SMED30003313

Overview
NameSMED30003313
Smed IDSMED30003313
Length (bp)460
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30003313 (SMED30003313) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30003313 (SMED30003313) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003313

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003313 dd_Smed_v4_616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003313 dd_Smed_v4_616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003313 dd_Smed_v4_616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003313 dd_Smed_v4_616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003313 dd_Smed_v4_616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30003313 dd_Smed_v4_616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30003313 dd_Smed_v6_616_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30003313 dd_Smed_v6_616_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003313 dd_Smed_v6_616_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30003313 dd_Smed_v6_616_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003313 dd_Smed_v6_616_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003313 dd_Smed_v4_616_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30003313 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001578:63455..64034 -2149
Homology
BLAST of SMED30003313 vs. Ensembl Human
Match: SELENOW (selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752])

HSP 1 Score: 86.2705 bits (212), Expect = 1.969e-22
Identity = 43/79 (54.43%), Postives = 51/79 (64.56%), Query Frame = -2
Query:  148 LYSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEALKQ 384
            +Y G+ GY SK+  LKK LE EFP +L I    TP  TG+FEV V GKLIHSKK GD +VD + K  K+  AI  AL Q
Sbjct:    8 VYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQ 86          
BLAST of SMED30003313 vs. Ensembl Human
Match: SELENOW (selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752])

HSP 1 Score: 86.2705 bits (212), Expect = 1.969e-22
Identity = 43/79 (54.43%), Postives = 51/79 (64.56%), Query Frame = -2
Query:  148 LYSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEALKQ 384
            +Y G+ GY SK+  LKK LE EFP +L I    TP  TG+FEV V GKLIHSKK GD +VD + K  K+  AI  AL Q
Sbjct:    8 VYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQ 86          
BLAST of SMED30003313 vs. Ensembl Human
Match: SELENOW (selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752])

HSP 1 Score: 86.2705 bits (212), Expect = 1.969e-22
Identity = 43/79 (54.43%), Postives = 51/79 (64.56%), Query Frame = -2
Query:  148 LYSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEALKQ 384
            +Y G+ GY SK+  LKK LE EFP +L I    TP  TG+FEV V GKLIHSKK GD +VD + K  K+  AI  AL Q
Sbjct:    8 VYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQ 86          
BLAST of SMED30003313 vs. Ensembl Human
Match: SELENOW (selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752])

HSP 1 Score: 83.1889 bits (204), Expect = 3.661e-21
Identity = 42/77 (54.55%), Postives = 49/77 (63.64%), Query Frame = -2
Query:  148 SGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEALKQ 378
             G+ GY SK+  LKK LE EFP +L I    TP  TG+FEV V GKLIHSKK GD +VD + K  K+  AI  AL Q
Sbjct:   11 CGAGGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQ 87          
BLAST of SMED30003313 vs. Ensembl Human
Match: SELENOW (selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752])

HSP 1 Score: 83.1889 bits (204), Expect = 3.701e-21
Identity = 43/79 (54.43%), Postives = 51/79 (64.56%), Query Frame = -2
Query:  148 LYSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEALKQ 384
            +Y G+ GY SK+  LKK LE EFP +L I    TP  TG+FEV V GKLIHSKK GD +VD + K  K+  AI  AL Q
Sbjct:    8 VYCGA-GYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQ 85          
BLAST of SMED30003313 vs. Ensembl Zebrafish
Match: selenow1 (selenoprotein W, 1 [Source:NCBI gene;Acc:352915])

HSP 1 Score: 99.7525 bits (247), Expect = 7.406e-28
Identity = 48/77 (62.34%), Postives = 56/77 (72.73%), Query Frame = -2
Query:  154 LYSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEAL 384
            +Y G  GY  KF  LK  LE EFPN+L IT   TP+ TGW EVEVNGKL+HSKKNGD FVD+D K+QKI  AI +A+
Sbjct:    8 VYCGGUGYRPKFIKLKTLLEDEFPNELEITGEGTPSTTGWLEVEVNGKLVHSKKNGDGFVDSDSKMQKIVTAIEQAM 84          
BLAST of SMED30003313 vs. Ensembl Mouse
Match: Selenow (selenoprotein W [Source:MGI Symbol;Acc:MGI:1100878])

HSP 1 Score: 83.1889 bits (204), Expect = 2.625e-21
Identity = 40/79 (50.63%), Postives = 50/79 (63.29%), Query Frame = -2
Query:  148 LYSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEALKQ 384
            +Y G+ GY  K+  LK+ LE EFP  L I    TP  TG+FEV V GKL+HSKK GD +VD + K +K+  AI  AL Q
Sbjct:    8 VYCGAUGYKPKYLQLKEKLEHEFPGCLDICGEGTPQVTGFFEVTVAGKLVHSKKRGDGYVDTESKFRKLVTAIKAALAQ 86          
BLAST of SMED30003313 vs. Ensembl Mouse
Match: Selenov (selenoprotein V [Source:MGI Symbol;Acc:MGI:3608324])

HSP 1 Score: 63.1586 bits (152), Expect = 5.324e-12
Identity = 38/84 (45.24%), Postives = 50/84 (59.52%), Query Frame = -2
Query:  148 VL*LFLYSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEALKQ 399
            +L   +Y G   YG ++  LK+ LE +FPN L          TG FEV V+GKLIHSKK GD FVD +  L+K+  AI E +K+
Sbjct:  245 ILIRVMYCGLUSYGLRYIILKRTLEHQFPNLLEFEEERATQVTGEFEVFVDGKLIHSKKKGDGFVD-ESGLKKLVGAIDEEIKK 327          
BLAST of SMED30003313 vs. Ensembl Mouse
Match: Selenov (selenoprotein V [Source:MGI Symbol;Acc:MGI:3608324])

HSP 1 Score: 44.2838 bits (103), Expect = 9.330e-7
Identity = 25/42 (59.52%), Postives = 31/42 (73.81%), Query Frame = -2
Query:  148 TGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEALKQ 273
            TG FEV V+GKLIHSKK GD FVD +  L+K+  AI E +K+
Sbjct:    5 TGEFEVFVDGKLIHSKKKGDGFVD-ESGLKKLVGAIDEEIKK 45          
BLAST of SMED30003313 vs. UniProt/SwissProt
Match: sp|Q568W0|SELW_DANRE (Selenoprotein W OS=Danio rerio OX=7955 GN=selenow PE=3 SV=3)

HSP 1 Score: 99.7525 bits (247), Expect = 4.951e-27
Identity = 48/77 (62.34%), Postives = 56/77 (72.73%), Query Frame = -2
Query:  154 LYSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEAL 384
            +Y G  GY  KF  LK  LE EFPN+L IT   TP+ TGW EVEVNGKL+HSKKNGD FVD+D K+QKI  AI +A+
Sbjct:    8 VYCGGUGYRPKFIKLKTLLEDEFPNELEITGEGTPSTTGWLEVEVNGKLVHSKKNGDGFVDSDSKMQKIMTAIEQAM 84          
BLAST of SMED30003313 vs. UniProt/SwissProt
Match: sp|D0EYG3|SELW_CHICK (Selenoprotein W OS=Gallus gallus OX=9031 GN=SELENOW PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 9.152e-22
Identity = 40/77 (51.95%), Postives = 49/77 (63.64%), Query Frame = -2
Query:  154 LYSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEAL 384
            LY G+ GY  K++ L+ +LE  FP  L +    T   TGWFEV V  +L+HSKKNGD FVD D KLQ+I  AI  AL
Sbjct:    8 LYCGAUGYKPKYERLRAELEKRFPGALEMRGQGTQEVTGWFEVTVGSRLVHSKKNGDGFVDTDAKLQRIVAAIQAAL 84          
BLAST of SMED30003313 vs. UniProt/SwissProt
Match: sp|Q5NVB2|SELW_PONAB (Selenoprotein W OS=Pongo abelii OX=9601 GN=SELENOW PE=3 SV=4)

HSP 1 Score: 86.2705 bits (212), Expect = 9.457e-22
Identity = 43/79 (54.43%), Postives = 51/79 (64.56%), Query Frame = -2
Query:  148 LYSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEALKQ 384
            +Y G+ GY SK+  LKK LE EFP +L I    TP  TG+FEV V GKLIHSKK GD +VD + K  K+  AI  AL Q
Sbjct:    8 VYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQ 86          
BLAST of SMED30003313 vs. UniProt/SwissProt
Match: sp|P63303|SELW_MACMU (Selenoprotein W OS=Macaca mulatta OX=9544 GN=SELENOW PE=1 SV=3)

HSP 1 Score: 86.2705 bits (212), Expect = 9.457e-22
Identity = 43/79 (54.43%), Postives = 51/79 (64.56%), Query Frame = -2
Query:  148 LYSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEALKQ 384
            +Y G+ GY SK+  LKK LE EFP +L I    TP  TG+FEV V GKLIHSKK GD +VD + K  K+  AI  AL Q
Sbjct:    8 VYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQ 86          
BLAST of SMED30003313 vs. UniProt/SwissProt
Match: sp|P63302|SELW_HUMAN (Selenoprotein W OS=Homo sapiens OX=9606 GN=SELENOW PE=1 SV=3)

HSP 1 Score: 86.2705 bits (212), Expect = 9.457e-22
Identity = 43/79 (54.43%), Postives = 51/79 (64.56%), Query Frame = -2
Query:  148 LYSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEALKQ 384
            +Y G+ GY SK+  LKK LE EFP +L I    TP  TG+FEV V GKLIHSKK GD +VD + K  K+  AI  AL Q
Sbjct:    8 VYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQ 86          
BLAST of SMED30003313 vs. TrEMBL
Match: F6NSR1 (Selenoprotein W, 1 OS=Danio rerio OX=7955 GN=selenow1 PE=1 SV=3)

HSP 1 Score: 99.7525 bits (247), Expect = 1.657e-24
Identity = 48/77 (62.34%), Postives = 56/77 (72.73%), Query Frame = -2
Query:  154 LYSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEAL 384
            +Y G  GY  KF  LK  LE EFPN+L IT   TP+ TGW EVEVNGKL+HSKKNGD FVD+D K+QKI  AI +A+
Sbjct:    8 VYCGGCGYRPKFIKLKTLLEDEFPNELEITGEGTPSTTGWLEVEVNGKLVHSKKNGDGFVDSDSKMQKIVTAIEQAM 84          
BLAST of SMED30003313 vs. TrEMBL
Match: Q802G9 (Selenoprotein W, 1 OS=Danio rerio OX=7955 GN=selenow1 PE=2 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 2.125e-24
Identity = 48/77 (62.34%), Postives = 56/77 (72.73%), Query Frame = -2
Query:  154 LYSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEAL 384
            +Y G  GY  KF  LK  LE EFPN+L IT   TP+ TGW EVEVNGKL+HSKKNGD FVD+D K+QKI  AI +A+
Sbjct:    8 VYCGGUGYRPKFIKLKTLLEDEFPNELEITGEGTPSTTGWLEVEVNGKLVHSKKNGDGFVDSDSKMQKIVTAIEQAM 84          
BLAST of SMED30003313 vs. TrEMBL
Match: M4QNV7 (Selenoprotein W OS=Cristaria plicata OX=165446 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.617e-23
Identity = 46/77 (59.74%), Postives = 59/77 (76.62%), Query Frame = -2
Query:  151 YSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEALK 381
            Y G+ GYG+KF+ L+ +L+ +FP KL I+S ATPT TG+FEVEV+GKL+HSKK GD +VD D KL+KI D I   LK
Sbjct:    9 YCGAUGYGAKFRKLEAELQKKFPGKLEISSEATPTVTGFFEVEVDGKLLHSKKGGDGYVDTDAKLRKIVDGIQAKLK 85          
BLAST of SMED30003313 vs. TrEMBL
Match: A0A1B2LPW5 (Selenoprotein W OS=Chanodichthys ilishaeformis OX=291482 GN=SelW PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.815e-22
Identity = 46/78 (58.97%), Postives = 52/78 (66.67%), Query Frame = -2
Query:  154 FLYSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEAL 387
             +Y G  GY  KF  LK  LE EFP +L IT   TP+ TGW EVEVNGKL+HSKKNGD FVD D K + I  AI +AL
Sbjct:    7 IVYCGGUGYRPKFTKLKTLLEDEFPGELEITGEGTPSTTGWLEVEVNGKLVHSKKNGDGFVDTDSKFRAIVTAIEQAL 84          
BLAST of SMED30003313 vs. TrEMBL
Match: A0A1S3L0D7 (selenoprotein W OS=Salmo salar OX=8030 GN=sepw1 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 7.548e-22
Identity = 44/76 (57.89%), Postives = 53/76 (69.74%), Query Frame = -2
Query:  154 YSGS*GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEAL 381
            Y G  GYG KF  LK  LE EFP  L IT  +TP+ +GWFEVEVNGKL+HSKK G  FVDN++K+  + DAI + L
Sbjct:   52 YCGGUGYGPKFTRLKTQLEDEFPGDLEITGESTPSTSGWFEVEVNGKLVHSKKEGSGFVDNEQKMATLVDAIDKVL 127          
BLAST of SMED30003313 vs. Ensembl Cavefish
Match: selenow1 (selenoprotein W, 1 [Source:NCBI gene;Acc:352915])

HSP 1 Score: 87.0409 bits (214), Expect = 3.997e-23
Identity = 41/71 (57.75%), Postives = 52/71 (73.24%), Query Frame = -2
Query:  154 GYGSKFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEAL 366
            GY  K+  LK  LE EFP  L I+  +TP  +GWFEVEVNGKL+HSKKNGD FVD+D+K+ KI  AI +++
Sbjct:    3 GYRPKYTKLKTLLEDEFPGDLEISGESTPRTSGWFEVEVNGKLVHSKKNGDGFVDSDQKMAKIVSAIEKSI 73          
BLAST of SMED30003313 vs. Ensembl Cavefish
Match: selenow1 (selenoprotein W, 1 [Source:NCBI gene;Acc:352915])

HSP 1 Score: 82.4185 bits (202), Expect = 2.872e-21
Identity = 38/66 (57.58%), Postives = 49/66 (74.24%), Query Frame = -2
Query:  154 FQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEAL 351
            +  LK  LE EFP  L I+  +TP  +GWFEVEVNGKL+HSKKNGD FVD+D+K+ KI  AI +++
Sbjct:    3 YTKLKTLLEDEFPGDLEISGESTPRTSGWFEVEVNGKLVHSKKNGDGFVDSDQKMAKIVSAIEKSI 68          
BLAST of SMED30003313 vs. Ensembl Cavefish
Match: selenow1 (selenoprotein W, 1 [Source:NCBI gene;Acc:352915])

HSP 1 Score: 82.0333 bits (201), Expect = 3.519e-21
Identity = 38/67 (56.72%), Postives = 50/67 (74.63%), Query Frame = -2
Query:  154 KFQNLKKDLELEFPNKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEAL 354
            ++  LK  LE EFP  L I+  +TP  +GWFEVEVNGKL+HSKKNGD FVD+D+K+ KI  AI +++
Sbjct:    6 QYTKLKTLLEDEFPGDLEISGESTPRTSGWFEVEVNGKLVHSKKNGDGFVDSDQKMAKIVSAIEKSI 72          
BLAST of SMED30003313 vs. Ensembl Nematostella
Match: EDO35675 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKT9])

HSP 1 Score: 77.0258 bits (188), Expect = 9.269e-20
Identity = 37/64 (57.81%), Postives = 50/64 (78.12%), Query Frame = -2
Query:  154 LKKDLELEFP-NKLTITSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKIFDAIAEAL 342
            LK  ++ EF  N++ +TS ATP  TG+FEV VN +L+HSKKNGD +VD++KKL KIFD+I +AL
Sbjct:    2 LKSTIQAEFSSNEVEVTSYATPNVTGYFEVSVNDQLVHSKKNGDGYVDSEKKLAKIFDSITKAL 65          
The following BLAST results are available for this feature:
BLAST of SMED30003313 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SELENOW1.969e-2254.43selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752... [more]
SELENOW1.969e-2254.43selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752... [more]
SELENOW1.969e-2254.43selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752... [more]
SELENOW3.661e-2154.55selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752... [more]
SELENOW3.701e-2154.43selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752... [more]
back to top
BLAST of SMED30003313 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003313 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003313 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
selenow17.406e-2862.34selenoprotein W, 1 [Source:NCBI gene;Acc:352915][more]
back to top
BLAST of SMED30003313 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003313 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Selenow2.625e-2150.63selenoprotein W [Source:MGI Symbol;Acc:MGI:1100878... [more]
Selenov5.324e-1245.24selenoprotein V [Source:MGI Symbol;Acc:MGI:3608324... [more]
Selenov9.330e-759.52selenoprotein V [Source:MGI Symbol;Acc:MGI:3608324... [more]
back to top
BLAST of SMED30003313 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q568W0|SELW_DANRE4.951e-2762.34Selenoprotein W OS=Danio rerio OX=7955 GN=selenow ... [more]
sp|D0EYG3|SELW_CHICK9.152e-2251.95Selenoprotein W OS=Gallus gallus OX=9031 GN=SELENO... [more]
sp|Q5NVB2|SELW_PONAB9.457e-2254.43Selenoprotein W OS=Pongo abelii OX=9601 GN=SELENOW... [more]
sp|P63303|SELW_MACMU9.457e-2254.43Selenoprotein W OS=Macaca mulatta OX=9544 GN=SELEN... [more]
sp|P63302|SELW_HUMAN9.457e-2254.43Selenoprotein W OS=Homo sapiens OX=9606 GN=SELENOW... [more]
back to top
BLAST of SMED30003313 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F6NSR11.657e-2462.34Selenoprotein W, 1 OS=Danio rerio OX=7955 GN=selen... [more]
Q802G92.125e-2462.34Selenoprotein W, 1 OS=Danio rerio OX=7955 GN=selen... [more]
M4QNV71.617e-2359.74Selenoprotein W OS=Cristaria plicata OX=165446 PE=... [more]
A0A1B2LPW53.815e-2258.97Selenoprotein W OS=Chanodichthys ilishaeformis OX=... [more]
A0A1S3L0D77.548e-2257.89selenoprotein W OS=Salmo salar OX=8030 GN=sepw1 PE... [more]
back to top
BLAST of SMED30003313 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
selenow13.997e-2357.75selenoprotein W, 1 [Source:NCBI gene;Acc:352915][more]
selenow12.872e-2157.58selenoprotein W, 1 [Source:NCBI gene;Acc:352915][more]
selenow13.519e-2156.72selenoprotein W, 1 [Source:NCBI gene;Acc:352915][more]
back to top
BLAST of SMED30003313 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003313 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003313 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO356759.269e-2057.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30003313 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003313 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003313 ID=SMED30003313|Name=SMED30003313|organism=Schmidtea mediterranea sexual|type=transcript|length=460bp
TTTTTTTTTTTTTTTTTTAAAAACCCTAAAACAAATCTATTGAATGCCAA
AAAACATCAAATTGCTGAAAATCAAAGATTTTTAACAACAATTTTCACAG
AGTTGGCAATAGAAATTAAAACCTAAAATGAAAGCTAAAACTGTTCATTG
TTTCAATGCTTCAGCTATCGCATCGAAGATCTTTTGTAATTTTTTATCGT
TATCAACGAATTCATCTCCATTCTTTTTTGAATGGATCAATTTACCATTC
ACTTCAACTTCAAACCACCCAGTTTTGGTCGGAGTTGCAGTCGAAGTAAT
GGTTAGTTTGTTTGGAAATTCAAGTTCCAGATCTTTCTTCAAGTTCTGAA
ACTTGCTTCCGTAACCTCAGGAGCCACTATATAAAAATAATTAAAGTACA
TCAAATTAATTAATTGCACATATTAGAAATCAATCTTACCAATAAGTCAC
AACAACCTTG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR012336Thioredoxin-like_fold
IPR011893Selenoprotein_Rdx-typ