL---------RADKLENYWIKQKKRLHITAAYIGNKEPQEQAQYLNKVFKQFYMTT--KVSVTGLLLTPRTISCHAVVNDREIWLFDQSLKEKFHLL-----THVTVRTAPGVSPVESGPDELKIQEMILSKKIPKQTFETRLGTVQDWGNCCFYMMLKKHYKYDLMF 963
            +P + G+  +     K+   + K  + +L V + +   + E          R+D     W K+  + H TA Y    +    ++Y   V  Q  +     + V GLL+TP+TIS H  +N+ ++ L+ Q    K   L      H+TV TA G+  V++G D LK+ E+    K P+ T     GTV  +    +Y+   K    D +F
Sbjct:  255 IPVYYGFMVSADDSGKLRLLAAKLARTMLQVDELSQAADGEADLLVNEFAKRSDDELVAW-KESDQFHCTAFYTAFGKRLGASEYDKSVVVQQNLGKHHGLEVLGLLVTPQTISFHVRLNEGQLRLWKQEENVKTPGLPPGSRAHLTVVTAKGIEAVQAGHDTLKLAELTALGK-PQVTSSIAAGTVFKYAEDFWYLARDKPMVVDTVF 461          
BLAST of SMED30003316 vs. Ensembl Cavefish
Match: cnp (2',3'-cyclic nucleotide 3' phosphodiesterase [Source:NCBI gene;Acc:103043047])

HSP 1 Score: 53.1434 bits (126), Expect = 1.706e-7
Identity = 62/232 (26.72%), Postives = 101/232 (43.53%), Query Frame = 1
Query:  373 QEFDMPTFSGWFWNNHLQKKMHSFSR---------KCFKEILNVGDCNSQLEKELRADKLENYWIKQKKRLHITAAYI------GNKEPQEQAQYLNKVFKQFYMTTKVSVTGLLLTPRTISCHAVVNDREIWLFDQSL-KEKFHLLT-------------HVTVRTAPGVSPVESGPDELKIQEMILSKKIPKQTFET----RLGTVQDWGNCCFYMMLKKHYKYDLMFLS 969
            +E ++P F GWF  + +++++   +          + FK  LN  +   + EKE+    LE Y+ + K  LH T  +       G+KE  EQ      V      + ++SV GL++TPRT   H  +   ++ L+ +   KE     +             HVT+  A  V  V++GPD L     IL++K   Q   T     LGT+   G   +Y+ L++    D  F S
Sbjct:  172 KEPEIPEFFGWFLLSEVEERIKCSTMDFIKTLDTLEAFKTHLN--EFTGEAEKEV---DLEQYF-QNKGPLHCTTKFCDYGKAEGSKEYAEQ----QVVKDALGNSAELSVVGLMVTPRTFGAHVALTTEQLQLWPEGADKEGVPEASLPSVEALPVGSRAHVTLGCAANVEAVQTGPDLLD----ILAQKKGGQEASTVEELELGTLSYLGGGRWYLTLREAVTCDTTFSS 389          
BLAST of SMED30003316 vs. Ensembl Sea Lamprey
Match: CNP (2',3'-cyclic nucleotide 3' phosphodiesterase [Source:HGNC Symbol;Acc:HGNC:2158])

HSP 1 Score: 46.9802 bits (110), Expect = 2.828e-6
Identity = 41/176 (23.30%), Postives = 71/176 (40.34%), Query Frame = 1
Query:  373 QEFDMPTFSGWFWNNHLQKKMHSFSRKCFKEILNVGDCNSQLEK------------ELRADKLENYWIKQKKRLHITAAYIGNKEPQEQAQYLNK--VFKQFYMTTKVSVTGLLLTPRTISCHAVVNDREIWLFDQSLKEKFHLL--------THVTVRTAPGVSPVESGPDELKI 834
            QE  +P + GWF      + M   S     +I  + +  S+ +             +L A    + ++     LH TA +  N E     +Y     V +       + VT LL+TPRT+     ++  ++ L+D +       +         H+++  APGV PV++G D L I
Sbjct:   80 QEALVPLYFGWFLTKGSVQTMCKISDTFLLKIAAISEFASEFQPFMKWQNEQDQKMDLGAYFRRSMFVGGPNVLHCTAMFCANGEVPGSEEYATSQAVQESCGHAFVLQVTALLVTPRTVGARVQLSAAQMALWDPNDCSSHCTVPNLPRGSRAHISLGCAPGVEPVQTGVDLLDI 255          
BLAST of SMED30003316 vs. Planmine SMEST
Match: SMESG000075349.1 (SMESG000075349.1)

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 295/295 (100.00%), Postives = 295/295 (100.00%), Query Frame = 1
Query:   91 MKRCNALFIIKNKKNSENFKNAIVKSYKCEDMTKKNEEQIQEFLKSKTNFTHFILDSKLPNLQLIVAMKQKTQFMPFVVSEHFDDTFHDTFEIGQEFDMPTFSGWFWNNHLQKKMHSFSRKCFKEILNVGDCNSQLEKELRADKLENYWIKQKKRLHITAAYIGNKEPQEQAQYLNKVFKQFYMTTKVSVTGLLLTPRTISCHAVVNDREIWLFDQSLKEKFHLLTHVTVRTAPGVSPVESGPDELKIQEMILSKKIPKQTFETRLGTVQDWGNCCFYMMLKKHYKYDLMFLSSQ 975
            MKRCNALFIIKNKKNSENFKNAIVKSYKCEDMTKKNEEQIQEFLKSKTNFTHFILDSKLPNLQLIVAMKQKTQFMPFVVSEHFDDTFHDTFEIGQEFDMPTFSGWFWNNHLQKKMHSFSRKCFKEILNVGDCNSQLEKELRADKLENYWIKQKKRLHITAAYIGNKEPQEQAQYLNKVFKQFYMTTKVSVTGLLLTPRTISCHAVVNDREIWLFDQSLKEKFHLLTHVTVRTAPGVSPVESGPDELKIQEMILSKKIPKQTFETRLGTVQDWGNCCFYMMLKKHYKYDLMFLSSQ
Sbjct:    1 MKRCNALFIIKNKKNSENFKNAIVKSYKCEDMTKKNEEQIQEFLKSKTNFTHFILDSKLPNLQLIVAMKQKTQFMPFVVSEHFDDTFHDTFEIGQEFDMPTFSGWFWNNHLQKKMHSFSRKCFKEILNVGDCNSQLEKELRADKLENYWIKQKKRLHITAAYIGNKEPQEQAQYLNKVFKQFYMTTKVSVTGLLLTPRTISCHAVVNDREIWLFDQSLKEKFHLLTHVTVRTAPGVSPVESGPDELKIQEMILSKKIPKQTFETRLGTVQDWGNCCFYMMLKKHYKYDLMFLSSQ 295          
BLAST of SMED30003316 vs. Planmine SMEST
Match: SMESG000075364.1 (SMESG000075364.1)

HSP 1 Score: 343.199 bits (879), Expect = 5.246e-118
Identity = 164/306 (53.59%), Postives = 225/306 (73.53%), Query Frame = 1
Query:   55 MHLLKNENSIIWMKRCNALFIIKNKKNS--ENFKNAIVKSYKCEDMTKKNEEQIQEFLKSKTNFTHFILDSKLPNLQLIVAMKQKTQFMPFVVSEHFDDTFHDTFEIGQEFDMPTFSGWFWNNHLQKKMHSFSRKCFKEILNVGDCNSQLEKELRADKLENYWIKQKKRLHITAAYIGNKEPQEQAQYLNKVFKQFYMTTKVSVTGLLLTPRTISCHAVVNDREIWLFDQSLKEKFHLLTHVTVRTAPGVSPVESGPDELKIQEMILSKKIPKQTFETRLGTVQDWGNCCFYMMLKKHYKYDLMFL 966
            MHL+K   SI WMKRCNALFI+K+ +N   + + + +VK YKCED TK  EE+++EF+KS+TN THF+ DSKL NL+ I+ MKQ+TQFMP  +   +  +F D+F + ++ D P + GWFWNN  Q+ ++  ++ C KEIL V D    L K+L+ D+L+NYW +QKKRLH+TA YIGNK+ ++  QYL+KVFKQFY TT+  +TG LLTP+T S H  +++   W+FD + +++FHLLTHVTV TAP V PV+SG D LKIQ+MI SKK+PKQ  + ++GTV DWG+CCFY++LK+    DLMFL
Sbjct:    1 MHLIKKTKSIKWMKRCNALFILKDFQNDTKQGYIHELVKIYKCEDTTKMKEEEVREFVKSETNRTHFLFDSKLQNLRSILNMKQETQFMPIPLVAIYYKSFDDSFGLCEKSDWPVYVGWFWNNRFQRHLYDLAKFCLKEILEVDDFKLNLVKKLKNDQLDNYWTEQKKRLHVTAMYIGNKKTRQNEQYLDKVFKQFYTTTESHLTGFLLTPKTFSAHVNLSENVKWMFDPAQQDEFHLLTHVTVATAPNVRPVQSGLDMLKIQKMIKSKKVPKQQVDIKVGTVYDWGDCCFYVVLKEPLNNDLMFL 306          
BLAST of SMED30003316 vs. Planmine SMEST
Match: SMESG000075364.1 (SMESG000075364.1)

HSP 1 Score: 328.946 bits (842), Expect = 1.251e-112
Identity = 157/294 (53.40%), Postives = 217/294 (73.81%), Query Frame = 1
Query:   91 MKRCNALFIIKNKKNS--ENFKNAIVKSYKCEDMTKKNEEQIQEFLKSKTNFTHFILDSKLPNLQLIVAMKQKTQFMPFVVSEHFDDTFHDTFEIGQEFDMPTFSGWFWNNHLQKKMHSFSRKCFKEILNVGDCNSQLEKELRADKLENYWIKQKKRLHITAAYIGNKEPQEQAQYLNKVFKQFYMTTKVSVTGLLLTPRTISCHAVVNDREIWLFDQSLKEKFHLLTHVTVRTAPGVSPVESGPDELKIQEMILSKKIPKQTFETRLGTVQDWGNCCFYMMLKKHYKYDLMFL 966
            MKRCNALFI+K+ +N   + + + +VK YKCED TK  EE+++EF+KS+TN THF+ DSKL NL+ I+ MKQ+TQFMP  +   +  +F D+F + ++ D P + GWFWNN  Q+ ++  ++ C KEIL V D    L K+L+ D+L+NYW +QKKRLH+TA YIGNK+ ++  QYL+KVFKQFY TT+  +TG LLTP+T S H  +++   W+FD + +++FHLLTHVTV TAP V PV+SG D LKIQ+MI SKK+PKQ  + ++GTV DWG+CCFY++LK+    DLMFL
Sbjct:    1 MKRCNALFILKDFQNDTKQGYIHELVKIYKCEDTTKMKEEEVREFVKSETNRTHFLFDSKLQNLRSILNMKQETQFMPIPLVAIYYKSFDDSFGLCEKSDWPVYVGWFWNNRFQRHLYDLAKFCLKEILEVDDFKLNLVKKLKNDQLDNYWTEQKKRLHVTAMYIGNKKTRQNEQYLDKVFKQFYTTTESHLTGFLLTPKTFSAHVNLSENVKWMFDPAQQDEFHLLTHVTVATAPNVRPVQSGLDMLKIQKMIKSKKVPKQQVDIKVGTVYDWGDCCFYVVLKEPLNNDLMFL 294          
BLAST of SMED30003316 vs. Planmine SMEST
Match: SMESG000075346.1 (SMESG000075346.1)

HSP 1 Score: 180.259 bits (456), Expect = 1.600e-55
Identity = 91/194 (46.91%), Postives = 118/194 (60.82%), Query Frame = 1
Query:  385 MPTFSGWFWNNHLQKKMHSFSRKCFKEILNVGDCNSQLEKELRADKLENYWIKQKKRLHITAAYIGNKEPQEQAQYLNKVFKQFYMTTKVSVTGLLLTPRTISCHAVVNDREIWLFDQSLKEKFHLLTHVTVRTAPGVSPVESGPDELKIQEMILSKKIPKQTFETRLGTVQDWGNCCFYMMLKKHYKYDLMFL 966
            +P F GWFWN   +K++H       + IL V D  +QL    +++ L  YWIKQ KRLH+TA ++G +  + + +YL +V+K F  +    VTG LLTPRT S H  +     W+FD S ++ F LL HVTVR AP +SPV SG D++ IQ+MI   KIPKQ F    G VQDWGNC FY  LKK   Y L FL
Sbjct:   13 IPNFVGWFWNELDEKELHRIETDFLERILAVKDLRNQLYNCTKSNDLMQYWIKQSKRLHVTAMFLGKRTAKSR-KYLKRVYKMFNTSNTAVVTGFLLTPRTYSGHVELPVNTRWMFDPSKQDLFTLLPHVTVRLAPHISPVVSGEDQVPIQKMIKENKIPKQQFSLDWGLVQDWGNCQFYAALKKPLVYSLQFL 205          
BLAST of SMED30003316 vs. Planmine SMEST
Match: SMESG000075346.1 (SMESG000075346.1)

HSP 1 Score: 180.259 bits (456), Expect = 3.231e-55
Identity = 91/194 (46.91%), Postives = 118/194 (60.82%), Query Frame = 1
Query:  385 MPTFSGWFWNNHLQKKMHSFSRKCFKEILNVGDCNSQLEKELRADKLENYWIKQKKRLHITAAYIGNKEPQEQAQYLNKVFKQFYMTTKVSVTGLLLTPRTISCHAVVNDREIWLFDQSLKEKFHLLTHVTVRTAPGVSPVESGPDELKIQEMILSKKIPKQTFETRLGTVQDWGNCCFYMMLKKHYKYDLMFL 966
            +P F GWFWN   +K++H       + IL V D  +QL    +++ L  YWIKQ KRLH+TA ++G +  + + +YL +V+K F  +    VTG LLTPRT S H  +     W+FD S ++ F LL HVTVR AP +SPV SG D++ IQ+MI   KIPKQ F    G VQDWGNC FY  LKK   Y L FL
Sbjct:   35 IPNFVGWFWNELDEKELHRIETDFLERILAVKDLRNQLYNCTKSNDLMQYWIKQSKRLHVTAMFLGKRTAKSR-KYLKRVYKMFNTSNTAVVTGFLLTPRTYSGHVELPVNTRWMFDPSKQDLFTLLPHVTVRLAPHISPVVSGEDQVPIQKMIKENKIPKQQFSLDWGLVQDWGNCQFYAALKKPLVYSLQFL 227          
The following BLAST results are available for this feature:
BLAST of SMED30003316 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003316 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003316 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003316 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003316 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003316 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003316 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003316 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8S0K17.698e-825.942',3'-cyclic nucleotide 3' phosphodiesterase OS=Am... [more]
A0A3Q1B6651.030e-725.942',3'-cyclic nucleotide 3' phosphodiesterase OS=Am... [more]
A0A3B3Q7391.763e-626.76Uncharacterized protein OS=Paramormyrops kingsleya... [more]
A0A3Q1FLM12.013e-625.602',3'-cyclic nucleotide 3' phosphodiesterase OS=Ac... [more]
A0A1W0WMG95.383e-626.32Putative 2',3'-cyclic-nucleotide 3'-phosphodiester... [more]
back to top
BLAST of SMED30003316 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cnp1.706e-726.722',3'-cyclic nucleotide 3' phosphodiesterase [Sour... [more]
back to top
BLAST of SMED30003316 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CNP2.828e-623.302',3'-cyclic nucleotide 3' phosphodiesterase [Sour... [more]
back to top
BLAST of SMED30003316 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003316 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003316 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003316 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075349.10.000e+0100.00SMESG000075349.1[more]
SMESG000075364.15.246e-11853.59SMESG000075364.1[more]
SMESG000075364.11.251e-11253.40SMESG000075364.1[more]
SMESG000075346.11.600e-5546.91SMESG000075346.1[more]
SMESG000075346.13.231e-5546.91SMESG000075346.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003316 ID=SMED30003316|Name=SMED30003316|organism=Schmidtea mediterranea sexual|type=transcript|length=988bp
ACATAATTTTCGAAAGTCAAAATTGTTAACAGATTTTCAAAGTCTTTAAT
TTTGATGCATTTGTTAAAAAACGAAAATTCTATTATTTGGATGAAGCGAT
GTAATGCTCTGTTCATTATAAAAAACAAAAAGAATTCTGAAAATTTCAAG
AATGCTATTGTTAAAAGTTATAAATGTGAAGATATGACAAAAAAGAATGA
AGAACAAATTCAAGAGTTCCTTAAATCTAAAACAAATTTCACTCATTTTA
TTCTCGATTCCAAACTACCGAACCTTCAATTAATAGTAGCTATGAAACAA
AAAACCCAATTTATGCCTTTCGTTGTATCTGAACATTTTGATGATACATT
TCATGATACATTTGAAATAGGACAAGAATTTGATATGCCAACCTTCTCTG
GTTGGTTTTGGAACAATCATTTGCAAAAAAAAATGCATAGCTTTTCAAGA
AAGTGTTTCAAAGAAATATTAAATGTTGGTGATTGTAATAGTCAATTGGA
AAAGGAATTGAGAGCGGACAAATTAGAGAACTATTGGATAAAACAGAAAA
AGCGATTACACATTACTGCAGCGTATATAGGAAATAAAGAACCACAAGAG
CAAGCACAATATTTAAACAAAGTATTCAAACAATTTTACATGACTACCAA
AGTTTCTGTCACTGGACTTTTGCTGACTCCTAGGACAATCAGCTGTCATG
CTGTCGTAAATGATAGAGAAATATGGTTGTTTGATCAATCTCTAAAAGAA
AAATTTCATTTGCTGACCCACGTTACGGTGAGGACAGCACCGGGTGTTAG
CCCAGTGGAATCGGGGCCCGACGAGTTAAAAATACAAGAAATGATACTAT
CGAAGAAAATACCTAAGCAAACTTTTGAAACTAGATTGGGAACGGTGCAG
GATTGGGGAAATTGCTGTTTCTATATGATGCTGAAAAAACATTATAAATA
CGATTTGATGTTTTTGTCTAGCCAATAATAATATATAT
back to top

protein sequence of SMED30003316-orf-1

>SMED30003316-orf-1 ID=SMED30003316-orf-1|Name=SMED30003316-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=308bp
MHLLKNENSIIWMKRCNALFIIKNKKNSENFKNAIVKSYKCEDMTKKNEE
QIQEFLKSKTNFTHFILDSKLPNLQLIVAMKQKTQFMPFVVSEHFDDTFH
DTFEIGQEFDMPTFSGWFWNNHLQKKMHSFSRKCFKEILNVGDCNSQLEK
ELRADKLENYWIKQKKRLHITAAYIGNKEPQEQAQYLNKVFKQFYMTTKV
SVTGLLLTPRTISCHAVVNDREIWLFDQSLKEKFHLLTHVTVRTAPGVSP
VESGPDELKIQEMILSKKIPKQTFETRLGTVQDWGNCCFYMMLKKHYKYD
LMFLSSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR008431CNPase
IPR009097Cyclic_Pdiesterase
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005615extracellular space
GO:0005737cytoplasm
GO:0005741mitochondrial outer membrane
GO:0005743mitochondrial inner membrane
GO:0005886plasma membrane
GO:0005902microvillus
GO:0031143pseudopodium
GO:0035748myelin sheath abaxonal region
GO:0035749myelin sheath adaxonal region
GO:0042470melanosome
GO:0042995cell projection
GO:0043209myelin sheath
GO:0048471perinuclear region of cytoplasm
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0009214cyclic nucleotide catabolic process
GO:0000226microtubule cytoskeleton organization
GO:0007409axonogenesis
GO:0007568aging
GO:0008344adult locomotory behavior
GO:0009636response to toxic substance
GO:0021762substantia nigra development
GO:0030900forebrain development
GO:0032496response to lipopolysaccharide
GO:0046902regulation of mitochondrial membrane permeability
GO:0048709oligodendrocyte differentiation
Vocabulary: molecular function
TermDefinition
GO:00041132',3'-cyclic-nucleotide 3'-phosphodiesterase activity
GO:0003723RNA binding
GO:0016787hydrolase activity
GO:0030551cyclic nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008431Cyclic nucleotide phosphodiesterasePFAMPF05881CNPasecoord: 111..304
e-value: 1.4E-12
score: 47.7
NoneNo IPR availableGENE3DG3DSA:3.90.1740.10coord: 106..306
e-value: 5.6E-27
score: 96.8
IPR009097Cyclic phosphodiesteraseSUPERFAMILYSSF55144LigT-likecoord: 111..303