Rotatin

Overview
NameRotatin
Smed IDSMED30003301
Length (bp)6579
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rotatin (SMED30003301) t-SNE clustered cells

Violin plots show distribution of expression levels for Rotatin (SMED30003301) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rotatin (SMED30003301) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rotatin (SMED30003301) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003301

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30003301h1SMcG0002071 Contig2456uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003301h1SMcG0002071 Contig2456newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003301h1SMcG0003658 Contig2456uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003301h1SMcG0003658 Contig2456newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30003301h1SMcG0003658 SmedASXL_016884SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30003301h1SMcG0003658 SmedASXL_016882SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30003301h1SMcG0003658 dd_Smed_v4_13117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30003301h1SMcG0003658 dd_Smed_v4_13117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30003301h1SMcG0003658 dd_Smed_v6_13117_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
testisSMED30003301h1SMcG0003657 PL08006A2C06smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30003301h1SMcG0003658 PL08006A2C06smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rotatin vs. Ensembl Human
Match: RTTN (rotatin [Source:HGNC Symbol;Acc:HGNC:18654])

HSP 1 Score: 93.5893 bits (231), Expect = 4.333e-18
Identity = 218/1036 (21.04%), Postives = 412/1036 (39.77%), Query Frame = 2
Query: 1301 IYLCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQSSESLIKFFLN-NNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLI-----SSTEIFGNREDMFIKCDEILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVND---NKHERWFPRLLNGQSKSLDIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKI-LDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEIKILEIIGDRILLPFRV-GKYSANKTSKTEWTFSNFSKIPNQKWN--YQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLNVDIYDIFNETSL-WISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDFIQWLVQIMT--TPNNSLFYFLEKGDKLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYP-FDNLSKLLIHIHLMSRSLELKSNF--FQG-NTLKVISNVINLCG-------DLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWL--------------RKSPWLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLDISEAPIVRSEAISILQNLLGKLPFPNSM 4285
            I + LFA+    + ++   E A ++L E   T L     D  + L        ++ Y+E  +     + K +   + S E    F  +   E  K   + +  A+ +L    Y       KE     S I     +S  + G  + + +         +K+  +  C        +I +  L +    KP S+  N I+FLL   +   + +FG+     E++  A A+   L +G+ +M+ + W + +      +  LQ   D    +G  IL L  ++S                    +   L L   K   VR  A + L   L  +   + +  + +    ++S V D    K      RL + +   + ++  +K+++I+ S ++D+ +RKSAAEQL + +Q   MH        +  ++E L   +  D   +  LV   + +L +++     +R +L   S L+  L +++L F  D   V ++ ++  L++F+ V + D  S        +     LP  V  +Y            S +S +     +    +     LRI W L  + G +N L        K++       +++D        L L+  D+  L  +     L D LH I  A  H +V++++  +   L+    +             SL W +  ++FL  +P+C+ D  LL  I+  L  +IK    N   + + W+++++   + N  L   +    +   +TD  R T  + +++  L   F  L+    LN ++++ ++    S+++ + +    + L Q  +  + P F  L  L        R+L   +N   F G ++   ++  +++C        ++I  F+  R  ++++FMG GV    +  L+     HL  E+     +    + W               +   WL+ L   R  ++R  S  + S +   E     L   C  I    LW   + + LD SE  +VR EA  ILQNLL  +P P  +
Sbjct:  474 ISISLFAV--RLLQTLLPVEKASEFLSEPMSTALFLLSLDMPISLEYPNIHEAVVAYLEQLNSENYSIYKRTAEAVYSIECTCNFLSDIGKEGEKNLLELVELADQALRSFSYHQHFPLIKEIISICSKIWKSAQASPLLQGESQKVLLHMLSHPLPRVKAETYHCC-------LEITKECLGVHNVTKPVSSLCNGIHFLLHPKVLYEISVFGIQEPESEVNTAAKAILLYLLQGRLMMTALTWNKFIESLCPVIPILQGYADTEDPLGNCILLLSKASS---------DTEEMLPCTTRLKSMLRLLLVKKPSVRSLALKLLAFHLTSEEGADTKRPLIDAR--VLSRVTDLFIGKKPIEL-RLDDRRELVIKLETVEKVYEIFTSDDVDLVLRKSAAEQLAVIMQDIKMHAVVKKLCLIDKIIEYLNECVSQDGKVVECLVQPCLTLLRKVLCGDPVMRVSLSQQSSLLTVLFRVSLIFHEDCSVVTEVGALFCLLLFDEVSRMDMWSVNPSNKPSLPSVFSLPVSVFRRYHLPVHVIGHHAVSPYSIVLPLSADCLALKPVSDMLRIAWNLSWYHGSDNLL--------KQMNSETKTQEILD-------ALKLSTEDILTLKITHMASGLQDCLHSIVQAATHREVRAAVTRMSFYLLNDRLSLKGCPGPCGVTLKSLAWHTALNRFLQVLPACTEDEKLLIDIIHFLNKLIKEQRKNSSLELLNWILELLLRHSANPLLDLLVLTESQAREETDDIR-TAVRQQLQKELIALFDTLL----LNFMEVTDRKC---SELLYVFQTQLALKLLQCLKVTDAPHFYGLPSL-------ERTLRGMANLTAFPGWSSHSPLTKPLDICVKYLSGLLEVITSFYVERGGNAMSFMGKGVTKSTILCLL-----HLSHEMMAQAGSLEWMSLWFLPLGSHSEEHIPTQQGLAWLIPLWVDRDPEVRFTSLGLGSALTTLETGCVALANSCQNI-SGGLWGTVVNILLDQSECSMVRREAAFILQNLL-VIPMPTEI 1451          

HSP 2 Score: 59.3066 bits (142), Expect = 1.271e-7
Identity = 83/346 (23.99%), Postives = 159/346 (45.95%), Query Frame = 2
Query: 5375 NTLKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTV-KLIFLLLSNLVWCPEGINILLRIRFLDKFEQIN-PNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNG-----SGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLKSANL 6391
            N L  LL  S+  + + ++   I++   ++K+++      AQ N+D  +R  K ++  +        +IKE+   ++LL+N  Y++   +  A+      +++ LW   L+D  L+   L  L   +A+  N   ++                  S SL+  I +L S       L   TV +++F+LLSNL    +   ++ +  FL  F  +  P    K  S + I    L L++++S  E+GQ  I++ +G     + + K  +  + +L      LLI  N+C  P  K K++ N   +I  +  CL+S +   +++  + L AL+Y+  K +  LKS ++
Sbjct: 1864 NALMSLLAVSRRAQKHALKANLIDNCMEQMKHIN------AQLNLD-SLRPGKAALKKKED-----GVIKELSIAMQLLRNCLYQNEECKEAALEAHLVPVLHSLWPWILMDDSLMQISLQLLCVYTANFPNGCSSLCWSSCGQHPVQATHRGAVSNSLMLCILKLAS----QMPLENTTVQQMVFMLLSNLALSHDCKGVIQKSNFLQNFLSLALPKGGNKHLSNLTILW--LKLLLNISSGEDGQQMILRLDGCLDLLTEMSKYKHKSSPLL-----PLLIFHNVCFSPANKPKILAN-EKVITVLAACLESENQNAQRIGAAALWALIYNYQKAKTALKSPSV 2185          

HSP 3 Score: 56.9954 bits (136), Expect = 5.583e-7
Identity = 42/123 (34.15%), Postives = 66/123 (53.66%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQLKLYSNT-SNFQI-LDQIIKNLLKVNSNDTILS 411
            L   + KL H L E+R RALK+I  K+E  +I   DL + ++   +LLEWFN   V   + VL L+    ++    + ++ +G +EFL++L+  SN   N Q  +D I+  L  + S    LS
Sbjct:    3 LAGLIRKLGHQLAEIRERALKSILCKIEHNLICYADLIQERQLFLHLLEWFNFPSVPMKEEVLNLLSRLVKYPPAVQHLVDVGAVEFLSKLR--SNVEPNLQAEIDGILDGLFLLPSEVPALS 123          

HSP 4 Score: 55.8398 bits (133), Expect = 1.282e-6
Identity = 38/119 (31.93%), Postives = 67/119 (56.30%), Query Frame = 2
Query:  593 LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFI------SEKQYSTIAVKAISKLCYKMLQYINTCLDPNFFSTKNTFGIINQN 931
            LK S  P +PLT  D++VLS +  +LRS +  ++ +  +   DVI++DFP+ +FLQR  +++ LL  +       + + +  +V  + +LC  +   +N   DP FFS K+    ++QN
Sbjct:  170 LKFSTFPWLPLTTTDRHVLSSNESSLRSSNHTLIWNTCELLKDVIMQDFPAEIFLQRPKIVQSLLSLLKLAFGDGKHRLALQSVSCLQQLCMYLRNRLNFHRDPGFFSNKH--DTVSQN 286          
BLAST of Rotatin vs. Ensembl Human
Match: RTTN (rotatin [Source:HGNC Symbol;Acc:HGNC:18654])

HSP 1 Score: 93.2041 bits (230), Expect = 6.289e-18
Identity = 218/1036 (21.04%), Postives = 412/1036 (39.77%), Query Frame = 2
Query: 1301 IYLCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQSSESLIKFFLN-NNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLI-----SSTEIFGNREDMFIKCDEILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVND---NKHERWFPRLLNGQSKSLDIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKI-LDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEIKILEIIGDRILLPFRV-GKYSANKTSKTEWTFSNFSKIPNQKWN--YQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLNVDIYDIFNETSL-WISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDFIQWLVQIMT--TPNNSLFYFLEKGDKLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYP-FDNLSKLLIHIHLMSRSLELKSNF--FQG-NTLKVISNVINLCG-------DLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWL--------------RKSPWLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLDISEAPIVRSEAISILQNLLGKLPFPNSM 4285
            I + LFA+    + ++   E A ++L E   T L     D  + L        ++ Y+E  +     + K +   + S E    F  +   E  K   + +  A+ +L    Y       KE     S I     +S  + G  + + +         +K+  +  C        +I +  L +    KP S+  N I+FLL   +   + +FG+     E++  A A+   L +G+ +M+ + W + +      +  LQ   D    +G  IL L  ++S                    +   L L   K   VR  A + L   L  +   + +  + +    ++S V D    K      RL + +   + ++  +K+++I+ S ++D+ +RKSAAEQL + +Q   MH        +  ++E L   +  D   +  LV   + +L +++     +R +L   S L+  L +++L F  D   V ++ ++  L++F+ V + D  S        +     LP  V  +Y            S +S +     +    +     LRI W L  + G +N L        K++       +++D        L L+  D+  L  +     L D LH I  A  H +V++++  +   L+    +             SL W +  ++FL  +P+C+ D  LL  I+  L  +IK    N   + + W+++++   + N  L   +    +   +TD  R T  + +++  L   F  L+    LN ++++ ++    S+++ + +    + L Q  +  + P F  L  L        R+L   +N   F G ++   ++  +++C        ++I  F+  R  ++++FMG GV    +  L+     HL  E+     +    + W               +   WL+ L   R  ++R  S  + S +   E     L   C  I    LW   + + LD SE  +VR EA  ILQNLL  +P P  +
Sbjct:  474 ISISLFAV--RLLQTLLPVEKASEFLSEPMSTALFLLSLDMPISLEYPNIHEAVVAYLEQLNSENYSIYKRTAEAVYSIECTCNFLSDIGKEGEKNLLELVELADQALRSFSYHQHFPLIKEIISICSKIWKSAQASPLLQGESQKVLLHMLSHPLPRVKAETYHCC-------LEITKECLGVHNVTKPVSSLCNGIHFLLHPKVLYEISVFGIQEPESEVNTAAKAILLYLLQGRLMMTALTWNKFIESLCPVIPILQGYADTEDPLGNCILLLSKASS---------DTEEMLPCTTRLKSMLRLLLVKKPSVRSLALKLLAFHLTSEEGADTKRPLIDAR--VLSRVTDLFIGKKPIEL-RLDDRRELVIKLETVEKVYEIFTSDDVDLVLRKSAAEQLAVIMQDIKMHAVVKKLCLIDKIIEYLNECVSQDGKVVECLVQPCLTLLRKVLCGDPVMRVSLSQQSSLLTVLFRVSLIFHEDCSVVTEVGALFCLLLFDEVSRMDMWSVNPSNKPSLPSVFSLPVSVFRRYHLPVHVIGHHAVSPYSIVLPLSADCLALKPVSDMLRIAWNLSWYHGSDNLL--------KQMNSETKTQEILD-------ALKLSTEDILTLKITHMASGLQDCLHSIVQAATHREVRAAVTRMSFYLLNDRLSLKGCPGPCGVTLKSLAWHTALNRFLQVLPACTEDEKLLIDIIHFLNKLIKEQRKNSSLELLNWILELLLRHSANPLLDLLVLTESQAREETDDIR-TAVRQQLQKELIALFDTLL----LNFMEVTDRKC---SELLYVFQTQLALKLLQCLKVTDAPHFYGLPSL-------ERTLRGMANLTAFPGWSSHSPLTKPLDICVKYLSGLLEVITSFYVERGGNAMSFMGKGVTKSTILCLL-----HLSHEMMAQAGSLEWMSLWFLPLGSHSEEHIPTQQGLAWLIPLWVDRDPEVRFTSLGLGSALTTLETGCVALANSCQNI-SGGLWGTVVNILLDQSECSMVRREAAFILQNLL-VIPMPTEI 1451          

HSP 2 Score: 59.6918 bits (143), Expect = 9.021e-8
Identity = 93/386 (24.09%), Postives = 177/386 (45.85%), Query Frame = 2
Query: 5375 NTLKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTV-KLIFLLLSNLVWCPEGINILLRIRFLDKFEQIN-PNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNG-----SGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLKSANL---VTKLMSL-REIYENDSKNGL-------LLDIISLLNA 6478
            N L  LL  S+  + + ++   I++   ++K+++      AQ N+D  +R  K ++  +        +IKE+   ++LL+N  Y++   +  A+      +++ LW   L+D  L+   L  L   +A+  N   ++                  S SL+  I +L S       L   TV +++F+LLSNL    +   ++ +  FL  F  +  P    K  S + I    L L++++S  E+GQ  I++ +G     + + K  +  + +L      LLI  N+C  P  K K++ N   +I  +  CL+S +   +++  + L AL+Y+  K +  LKS ++   V +  SL ++ + N   N L       L +++ LLN+
Sbjct: 1864 NALMSLLAVSRRAQKHALKANLIDNCMEQMKHIN------AQLNLD-SLRPGKAALKKKED-----GVIKELSIAMQLLRNCLYQNEECKEAALEAHLVPVLHSLWPWILMDDSLMQISLQLLCVYTANFPNGCSSLCWSSCGQHPVQATHRGAVSNSLMLCILKLAS----QMPLENTTVQQMVFMLLSNLALSHDCKGVIQKSNFLQNFLSLALPKGGNKHLSNLTILW--LKLLLNISSGEDGQQMILRLDGCLDLLTEMSKYKHKSSPLL-----PLLIFHNVCFSPANKPKILAN-EKVITVLAACLESENQNAQRIGAAALWALIYNYQKAKTALKSPSVKRRVDEAYSLAKKTFPNSEANPLNAYYLKCLENLVQLLNS 2225          

HSP 3 Score: 56.9954 bits (136), Expect = 5.685e-7
Identity = 42/123 (34.15%), Postives = 66/123 (53.66%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQLKLYSNT-SNFQI-LDQIIKNLLKVNSNDTILS 411
            L   + KL H L E+R RALK+I  K+E  +I   DL + ++   +LLEWFN   V   + VL L+    ++    + ++ +G +EFL++L+  SN   N Q  +D I+  L  + S    LS
Sbjct:    3 LAGLIRKLGHQLAEIRERALKSILCKIEHNLICYADLIQERQLFLHLLEWFNFPSVPMKEEVLNLLSRLVKYPPAVQHLVDVGAVEFLSKLR--SNVEPNLQAEIDGILDGLFLLPSEVPALS 123          

HSP 4 Score: 55.8398 bits (133), Expect = 1.350e-6
Identity = 38/119 (31.93%), Postives = 67/119 (56.30%), Query Frame = 2
Query:  593 LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFI------SEKQYSTIAVKAISKLCYKMLQYINTCLDPNFFSTKNTFGIINQN 931
            LK S  P +PLT  D++VLS +  +LRS +  ++ +  +   DVI++DFP+ +FLQR  +++ LL  +       + + +  +V  + +LC  +   +N   DP FFS K+    ++QN
Sbjct:  170 LKFSTFPWLPLTTTDRHVLSSNESSLRSSNHTLIWNTCELLKDVIMQDFPAEIFLQRPKIVQSLLSLLKLAFGDGKHRLALQSVSCLQQLCMYLRNRLNFHRDPGFFSNKH--DTVSQN 286          
BLAST of Rotatin vs. Ensembl Human
Match: RTTN (rotatin [Source:HGNC Symbol;Acc:HGNC:18654])

HSP 1 Score: 72.0182 bits (175), Expect = 1.508e-11
Identity = 106/508 (20.87%), Postives = 206/508 (40.55%), Query Frame = 2
Query: 1301 IYLCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQSSESLIKFFLN-NNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLI-----SSTEIFGNREDMFIKCDEILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVND---NKHERWFPRLLNGQSKSLDIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKI-LDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQD 2794
            I + LFA+    + ++   E A ++L E   T L     D  + L        ++ Y+E  +     + K +   + S E    F  +   E  K   + +  A+ +L    Y       KE     S I     +S  + G  + + +         +K+  +  C        +I +  L +    KP S+  N I+FLL   +   + +FG+     E++  A A+   L +G+ +M+ + W + +      +  LQ   D    +G  IL L  ++S                    +   L L   K   VR  A + L   L  +   + +  + +    ++S V D    K      RL + +   + ++  +K+++I+ S ++D+ +RKSAAEQL + +Q   MH        +  ++E L   +  D   +  LV   + +L +++     +R +L   S L+  L +++L F  D   V ++ ++  L++F+ V + D
Sbjct:  301 ISISLFAV--RLLQTLLPVEKASEFLSEPMSTALFLLSLDMPISLEYPNIHEAVVAYLEQLNSENYSIYKRTAEAVYSIECTCNFLSDIGKEGEKNLLELVELADQALRSFSYHQHFPLIKEIISICSKIWKSAQASPLLQGESQKVLLHMLSHPLPRVKAETYHCC-------LEITKECLGVHNVTKPVSSLCNGIHFLLHPKVLYEISVFGIQEPESEVNTAAKAILLYLLQGRLMMTALTWNKFIESLCPVIPILQGYADTEDPLGNCILLLSKASS---------DTEEMLPCTTRLKSMLRLLLVKKPSVRSLALKLLAFHLTSEEGADTKRPLIDAR--VLSRVTDLFIGKKPIEL-RLDDRRELVIKLETVEKVYEIFTSDDVDLVLRKSAAEQLAVIMQDIKMHAVVKKLCLIDKIIEYLNECVSQDGKVVECLVQPCLTLLRKVLCGDPVMRVSLSQQSSLLTVLFRVSLIFHEDCSVVTEVGALFCLLLFDEVSRMD 787          
BLAST of Rotatin vs. Ensembl Human
Match: RTTN (rotatin [Source:HGNC Symbol;Acc:HGNC:18654])

HSP 1 Score: 58.151 bits (139), Expect = 1.064e-7
Identity = 92/386 (23.83%), Postives = 178/386 (46.11%), Query Frame = 2
Query: 5375 NTLKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTV-KLIFLLLSNLVWCPEGINILLRIRFLDKFEQIN-PNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNG-----SGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLKSANL---VTKLMSL-REIYENDSKNGL-------LLDIISLLNA 6478
            N L  LL  S+  + + ++   I++   ++K+++++L      N+D  +R  K ++  +        +IKE+   ++LL+N  Y++   +  A+      +++ LW   L+D  L+   L  L   +A+  N   ++                  S SL+  I +L S       L   TV +++F+LLSNL    +   ++ +  FL  F  +  P    K  S + I    L L++++S  E+GQ  I++ +G     + + K  +  + +L      LLI  N+C  P  K K++ N   +I  +  CL+S +   +++  + L AL+Y+  K +  LKS ++   V +  SL ++ + N   N L       L +++ LLN+
Sbjct:   33 NALMSLLAVSRRAQKHALKANLIDNCMEQMKHINAQL------NLDS-LRPGKAALKKKED-----GVIKELSIAMQLLRNCLYQNEECKEAALEAHLVPVLHSLWPWILMDDSLMQISLQLLCVYTANFPNGCSSLCWSSCGQHPVQATHRGAVSNSLMLCILKLAS----QMPLENTTVQQMVFMLLSNLALSHDCKGVIQKSNFLQNFLSLALPKGGNKHLSNLTILW--LKLLLNISSGEDGQQMILRLDGCLDLLTEMSKYKHKSSPLL-----PLLIFHNVCFSPANKPKILAN-EKVITVLAACLESENQNAQRIGAAALWALIYNYQKAKTALKSPSVKRRVDEAYSLAKKTFPNSEANPLNAYYLKCLENLVQLLNS 394          
BLAST of Rotatin vs. Ensembl Human
Match: RTTN (rotatin [Source:HGNC Symbol;Acc:HGNC:18654])

HSP 1 Score: 56.9954 bits (136), Expect = 3.149e-7
Identity = 43/123 (34.96%), Postives = 65/123 (52.85%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQLKLYSNT-SNFQI-LDQIIKNLLKVNSNDTILS 411
            L   + KL H L E+R RALK+I  K+E  +I   DL + ++   +LLEWFN   V   + VL L+    ++    + ++ +G +EFL+  KL SN   N Q  +D I+  L  + S    LS
Sbjct:    3 LAGLIRKLGHQLAEIRERALKSILCKIEHNLICYADLIQERQLFLHLLEWFNFPSVPMKEEVLNLLSRLVKYPPAVQHLVDVGAVEFLS--KLRSNVEPNLQAEIDGILDGLFLLPSEVPALS 123          

HSP 2 Score: 55.4546 bits (132), Expect = 9.695e-7
Identity = 38/119 (31.93%), Postives = 67/119 (56.30%), Query Frame = 2
Query:  593 LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFI------SEKQYSTIAVKAISKLCYKMLQYINTCLDPNFFSTKNTFGIINQN 931
            LK S  P +PLT  D++VLS +  +LRS +  ++ +  +   DVI++DFP+ +FLQR  +++ LL  +       + + +  +V  + +LC  +   +N   DP FFS K+    ++QN
Sbjct:  170 LKFSTFPWLPLTTTDRHVLSSNESSLRSSNHTLIWNTCELLKDVIMQDFPAEIFLQRPKIVQSLLSLLKLAFGDGKHRLALQSVSCLQQLCMYLRNRLNFHRDPGFFSNKH--DTVSQN 286          
BLAST of Rotatin vs. Ensembl Zebrafish
Match: rttn (rotatin [Source:ZFIN;Acc:ZDB-GENE-090609-5])

HSP 1 Score: 107.457 bits (267), Expect = 1.849e-22
Identity = 197/950 (20.74%), Postives = 373/950 (39.26%), Query Frame = 2
Query: 1793 FTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVNDNKHERWFPRLLNGQSKSLDI------------DNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYF----ISNGGLHYVLELLKGKILDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEI---------KILEIIGDRILLPFRVGKYSANKTSKTEWTFSNFSKIPNQKWNYQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLNVDIYDIFNETS---------LWISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTN-HMKDFIQWLVQIMTTPNNSLFYFLEKGD-------KLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYP-FDNLSKLLIHIHLMSRSLELKSNFFQGNT--LKVISNVINLCGDLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWL------RKS------------PWLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLDISEAPIVRSEAISILQNLLGKLPFPNSMEIPIDVNQNDENEDISSLFIDRNSSGKYQEINGFYQKLLYLDFFRKAGLSLTNFYT 4453
            ++    I++  L ++  AKP S+    ++FLL + +   + +FGL ++  E+   A  +   L +G+ +M+   WR+     +  +  LQ        +G             +     +K    R+    +   L L + K + VRK A Q+L   L            QN    L     D+      P L N  +KS+DI            ++  K+++I  S  +D+ +RKSAAEQL I LQ  +MH       +S+    ++ E +   +     +  L+ S+  +L ++V     +R +L   +  +  L++ +L    ++  V++ ++++ +++F+ + + D  + E           +   I  R  LPF+   + A   S        +S + + K  ++      L+I W    H G++  L +   F         D              L L+ES   VL  S  +  + D +H + +A +H  V           I R H +L  D   + + T           W S   +FL+  P+C  D  LL  I+  L    K + +    +D    L  ++   +++L   L   D       +  G+ D  +  L+ ++++  L   F  L+  +   + ++    S   +  + + +++  + L+    +   P  +   + + H+  +       +   + NT  LK +S ++    ++I  F+     +S++FMG GV    +  L+     HL  E+  + E+T    DW+      R+              WL+ L   R  ++R  S  + + +   E+    L   C  I    LW+  L + L+  E  +VR EA  ILQNLL        M +P +  +  E    S    D +S      +      L +  FF   G  + + YT
Sbjct:  635 YSCTLSILKECLGVQNVAKPASSICAGVHFLLHSRVLYEISVFGLQDQATEVSAAAKDILLYLLKGRLMMTAASWRRFNEALYPVIPILQSYAGTEDALGN--------CILLLSEASAEKGDEMRSPTARLRAALRLLFTKQHTVRKMAVQHLLPHLTSAE------GAQNSRPTL-----DSSTLSCLPNLYN-LNKSVDIKFSSSDKSYVKVESVNKLYNILASETVDLVLRKSAAEQLAIVLQDSSMHAVLKALGLSDKLTSFITECVNSNV---PSMDCLLESSACMLRKLVFADPSLRHSLAQQTTFLITLLRASLIIKENQGDVSEAAALMCILLFDEIARMDVWTDEAGSDTGLSSFSLPAAIIRRYNLPFQAPSHHA--VSPYCSVLPPYSDLLSLKPAWEA-----LQITWNTAWHSGIDGLLEHLRGFRSDVPEFHSD--------------LVLSESQAVVLRISNMRSGIEDCIHTVCDASSHSTV--------TFAITRMHLYLLFDFLALKSTTQSCKNILQTLSWHSAVERFLVVRPACHQDERLLVDILSFLNTFFKQNQSELDQQDLKWLLELLLNQESHTLLNLLLSADPQNHTHVQSQGEVDKLQAHLS-HRLQRELTGLFNTLLLLMTFTSDRMCEVLSGPFASELSL-RLLQCLRLSDAPCFYGLPSLERTLRTMAHVTALP-GWSTHTPSVEPNTLCLKYLSGLL----EVISSFYVDLGGNSMSFMGKGVTKNAVICLL-----HLSHEM--MKEST--NKDWISLWSLGREQSADEQSAAQLGLAWLIPLWVDRDPEVRCASLAVGAALSSLERGCVALSASCQNI-SGGLWATVLNILLEKQECSMVRREAAFILQNLL-------VMPMPANAEEAKECAWQSPCVHDEDSGLCLVGLPALQALLYHCQFFESVGQMVKSCYT 1508          

HSP 2 Score: 70.0922 bits (170), Expect = 3.467e-11
Identity = 41/113 (36.28%), Postives = 66/113 (58.41%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQLKLYSNTSNFQILDQIIKNLLKV 387
            L+  + K+ H L E+R RALKNI +K++  +I++ DL + K    +LLEWFN   V   + VL+LV+M S+   G + + ++G +EFLTQL    +     I+D +   L  +
Sbjct:    3 LSSLIKKIGHSLVEIRVRALKNIRSKLDHGLISVPDLVQEKMLFVFLLEWFNFPEVPMQEEVLELVDMLSKHPTGAQMLREVGAVEFLTQLSPNVDLRLRTIVDGVFDQLFHL 115          

HSP 3 Score: 64.6994 bits (156), Expect = 1.600e-9
Identity = 79/349 (22.64%), Postives = 152/349 (43.55%), Query Frame = 2
Query: 5369 VHNTLKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTV--KLIFLLLSNLVWCPEGINILLRIRFLDKFEQINPNQLQKSASGIAIQNLWLGLI--ISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLKSANLVTKL 6403
            V   L  LL      ++Y  + G I+S    +K+++++L             ++  +  N ++    +  ++E+  +LE+L+N  Y+    ++VA  +   +++   W   LLD   +   L  L   +A+      A+         S          + + N        L +    +N+    L F LL+NL    +G  +LL+  FL  F  +   +        A++ L L L   +++SF E+GQ  I++  G+  + V   Q+     + + LLI+ N+C     K K++ N  + +E +  CL S+   I+ +  S L ALL++N K +  LK  ++  K+
Sbjct: 1863 VAKALMSLLACCSSAQSYACKAGVIDSCVERMKHIYAELH-----------LESVKTGRNAHRRKQVENSMRELKMILEMLRNCLYQHNECKAVATDLRLAVVLLAFWPWLLLDDLTMAAALELLCVYTANCTAACSALCFSSSSSSVSVGSVQPVLPKTAVTNSLMHAVMKLASQVAPDNSSIHSLAFSLLANLAISRDGKGLLLKCNFLQNFLSLPMPKASGRGGAPAVETLSLWLRLLLNVSFGEDGQQMILRLRGALELLVELTQSKHSSAKPTVLLILHNICFCSANKPKVLANDKA-VELLVSCLSSSSSDIRNIGASALWALLHNNQKAKATLKCPSIRLKV 2199          

HSP 4 Score: 64.3142 bits (155), Expect = 2.077e-9
Identity = 37/111 (33.33%), Postives = 61/111 (54.95%), Query Frame = 2
Query:  593 LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFI-----SEKQYSTI-AVKAISKLCYKMLQYINTCLDPNFFSTKN 907
            LK SV P + L   D+++LS +  +LRSD+  +V +  +   DVI++DFP+ +FLQR   ++ LL  +      +  Y T  A+  + +LC  +   +    DP+FFS K 
Sbjct:  166 LKFSVFPWLSLNTTDRHILSSNESSLRSDNHNLVRTTCELLRDVIMQDFPAEIFLQRPSTVQSLLSLLGLNVDGDVSYLTFQALACLQQLCRNLKSRLRFYRDPSFFSAKQ 276          
BLAST of Rotatin vs. Ensembl Zebrafish
Match: rttn (rotatin [Source:ZFIN;Acc:ZDB-GENE-090609-5])

HSP 1 Score: 103.605 bits (257), Expect = 2.540e-21
Identity = 198/974 (20.33%), Postives = 380/974 (39.01%), Query Frame = 2
Query: 1793 FTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRF------------DRLWNCQLNIQNM---TDFLVSSVNDN-------KHERWFPRLL-----------NGQSKSL---DIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYF----ISNGGLHYVLELLKGKILDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEI---------KILEIIGDRILLPFRVGKYSANKTSKTEWTFSNFSKIPNQKWNYQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLNVDIYDIFNETS---------LWISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTN-HMKDFIQWLVQIMTTPNNSLFYFLEKGD-------KLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYP-FDNLSKLLIHIHLMSRSLELKSNFFQGNT--LKVISNVINLCGDLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWL------RKS------------PWLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLDISEAPIVRSEAISILQNLLGKLPFPNSMEIPIDVNQNDENEDISSLFIDRNSSGKYQEINGFYQKLLYLDFFRKAGLSLTNFYT 4453
            ++    I++  L ++  AKP S+    ++FLL + +   + +FGL ++  E+   A  +   L +G+ +M+   WR+     +  +  LQ        +G             +     +K    R+    +   L L + K + VRK A Q+L   L                  +C  N+ N+    D   SS + +        H   F +LL           N   +S+    +++  K+++I  S  +D+ +RKSAAEQL I LQ  +MH       +S+    ++ E +   +     +  L+ S+  +L ++V     +R +L   +  +  L++ +L    ++  V++ ++++ +++F+ + + D  + E           +   I  R  LPF+   + A   S        +S + + K  ++      L+I W    H G++  L +   F         D              L L+ES   VL  S  +  + D +H + +A +H  V           I R H +L  D   + + T           W S   +FL+  P+C  D  LL  I+  L    K + +    +D    L  ++   +++L   L   D       +  G+ D  +  L+ ++++  L   F  L+  +   + ++    S   +  + + +++  + L+    +   P  +   + + H+  +       +   + NT  LK +S ++    ++I  F+     +S++FMG GV    +  L+     HL  E+  + E+T    DW+      R+              WL+ L   R  ++R  S  + + +   E+    L   C  I    LW+  L + L+  E  +VR EA  ILQNLL        M +P +  +  E    S    D +S      +      L +  FF   G  + + YT
Sbjct:  635 YSCTLSILKECLGVQNVAKPASSICAGVHFLLHSRVLYEISVFGLQDQATEVSAAAKDILLYLLKGRLMMTAASWRRFNEALYPVIPILQSYAGTEDALGN--------CILLLSEASAEKGDEMRSPTARLRAALRLLFTKQHTVRKMAVQHLLPHLTSAEGAQNSRPTLDSSTLSCLPNLYNLNKSVDIKFSSSDKSYVKVKHFSHSAAFDKLLSRITLNQLVYANSDKRSVVFKQVESVNKLYNILASETVDLVLRKSAAEQLAIVLQDSSMHAVLKALGLSDKLTSFITECVNSNV---PSMDCLLESSACMLRKLVFADPSLRHSLAQQTTFLITLLRASLIIKENQGDVSEAAALMCILLFDEIARMDVWTDEAGSDTGLSSFSLPAAIIRRYNLPFQAPSHHA--VSPYCSVLPPYSDLLSLKPAWEA-----LQITWNTAWHSGIDGLLEHLRGFRSDVPEFHSD--------------LVLSESQAVVLRISNMRSGIEDCIHTVCDASSHSTV--------TFAITRMHLYLLFDFLALKSTTQSCKNILQTLSWHSAVERFLVVRPACHQDERLLVDILSFLNTFFKQNQSELDQQDLKWLLELLLNQESHTLLNLLLSADPQNHTHVQSQGEVDKLQAHLS-HRLQRELTGLFNTLLLLMTFTSDRMCEVLSGPFASELSL-RLLQCLRLSDAPCFYGLPSLERTLRTMAHVTALP-GWSTHTPSVEPNTLCLKYLSGLL----EVISSFYVDLGGNSMSFMGKGVTKNAVICLL-----HLSHEM--MKEST--NKDWISLWSLGREQSADEQSAAQLGLAWLIPLWVDRDPEVRCASLAVGAALSSLERGCVALSASCQNI-SGGLWATVLNILLEKQECSMVRREAAFILQNLL-------VMPMPANAEEAKECAWQSPCVHDEDSGLCLVGLPALQALLYHCQFFESVGQMVKSCYT 1544          

HSP 2 Score: 70.0922 bits (170), Expect = 4.077e-11
Identity = 41/113 (36.28%), Postives = 66/113 (58.41%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQLKLYSNTSNFQILDQIIKNLLKV 387
            L+  + K+ H L E+R RALKNI +K++  +I++ DL + K    +LLEWFN   V   + VL+LV+M S+   G + + ++G +EFLTQL    +     I+D +   L  +
Sbjct:    3 LSSLIKKIGHSLVEIRVRALKNIRSKLDHGLISVPDLVQEKMLFVFLLEWFNFPEVPMQEEVLELVDMLSKHPTGAQMLREVGAVEFLTQLSPNVDLRLRTIVDGVFDQLFHL 115          

HSP 3 Score: 64.6994 bits (156), Expect = 1.730e-9
Identity = 79/349 (22.64%), Postives = 152/349 (43.55%), Query Frame = 2
Query: 5369 VHNTLKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTV--KLIFLLLSNLVWCPEGINILLRIRFLDKFEQINPNQLQKSASGIAIQNLWLGLI--ISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLKSANLVTKL 6403
            V   L  LL      ++Y  + G I+S    +K+++++L             ++  +  N ++    +  ++E+  +LE+L+N  Y+    ++VA  +   +++   W   LLD   +   L  L   +A+      A+         S          + + N        L +    +N+    L F LL+NL    +G  +LL+  FL  F  +   +        A++ L L L   +++SF E+GQ  I++  G+  + V   Q+     + + LLI+ N+C     K K++ N  + +E +  CL S+   I+ +  S L ALL++N K +  LK  ++  K+
Sbjct: 1899 VAKALMSLLACCSSAQSYACKAGVIDSCVERMKHIYAELH-----------LESVKTGRNAHRRKQVENSMRELKMILEMLRNCLYQHNECKAVATDLRLAVVLLAFWPWLLLDDLTMAAALELLCVYTANCTAACSALCFSSSSSSVSVGSVQPVLPKTAVTNSLMHAVMKLASQVAPDNSSIHSLAFSLLANLAISRDGKGLLLKCNFLQNFLSLPMPKASGRGGAPAVETLSLWLRLLLNVSFGEDGQQMILRLRGALELLVELTQSKHSSAKPTVLLILHNICFCSANKPKVLANDKA-VELLVSCLSSSSSDIRNIGASALWALLHNNQKAKATLKCPSIRLKV 2235          

HSP 4 Score: 64.3142 bits (155), Expect = 2.189e-9
Identity = 37/111 (33.33%), Postives = 61/111 (54.95%), Query Frame = 2
Query:  593 LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFI-----SEKQYSTI-AVKAISKLCYKMLQYINTCLDPNFFSTKN 907
            LK SV P + L   D+++LS +  +LRSD+  +V +  +   DVI++DFP+ +FLQR   ++ LL  +      +  Y T  A+  + +LC  +   +    DP+FFS K 
Sbjct:  166 LKFSVFPWLSLNTTDRHILSSNESSLRSDNHNLVRTTCELLRDVIMQDFPAEIFLQRPSTVQSLLSLLGLNVDGDVSYLTFQALACLQQLCRNLKSRLRFYRDPSFFSAKQ 276          
BLAST of Rotatin vs. Ensembl Xenopus
Match: RTTN (rotatin [Source:NCBI gene;Acc:100379860])

HSP 1 Score: 91.2781 bits (225), Expect = 1.835e-17
Identity = 202/1033 (19.55%), Postives = 388/1033 (37.56%), Query Frame = 2
Query: 1283 LSNKRQIYLCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQSSESLIKFFL-NNNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLISSTEIFGNREDMFIKCDE---ILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVNDNKHERWFPRLLNGQSKSLDI-DNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKI-LDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEIKILEIIGDRILLPFRVGKYSANKTSKTEWTFSNFSKIPNQKWNYQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLN----VDIYDIFNETSL----WISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDFIQWLVQIMTTPNNS-LFYFLEKGDKLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYPFDNLSKLLIHIHLMSRSLELKSNFFQG-----NTLKVISNVINLCG----------------------DLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWLR------------------KSPWLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLD 4201
            L + R  ++ +       + SI   E A   L E     L     D    +        +I+++E  +     + K+S+    S E    F L +  E  K   + +  AE +L  L +       ++F    S     +IF + +   +  +E   +L  LM      +    +    +IV++SL I    KP S+    I+FLL + +   +  FGL     EI   A  +   L +G+ +M    W  ++      +  LQ   D    +G  IL L  +++++                  I   L   ++K   VR  A +++   L  +    C+   Q +   L ++V     E+     L+   KS  + D  +K+ +I+LS  +D +++KSAAEQ+ +  Q   MH+     G +  +L  L   +  D      ++   +++L +IV      R  L      +  L +++L    +   + + +++L +++F+ + + D  +    ++ ++  R  LP  V  Y A        + S         W   +     LR+ W +  H G++ +L         K + ++      +EI   ++ L L+  ++  L  +     L D L  I  A++H +V+S++  +       N   LN    ++       +SL    W +   +FLL  P+C  D  LL  ++  L  I++    N     +QW+++++   + S LF  +E+ +    K         +  ++  L  FF  LM                              +CL  +T           +  + +HL++R     +  F G      TL+ +S+V +  G                      ++I  F+     +++++MG GV    +  L+     HL  E+    +     TDW+                      WL+ L   R  ++R  S  I S +   ++    L   C  I    LW    +++L+
Sbjct:  455 LMSHRMAFISISLFTMRLLQSILPVEKANDVLPESLMNALFLISLDLPFRMAYPSVHESVISFMEQLNSEHCGIYKQSSETAYSIECATTFMLYSRKEGKKDFIELVELAEKALSSLPFHKHFPLVQKFIQICS-----DIFKSAQSSPVLLEESQKVLLCLMSHWMPLVKAEAYKTNLEIVKDSLGIHNVTKPVSSVCQGIHFLLHSKVLYEISTFGLQESNSEICTAAKTILSYLLQGRLVMENHTWNTLIESICPVIPVLQGFADTEETLGTSILTLCETSANDDGILPKTA---------RIRAALRQLFSKKQAVRSVAIKWIAVHLMNEEDSTCK-RPQILGSTLSNAVCLFILEQPLDLKLDNNEKSFFMEDTVQKVCEIFLSDTVDFALQKSAAEQMSVIAQDVKMHSVLKKPGVVDKILHYLYKYVQQDGKAFECMILPCLMLLRKIVYADPGFRLTLSQKPCFLLTLFRVSLMMQQEVTSLTEAAALLCMLLFDEISRMD--TCIFYVIYVLFLRFHLPVLVSAYHAVSPYTMASSLS-------ADWLTSKPVSVMLRMSWNISWHQGVDPFL---------KTVANEQ-----EEIENSLETLKLSPEEVLTLKMTHSVSGLQDCLSSIIQAVSHGEVRSAVARM-------NFYLLNDRLVLNCLTACYMSSLKCLPWHTALSRFLLVHPACEEDEKLLADVIRFLNKILQEQKGNSDPHDLQWILEMLLKQSPSPLFELMEQKEYPAKKDLDDTRAAVRQHLQKELMMFFNTLM------------------------------LCLTSVTDRKCLVLGGTFRTQLALHLLNRLKISDAPHFYGLPSLAQTLRGMSHVTSQPGWSAYSPSTEPFAICVKTLTSLLEIISSFYVEWGGNALSYMGKGVTKSTVLCLL-----HLSHEMTAQAKN----TDWIHLWTLPYDHGTEDQVLSRLGLEWLIPLWVDRDPEVRFTSLGIASALTCLQKGCLALSASCQNI-SGGLWGTVFSIFLN 1402          

HSP 2 Score: 72.7886 bits (177), Expect = 8.963e-12
Identity = 41/135 (30.37%), Postives = 71/135 (52.59%), Query Frame = 2
Query:  593 LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFI-------SEKQYSTIAVKAISKLCYKMLQYINTCLDPNFFSTKNTFGIINQNYGEYEEDNHWNSDDL 976
            LK S  P +PLT  DK+VLS +  +LRS++  +V    Q   DV+++DFP  +FLQR  +++ LL           ++  ++ ++  +S+LC  +    +   DPNF STK    + + ++  Y  D   N+  +
Sbjct:  163 LKFSTFPWLPLTTTDKHVLSSNESSLRSNNPSLVWRSCQLLQDVVMQDFPPEIFLQRPKIVQSLLSLFGLASEKDGQQHLASQSISCLSQLCTLLRNRFSFHRDPNFLSTKQEI-VSHNSFASYCHDAQANNSQV 296          

HSP 3 Score: 67.781 bits (164), Expect = 2.867e-10
Identity = 90/328 (27.44%), Postives = 158/328 (48.17%), Query Frame = 2
Query: 5387 ILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTVK-LIFLLLSNLVWCPEGINILLRIRFLDKFEQIN-PNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKI 6364
            ILLG S +V       G I+    EIK++H++L      N+D  +R  K +   + +       +K++  ++++L+N  Y++   ++ A+   F  +++ LW   L+D  L+   L  L   +A       ++   +        PP  G+S SL+ NI +L S D TA     +TV+ + F LLSNLV   +   I+ +  FL  F  ++ P    KS   +A  N WL  + +LS   +GQ  I+K  GS  + V        ++    LLI+ N+C +   K K++ N  + +  +  CL+S+++  +Q+  S   ALL+   K+
Sbjct: 1594 ILLGKSHLVD------GCIQ----EIKHIHAQL------NLD-SLRPGKAAHKKKEE-----NHLKQLKVLMQILRNCLYQNEEGKAAAIDSQFPFVLHSLWPWLLMDDALMQGALQLLCVYTAYYPAACTSLCWTNTGVTTPQPPPKTGASNSLMHNILKLAS-DSTA---NNSTVQQMAFALLSNLVVIQDSKCIIQKSNFLQNFLTLSLPKAGTKSLCILA--NNWLKFLWNLSMGSDGQQMILKLKGSLDLLVELTTYKQKMISPVALLILHNVCFNTANKAKILSNDKA-VAVLSTCLESDNLLDQQIGCSAFWALLHGYQKV 1892          

HSP 4 Score: 54.299 bits (129), Expect = 3.330e-6
Identity = 36/110 (32.73%), Postives = 60/110 (54.55%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQLKLYSNTSNFQILDQIIKNL 378
            ++  V KL H L E+R RALKNI  K++  ++++ DL + K F  +LLEWFN   V     VL L+    +     + +I++G ++F +QL+         ++D I+  L
Sbjct:    3 ISTLVKKLGHQLVEIRERALKNILCKLDHNLVSLVDLAQEKTFFLHLLEWFNFPAVPMKADVLHLLNKLVKHSEAAQWLIQLGAVDFFSQLRSNVEPDLQAVVDSILDGL 112          
BLAST of Rotatin vs. Ensembl Xenopus
Match: RTTN (rotatin [Source:NCBI gene;Acc:100379860])

HSP 1 Score: 91.2781 bits (225), Expect = 2.143e-17
Identity = 203/1036 (19.59%), Postives = 390/1036 (37.64%), Query Frame = 2
Query: 1283 LSNKRQIYLCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQSSESLIKFFL-NNNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLISSTEIFGNREDMFIKCDE---ILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVNDNKHERWFPRLLNGQSKSLDI-DNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGG----LHYVLELLKGKILDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEIKILEIIGDRILLPFRVGKYSANKTSKTEWTFSNFSKIPNQKWNYQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLN----VDIYDIFNETSL----WISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDFIQWLVQIMTTPNNS-LFYFLEKGDKLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYPFDNLSKLLIHIHLMSRSLELKSNFFQG-----NTLKVISNVINLCG----------------------DLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWLR------------------KSPWLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLD 4201
            L + R  ++ +       + SI   E A   L E     L     D    +        +I+++E  +     + K+S+    S E    F L +  E  K   + +  AE +L  L +       ++F    S     +IF + +   +  +E   +L  LM      +    +    +IV++SL I    KP S+    I+FLL + +   +  FGL     EI   A  +   L +G+ +M    W  ++      +  LQ   D    +G  IL L  +++++                  I   L   ++K   VR  A +++   L  +    C+   Q +   L ++V     E+     L+   KS  + D  +K+ +I+LS  +D +++KSAAEQ+ +  Q   MH+     G     LHY+ + ++    D      ++   +++L +IV      R  L      +  L +++L    +   + + +++L +++F+ + + D  +    ++ ++  R  LP  V  Y A        + S         W   +     LR+ W +  H G++ +L         K + ++      +EI   ++ L L+  ++  L  +     L D L  I  A++H +V+S++  +       N   LN    ++       +SL    W +   +FLL  P+C  D  LL  ++  L  I++    N     +QW+++++   + S LF  +E+ +    K         +  ++  L  FF  LM                              +CL  +T           +  + +HL++R     +  F G      TL+ +S+V +  G                      ++I  F+     +++++MG GV    +  L+     HL  E+    +     TDW+                      WL+ L   R  ++R  S  I S +   ++    L   C  I    LW    +++L+
Sbjct:  440 LMSHRMAFISISLFTMRLLQSILPVEKANDVLPESLMNALFLISLDLPFRMAYPSVHESVISFMEQLNSEHCGIYKQSSETAYSIECATTFMLYSRKEGKKDFIELVELAEKALSSLPFHKHFPLVQKFIQICS-----DIFKSAQSSPVLLEESQKVLLCLMSHWMPLVKAEAYKTNLEIVKDSLGIHNVTKPVSSVCQGIHFLLHSKVLYEISTFGLQESNSEICTAAKTILSYLLQGRLVMENHTWNTLIESICPVIPVLQGFADTEETLGTSILTLCETSANDDGILPKTA---------RIRAALRQLFSKKQAVRSVAIKWIAVHLMNEEDSTCK-RPQILGSTLSNAVCLFILEQPLDLKLDNNEKSFFMEDTVQKVCEIFLSDTVDFALQKSAAEQMSVIAQDVKMHSVLKKPGVVDKILHYLYKYVQQ---DGKAFECMILPCLMLLRKIVYADPGFRLTLSQKPCFLLTLFRVSLMMQQEVTSLTEAAALLCMLLFDEISRMD--TCIFYVIYVLFLRFHLPVLVSAYHAVSPYTMASSLS-------ADWLTSKPVSVMLRMSWNISWHQGVDPFL---------KTVANEQ-----EEIENSLETLKLSPEEVLTLKMTHSVSGLQDCLSSIIQAVSHGEVRSAVARM-------NFYLLNDRLVLNCLTACYMSSLKCLPWHTALSRFLLVHPACEEDEKLLADVIRFLNKILQEQKGNSDPHDLQWILEMLLKQSPSPLFELMEQKEYPAKKDLDDTRAAVRQHLQKELMMFFNTLM------------------------------LCLTSVTDRKCLVLGGTFRTQLALHLLNRLKISDAPHFYGLPSLAQTLRGMSHVTSQPGWSAYSPSTEPFAICVKTLTSLLEIISSFYVEWGGNALSYMGKGVTKSTVLCLL-----HLSHEMTAQAKN----TDWIHLWTLPYDHGTEDQVLSRLGLEWLIPLWVDRDPEVRFTSLGIASALTCLQKGCLALSASCQNI-SGGLWGTVFSIFLN 1387          

HSP 2 Score: 72.7886 bits (177), Expect = 8.352e-12
Identity = 41/135 (30.37%), Postives = 71/135 (52.59%), Query Frame = 2
Query:  593 LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFI-------SEKQYSTIAVKAISKLCYKMLQYINTCLDPNFFSTKNTFGIINQNYGEYEEDNHWNSDDL 976
            LK S  P +PLT  DK+VLS +  +LRS++  +V    Q   DV+++DFP  +FLQR  +++ LL           ++  ++ ++  +S+LC  +    +   DPNF STK    + + ++  Y  D   N+  +
Sbjct:  148 LKFSTFPWLPLTTTDKHVLSSNESSLRSNNPSLVWRSCQLLQDVVMQDFPPEIFLQRPKIVQSLLSLFGLASEKDGQQHLASQSISCLSQLCTLLRNRFSFHRDPNFLSTKQEI-VSHNSFASYCHDAQANNSQV 281          

HSP 3 Score: 69.3218 bits (168), Expect = 9.905e-11
Identity = 92/366 (25.14%), Postives = 174/366 (47.54%), Query Frame = 2
Query: 5273 FTELLLKKRESLSRINAKSHSYTDTSINERINVHNTLKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTVK-LIFLLLSNLVWCPEGINILLRIRFLDKFEQIN-PNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKI 6364
            F+ L +K  ++  + +  +H Y   S +++ ++  T K L         +L+    ++    EIK++H++L      N+D  +R  K +   + +       +K++  ++++L+N  Y++   ++ A+   F  +++ LW   L+D  L+   L  L   +A       ++   +        PP  G+S SL+ NI +L S D TA     +TV+ + F LLSNLV   +   I+ +  FL  F  ++ P    KS   +A  N WL  + +LS   +GQ  I+K  GS  + V        ++    LLI+ N+C +   K K++ N  + +  +  CL+S+++  +Q+  S   ALL+   K+
Sbjct: 1534 FSSLSMKNNKTWGKSHPVTH-YLLNSKSKQFHIKPTQKCL--------GHLLSTHLVDGCIQEIKHIHAQL------NLD-SLRPGKAAHKKKEE-----NHLKQLKVLMQILRNCLYQNEEGKAAAIDSQFPFVLHSLWPWLLMDDALMQGALQLLCVYTAYYPAACTSLCWTNTGVTTPQPPPKTGASNSLMHNILKLAS-DSTA---NNSTVQQMAFALLSNLVVIQDSKCIIQKSNFLQNFLTLSLPKAGTKSLCILA--NNWLKFLWNLSMGSDGQQMILKLKGSLDLLVELTTYKQKMISPVALLILHNVCFNTANKAKILSNDKA-VAVLSTCLESDNLLDQQIGCSAFWALLHGYQKV 1871          

HSP 4 Score: 56.225 bits (134), Expect = 8.089e-7
Identity = 40/131 (30.53%), Postives = 69/131 (52.67%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQLKLYSNTSNFQILDQIIKNLLKVNSNDTILSENEGFSCSLL 441
            ++  V KL H L E+R RALKNI  K++  ++++ DL + K F  +LLEWFN   V     VL L+    +     + +I++G ++F +QL+         ++D I+  L  + +     S+NE    S++
Sbjct:    3 ISTLVKKLGHQLVEIRERALKNILCKLDHNLVSLVDLAQEKTFFLHLLEWFNFPAVPMKADVLHLLNKLVKHSEAAQWLIQLGAVDFFSQLRSNVEPDLQAVVDSILDGLFLLPTERPEPSQNENLLISVI 133          
BLAST of Rotatin vs. Ensembl Xenopus
Match: RTTN (rotatin [Source:NCBI gene;Acc:100379860])

HSP 1 Score: 91.2781 bits (225), Expect = 2.177e-17
Identity = 203/1036 (19.59%), Postives = 390/1036 (37.64%), Query Frame = 2
Query: 1283 LSNKRQIYLCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQSSESLIKFFL-NNNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLISSTEIFGNREDMFIKCDE---ILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVNDNKHERWFPRLLNGQSKSLDI-DNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGG----LHYVLELLKGKILDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEIKILEIIGDRILLPFRVGKYSANKTSKTEWTFSNFSKIPNQKWNYQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLN----VDIYDIFNETSL----WISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDFIQWLVQIMTTPNNS-LFYFLEKGDKLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYPFDNLSKLLIHIHLMSRSLELKSNFFQG-----NTLKVISNVINLCG----------------------DLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWLR------------------KSPWLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLD 4201
            L + R  ++ +       + SI   E A   L E     L     D    +        +I+++E  +     + K+S+    S E    F L +  E  K   + +  AE +L  L +       ++F    S     +IF + +   +  +E   +L  LM      +    +    +IV++SL I    KP S+    I+FLL + +   +  FGL     EI   A  +   L +G+ +M    W  ++      +  LQ   D    +G  IL L  +++++                  I   L   ++K   VR  A +++   L  +    C+   Q +   L ++V     E+     L+   KS  + D  +K+ +I+LS  +D +++KSAAEQ+ +  Q   MH+     G     LHY+ + ++    D      ++   +++L +IV      R  L      +  L +++L    +   + + +++L +++F+ + + D  +    ++ ++  R  LP  V  Y A        + S         W   +     LR+ W +  H G++ +L         K + ++      +EI   ++ L L+  ++  L  +     L D L  I  A++H +V+S++  +       N   LN    ++       +SL    W +   +FLL  P+C  D  LL  ++  L  I++    N     +QW+++++   + S LF  +E+ +    K         +  ++  L  FF  LM                              +CL  +T           +  + +HL++R     +  F G      TL+ +S+V +  G                      ++I  F+     +++++MG GV    +  L+     HL  E+    +     TDW+                      WL+ L   R  ++R  S  I S +   ++    L   C  I    LW    +++L+
Sbjct:  427 LMSHRMAFISISLFTMRLLQSILPVEKANDVLPESLMNALFLISLDLPFRMAYPSVHESVISFMEQLNSEHCGIYKQSSETAYSIECATTFMLYSRKEGKKDFIELVELAEKALSSLPFHKHFPLVQKFIQICS-----DIFKSAQSSPVLLEESQKVLLCLMSHWMPLVKAEAYKTNLEIVKDSLGIHNVTKPVSSVCQGIHFLLHSKVLYEISTFGLQESNSEICTAAKTILSYLLQGRLVMENHTWNTLIESICPVIPVLQGFADTEETLGTSILTLCETSANDDGILPKTA---------RIRAALRQLFSKKQAVRSVAIKWIAVHLMNEEDSTCK-RPQILGSTLSNAVCLFILEQPLDLKLDNNEKSFFMEDTVQKVCEIFLSDTVDFALQKSAAEQMSVIAQDVKMHSVLKKPGVVDKILHYLYKYVQQ---DGKAFECMILPCLMLLRKIVYADPGFRLTLSQKPCFLLTLFRVSLMMQQEVTSLTEAAALLCMLLFDEISRMD--TCIFYVIYVLFLRFHLPVLVSAYHAVSPYTMASSLS-------ADWLTSKPVSVMLRMSWNISWHQGVDPFL---------KTVANEQ-----EEIENSLETLKLSPEEVLTLKMTHSVSGLQDCLSSIIQAVSHGEVRSAVARM-------NFYLLNDRLVLNCLTACYMSSLKCLPWHTALSRFLLVHPACEEDEKLLADVIRFLNKILQEQKGNSDPHDLQWILEMLLKQSPSPLFELMEQKEYPAKKDLDDTRAAVRQHLQKELMMFFNTLM------------------------------LCLTSVTDRKCLVLGGTFRTQLALHLLNRLKISDAPHFYGLPSLAQTLRGMSHVTSQPGWSAYSPSTEPFAICVKTLTSLLEIISSFYVEWGGNALSYMGKGVTKSTVLCLL-----HLSHEMTAQAKN----TDWIHLWTLPYDHGTEDQVLSRLGLEWLIPLWVDRDPEVRFTSLGIASALTCLQKGCLALSASCQNI-SGGLWGTVFSIFLN 1374          

HSP 2 Score: 72.7886 bits (177), Expect = 8.205e-12
Identity = 41/135 (30.37%), Postives = 71/135 (52.59%), Query Frame = 2
Query:  593 LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFI-------SEKQYSTIAVKAISKLCYKMLQYINTCLDPNFFSTKNTFGIINQNYGEYEEDNHWNSDDL 976
            LK S  P +PLT  DK+VLS +  +LRS++  +V    Q   DV+++DFP  +FLQR  +++ LL           ++  ++ ++  +S+LC  +    +   DPNF STK    + + ++  Y  D   N+  +
Sbjct:  135 LKFSTFPWLPLTTTDKHVLSSNESSLRSNNPSLVWRSCQLLQDVVMQDFPPEIFLQRPKIVQSLLSLFGLASEKDGQQHLASQSISCLSQLCTLLRNRFSFHRDPNFLSTKQEI-VSHNSFASYCHDAQANNSQV 268          

HSP 3 Score: 68.9366 bits (167), Expect = 1.067e-10
Identity = 92/366 (25.14%), Postives = 174/366 (47.54%), Query Frame = 2
Query: 5273 FTELLLKKRESLSRINAKSHSYTDTSINERINVHNTLKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTVK-LIFLLLSNLVWCPEGINILLRIRFLDKFEQIN-PNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKI 6364
            F+ L +K  ++  + +  +H Y   S +++ ++  T K L         +L+    ++    EIK++H++L      N+D  +R  K +   + +       +K++  ++++L+N  Y++   ++ A+   F  +++ LW   L+D  L+   L  L   +A       ++   +        PP  G+S SL+ NI +L S D TA     +TV+ + F LLSNLV   +   I+ +  FL  F  ++ P    KS   +A  N WL  + +LS   +GQ  I+K  GS  + V        ++    LLI+ N+C +   K K++ N  + +  +  CL+S+++  +Q+  S   ALL+   K+
Sbjct: 1521 FSSLSMKNNKTWGKSHPVTH-YLLNSKSKQFHIKPTQKCL--------GHLLSTHLVDGCIQEIKHIHAQL------NLD-SLRPGKAAHKKKEE-----NHLKQLKVLMQILRNCLYQNEEGKAAAIDSQFPFVLHSLWPWLLMDDALMQGALQLLCVYTAYYPAACTSLCWTNTGVTTPQPPPKTGASNSLMHNILKLAS-DSTA---NNSTVQQMAFALLSNLVVIQDSKCIIQKSNFLQNFLTLSLPKAGTKSLCILA--NNWLKFLWNLSMGSDGQQMILKLKGSLDLLVELTTYKQKMISPVALLILHNVCFNTANKAKILSNDKA-VAVLSTCLESDNLLDQQIGCSAFWALLHGYQKV 1858          
BLAST of Rotatin vs. Ensembl Xenopus
Match: RTTN (rotatin [Source:NCBI gene;Acc:100379860])

HSP 1 Score: 90.8929 bits (224), Expect = 2.477e-17
Identity = 195/985 (19.80%), Postives = 372/985 (37.77%), Query Frame = 2
Query: 1460 LITYIELFDQNFAKLNKESNRLMQSSESLIKFFL-NNNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLISSTEIFGNREDMFIKCDE---ILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVNDNKHERWFPRLLNGQSKSLDI-DNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGG----LHYVLELLKGKILDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEIKILE--------IIGDRILLPFRVGKYSANKTSKTEWTFSNFSKIPNQKWNYQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLN----VDIYDIFNETSL----WISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDFIQWLVQIMTTPNNS-LFYFLEKGDKLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYPFDNLSKLLIHIHLMSRSLELKSNFFQG-----NTLKVISNVINLCG----------------------DLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWLR------------------KSPWLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLD 4201
            +I+++E  +     + K+S+    S E    F L +  E  K   + +  AE +L  L +       ++F    S     +IF + +   +  +E   +L  LM      +    +    +IV++SL I    KP S+    I+FLL + +   +  FGL     EI   A  +   L +G+ +M    W  ++      +  LQ   D    +G  IL L  +++++                  I   L   ++K   VR  A +++   L  +    C+   Q +   L ++V     E+     L+   KS  + D  +K+ +I+LS  +D +++KSAAEQ+ +  Q   MH+     G     LHY+ + ++    D      ++   +++L +IV      R  L      +  L +++L    +   + + +++L +++F+ + + D  S  I             +  R  LP  V  Y A        + S         W   +     LR+ W +  H G++ +L         K + ++      +EI   ++ L L+  ++  L  +     L D L  I  A++H +V+S++  +       N   LN    ++       +SL    W +   +FLL  P+C  D  LL  ++  L  I++    N     +QW+++++   + S LF  +E+ +    K         +  ++  L  FF  LM                              +CL  +T           +  + +HL++R     +  F G      TL+ +S+V +  G                      ++I  F+     +++++MG GV    +  L+     HL  E+    +     TDW+                      WL+ L   R  ++R  S  I S +   ++    L   C  I    LW    +++L+
Sbjct:  533 VISFMEQLNSEHCGIYKQSSETAYSIECATTFMLYSRKEGKKDFIELVELAEKALSSLPFHKHFPLVQKFIQICS-----DIFKSAQSSPVLLEESQKVLLCLMSHWMPLVKAEAYKTNLEIVKDSLGIHNVTKPVSSVCQGIHFLLHSKVLYEISTFGLQESNSEICTAAKTILSYLLQGRLVMENHTWNTLIESICPVIPVLQGFADTEETLGTSILTLCETSANDDGILPKTA---------RIRAALRQLFSKKQAVRSVAIKWIAVHLMNEEDSTCK-RPQILGSTLSNAVCLFILEQPLDLKLDNNEKSFFMEDTVQKVCEIFLSDTVDFALQKSAAEQMSVIAQDVKMHSVLKKPGVVDKILHYLYKYVQQ---DGKAFECMILPCLMLLRKIVYADPGFRLTLSQKPCFLLTLFRVSLMMQQEVTSLTEAAALLCMLLFDEISRMDTWSEAIPFCTQPPFGLPVTVVRRFHLPVLVSAYHAVSPYTMASSLS-------ADWLTSKPVSVMLRMSWNISWHQGVDPFL---------KTVANEQ-----EEIENSLETLKLSPEEVLTLKMTHSVSGLQDCLSSIIQAVSHGEVRSAVARM-------NFYLLNDRLVLNCLTACYMSSLKCLPWHTALSRFLLVHPACEEDEKLLADVIRFLNKILQEQKGNSDPHDLQWILEMLLKQSPSPLFELMEQKEYPAKKDLDDTRAAVRQHLQKELMMFFNTLM------------------------------LCLTSVTDRKCLVLGGTFRTQLALHLLNRLKISDAPHFYGLPSLAQTLRGMSHVTSQPGWSAYSPSTEPFAICVKTLTSLLEIISSFYVEWGGNALSYMGKGVTKSTVLCLL-----HLSHEMTAQAKN----TDWIHLWTLPYDHGTEDQVLSRLGLEWLIPLWVDRDPEVRFTSLGIASALTCLQKGCLALSASCQNI-SGGLWGTVFSIFLN 1431          

HSP 2 Score: 73.559 bits (179), Expect = 5.091e-12
Identity = 88/331 (26.59%), Postives = 160/331 (48.34%), Query Frame = 2
Query: 5378 TLKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTVK-LIFLLLSNLVWCPEGINILLRIRFLDKFEQIN-PNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKI 6364
            TL +LL  S+  + Y +    ++    EIK++H++L      N+D  +R  K +   + +       +K++  ++++L+N  Y++   ++ A+   F  +++ LW   L+D  L+   L  L   +A       ++   +        PP  G+S SL+ NI +L S D TA     +TV+ + F LLSNLV   +   I+ +  FL  F  ++ P    KS   +A  N WL  + +LS   +GQ  I+K  GS  + V        ++    LLI+ N+C +   K K++ N  + +  +  CL+S+++  +Q+  S   ALL+   K+
Sbjct: 1864 TLILLLAVSRSARKYSLDAHLVDGCIQEIKHIHAQL------NLDS-LRPGKAAHKKKEE-----NHLKQLKVLMQILRNCLYQNEEGKAAAIDSQFPFVLHSLWPWLLMDDALMQGALQLLCVYTAYYPAACTSLCWTNTGVTTPQPPPKTGASNSLMHNILKLAS-DSTA---NNSTVQQMAFALLSNLVVIQDSKCIIQKSNFLQNFLTLSLPKAGTKSLCILA--NNWLKFLWNLSMGSDGQQMILKLKGSLDLLVELTTYKQKMISPVALLILHNVCFNTANKAKILSNDKA-VAVLSTCLESDNLLDQQIGCSAFWALLHGYQKV 2175          

HSP 3 Score: 72.7886 bits (177), Expect = 8.793e-12
Identity = 41/131 (31.30%), Postives = 69/131 (52.67%), Query Frame = 2
Query:  593 LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFI-------SEKQYSTIAVKAISKLCYKMLQYINTCLDPNFFSTKNTFGIINQNYGEYEEDNHWN 964
            LK S  P +PLT  DK+VLS +  +LRS++  +V    Q   DV+++DFP  +FLQR  +++ LL           ++  ++ ++  +S+LC  +    +   DPNF STK    + + ++  Y  D   N
Sbjct:  178 LKFSTFPWLPLTTTDKHVLSSNESSLRSNNPSLVWRSCQLLQDVVMQDFPPEIFLQRPKIVQSLLSLFGLASEKDGQQHLASQSISCLSQLCTLLRNRFSFHRDPNFLSTKQEI-VSHNSFASYCHDAQAN 307          

HSP 4 Score: 54.299 bits (129), Expect = 3.439e-6
Identity = 36/110 (32.73%), Postives = 60/110 (54.55%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQLKLYSNTSNFQILDQIIKNL 378
            ++  V KL H L E+R RALKNI  K++  ++++ DL + K F  +LLEWFN   V     VL L+    +     + +I++G ++F +QL+         ++D I+  L
Sbjct:    3 ISTLVKKLGHQLVEIRERALKNILCKLDHNLVSLVDLAQEKTFFLHLLEWFNFPAVPMKADVLHLLNKLVKHSEAAQWLIQLGAVDFFSQLRSNVEPDLQAVVDSILDGL 112          
BLAST of Rotatin vs. Ensembl Xenopus
Match: RTTN (rotatin [Source:NCBI gene;Acc:100379860])

HSP 1 Score: 90.8929 bits (224), Expect = 3.090e-17
Identity = 195/985 (19.80%), Postives = 372/985 (37.77%), Query Frame = 2
Query: 1460 LITYIELFDQNFAKLNKESNRLMQSSESLIKFFL-NNNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLISSTEIFGNREDMFIKCDE---ILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVNDNKHERWFPRLLNGQSKSLDI-DNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGG----LHYVLELLKGKILDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEIKILE--------IIGDRILLPFRVGKYSANKTSKTEWTFSNFSKIPNQKWNYQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLN----VDIYDIFNETSL----WISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDFIQWLVQIMTTPNNS-LFYFLEKGDKLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYPFDNLSKLLIHIHLMSRSLELKSNFFQG-----NTLKVISNVINLCG----------------------DLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWLR------------------KSPWLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLD 4201
            +I+++E  +     + K+S+    S E    F L +  E  K   + +  AE +L  L +       ++F    S     +IF + +   +  +E   +L  LM      +    +    +IV++SL I    KP S+    I+FLL + +   +  FGL     EI   A  +   L +G+ +M    W  ++      +  LQ   D    +G  IL L  +++++                  I   L   ++K   VR  A +++   L  +    C+   Q +   L ++V     E+     L+   KS  + D  +K+ +I+LS  +D +++KSAAEQ+ +  Q   MH+     G     LHY+ + ++    D      ++   +++L +IV      R  L      +  L +++L    +   + + +++L +++F+ + + D  S  I             +  R  LP  V  Y A        + S         W   +     LR+ W +  H G++ +L         K + ++      +EI   ++ L L+  ++  L  +     L D L  I  A++H +V+S++  +       N   LN    ++       +SL    W +   +FLL  P+C  D  LL  ++  L  I++    N     +QW+++++   + S LF  +E+ +    K         +  ++  L  FF  LM                              +CL  +T           +  + +HL++R     +  F G      TL+ +S+V +  G                      ++I  F+     +++++MG GV    +  L+     HL  E+    +     TDW+                      WL+ L   R  ++R  S  I S +   ++    L   C  I    LW    +++L+
Sbjct:  533 VISFMEQLNSEHCGIYKQSSETAYSIECATTFMLYSRKEGKKDFIELVELAEKALSSLPFHKHFPLVQKFIQICS-----DIFKSAQSSPVLLEESQKVLLCLMSHWMPLVKAEAYKTNLEIVKDSLGIHNVTKPVSSVCQGIHFLLHSKVLYEISTFGLQESNSEICTAAKTILSYLLQGRLVMENHTWNTLIESICPVIPVLQGFADTEETLGTSILTLCETSANDDGILPKTA---------RIRAALRQLFSKKQAVRSVAIKWIAVHLMNEEDSTCK-RPQILGSTLSNAVCLFILEQPLDLKLDNNEKSFFMEDTVQKVCEIFLSDTVDFALQKSAAEQMSVIAQDVKMHSVLKKPGVVDKILHYLYKYVQQ---DGKAFECMILPCLMLLRKIVYADPGFRLTLSQKPCFLLTLFRVSLMMQQEVTSLTEAAALLCMLLFDEISRMDTWSEAIPFCTQPPFGLPVTVVRRFHLPVLVSAYHAVSPYTMASSLS-------ADWLTSKPVSVMLRMSWNISWHQGVDPFL---------KTVANEQ-----EEIENSLETLKLSPEEVLTLKMTHSVSGLQDCLSSIIQAVSHGEVRSAVARM-------NFYLLNDRLVLNCLTACYMSSLKCLPWHTALSRFLLVHPACEEDEKLLADVIRFLNKILQEQKGNSDPHDLQWILEMLLKQSPSPLFELMEQKEYPAKKDLDDTRAAVRQHLQKELMMFFNTLM------------------------------LCLTSVTDRKCLVLGGTFRTQLALHLLNRLKISDAPHFYGLPSLAQTLRGMSHVTSQPGWSAYSPSTEPFAICVKTLTSLLEIISSFYVEWGGNALSYMGKGVTKSTVLCLL-----HLSHEMTAQAK----NTDWIHLWTLPYDHGTEDQVLSRLGLEWLIPLWVDRDPEVRFTSLGIASALTCLQKGCLALSASCQNI-SGGLWGTVFSIFLN 1431          

HSP 2 Score: 75.8702 bits (185), Expect = 8.728e-13
Identity = 90/336 (26.79%), Postives = 162/336 (48.21%), Query Frame = 2
Query: 5378 TLKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTVK-LIFLLLSNLVWCPEGINILLRIRFLDKFEQIN-PNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLK 6379
            TL +LL  S+  + Y +    ++    EIK++H++L      N+D  +R  K +   + +       +K++  ++++L+N  Y++   ++ A+   F  +++ LW   L+D  L+   L  L   +A       ++   +        PP  G+S SL+ NI +L S D TA     +TV+ + F LLSNLV   +   I+ +  FL  F  ++ P    KS   +A  N WL  + +LS   +GQ  I+K  GS  + V        ++    LLI+ N+C +   K K++ N  + +  +  CL+S+++  +Q+  S   ALL+   K +  LK
Sbjct: 1864 TLILLLAVSRSARKYSLDAHLVDGCIQEIKHIHAQL------NLDS-LRPGKAAHKKKEE-----NHLKQLKVLMQILRNCLYQNEEGKAAAIDSQFPFVLHSLWPWLLMDDALMQGALQLLCVYTAYYPAACTSLCWTNTGVTTPQPPPKTGASNSLMHNILKLAS-DSTA---NNSTVQQMAFALLSNLVVIQDSKCIIQKSNFLQNFLTLSLPKAGTKSLCILA--NNWLKFLWNLSMGSDGQQMILKLKGSLDLLVELTTYKQKMISPVALLILHNVCFNTANKAKILSNDKA-VAVLSTCLESDNLLDQQIGCSAFWALLHGYQKAKATLK 2180          

HSP 3 Score: 72.7886 bits (177), Expect = 8.588e-12
Identity = 41/131 (31.30%), Postives = 69/131 (52.67%), Query Frame = 2
Query:  593 LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFI-------SEKQYSTIAVKAISKLCYKMLQYINTCLDPNFFSTKNTFGIINQNYGEYEEDNHWN 964
            LK S  P +PLT  DK+VLS +  +LRS++  +V    Q   DV+++DFP  +FLQR  +++ LL           ++  ++ ++  +S+LC  +    +   DPNF STK    + + ++  Y  D   N
Sbjct:  178 LKFSTFPWLPLTTTDKHVLSSNESSLRSNNPSLVWRSCQLLQDVVMQDFPPEIFLQRPKIVQSLLSLFGLASEKDGQQHLASQSISCLSQLCTLLRNRFSFHRDPNFLSTKQEI-VSHNSFASYCHDAQAN 307          

HSP 4 Score: 54.299 bits (129), Expect = 3.218e-6
Identity = 36/110 (32.73%), Postives = 60/110 (54.55%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQLKLYSNTSNFQILDQIIKNL 378
            ++  V KL H L E+R RALKNI  K++  ++++ DL + K F  +LLEWFN   V     VL L+    +     + +I++G ++F +QL+         ++D I+  L
Sbjct:    3 ISTLVKKLGHQLVEIRERALKNILCKLDHNLVSLVDLAQEKTFFLHLLEWFNFPAVPMKADVLHLLNKLVKHSEAAQWLIQLGAVDFFSQLRSNVEPDLQAVVDSILDGL 112          
BLAST of Rotatin vs. Ensembl Mouse
Match: Rttn (rotatin [Source:MGI Symbol;Acc:MGI:2179288])

HSP 1 Score: 100.523 bits (249), Expect = 2.664e-20
Identity = 217/1041 (20.85%), Postives = 406/1041 (39.00%), Query Frame = 2
Query:  593 LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFI-------SEKQYSTIAVKAISKLCYKMLQYINTCLDPNFF-------STKNTFGIINQNYGEYE-------------------------EDNHWNS------------DDLLGFHYEPNFG---LPE------------PLPVPVFCLQVINVCLYHILEIDTDSNWAELFHLICTAIELFRESFGSDLRQPYLLELWNLKDQINDVLTLWSRLLKQYSIIEDMNYRKLS-----------NKRQIYLCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQSSESLIKFFLN-NNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLI-----SSTEIFGNREDMFIKCDEILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRN-----FQNNIIKFLPLFYNKNYDVRKEACQYL------EQFLRFDRLWNCQLNIQNMTD-FLVSSVNDNKHERWFPRLLNGQSKSLDIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKI-LDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEIKILEIIGDRILLPFRV-GKYSANKTSKTEWTFSNFS---KIPNQKWNYQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLN-VDIYDIFNETSLWISTFHKFLLNIPSCSADFILLEFIMDVLENIIK 3412
            L+ SV P +PLT  D++VLS +  +LRS +  ++ +  +   DVI++DFP+ +FLQR  +++ LL  +        + + +  +V  + +LC  +   +N   DPNFF       S  ++    ++  G Y                          +   W++            +  +  H   +     LPE             L +P FC+  +      +L   +      +  L+   + L  ++  S++     L   N+K+++  VL          S+ E M YRK S           + R  ++ +       +  +   E A ++L E     L     D  + L   E    ++ Y+E  D     + K +   + S E    F  +   E  K   + +  A+ +L    Y       KE     S I     +S  + G  + +F+         +K   +  C        +IV+  L ++   KP S+  + I+FLL   +   +  FG+     E++  A A+   L +G+ +M+ + W + +      +  LQ   D    +G  IL L              K+S++           +   L L   K   VR  A + L      E+     R +     +  +T+ F+V    D K       L + +   + ++  KK+ DI+ S ++D+ +RKSAAEQL + +Q   MH        +  ++  L   +  D   +  L+   + +L +++     IR +L   + L+  L++++L F  D   VA++ ++  L++F+ V + D  S  +     +     LP  V  +Y            S +S    +P +    +   +  LRI W L  + G +N L+   S    KI +  D   L  E +  + K+T T+S L             D L  I  A  H  V++++  +   L+    +  + +    +  ++  W +  ++FL  +P+C+ D  LL  I+  L  +IK
Sbjct:  170 LRFSVFPWLPLTTTDRHVLSSNESSLRSSNHTLIWNTCELLKDVIMQDFPAEIFLQRPKIVQGLLCLVKLAFGGDGKHRLALQSVSCLQQLCTSLRNRLNFYRDPNFFSSRQDTVSQNSSLSYCHEARGPYHSPNPSPGSSSSRPSVVGRTGQRPRGDGQDWDAVSSSGSSSHTHVNSRISVHSPLDVAPVDLPELEAEDTLELQFQQLSLPQFCISTLEAA-APLLRTGSREMIIRVLELLAEDMLLIGQAISSEIWDDNSLFAINVKEKLLQVLG---------SLGETMCYRKTSFSMEQAEAVLVHHRMAFVSISLFTVRLLQLLLPVEKASEFLPESMSAALFFVSLDMPISLEYPEIHDTVVAYLEQLDSENYSIYKRTAEAVYSIECTCNFLSDVGKEGEKNLLELVELADQALRSFSYHQHSPLIKEIICICSKIWKSAQASPLLQGESQKVFLHMLSHPLPQVKVETYQCC-------LEIVKECLGVQNVTKPVSSLCSGIHFLLHPKVLYEISAFGIQESKNEVNAAAKAILLYLLQGRLMMTALTWNKFIESLAPVIPVLQGYADTEDPLGNCILLLS-------------KVSSEAGEGALPCTARLKSVLRLLLVKKPSVRSLALKLLAFHLTSEEGADKKRPFIDAGVLSRVTNLFIVKKPIDLK-------LDDRRELVIKLETVKKVCDIFTSDDVDLVLRKSAAEQLAVIMQDIKMHTVVKKLCLVEKIIGHLNEFVGQDGEVIECLIQPCLTLLRKVLYADPVIRVSLSQQASLLTLLLRVSLIFHEDCTVVAEVGALFCLLLFDEVSRMDTWSDTLSDKPSLSSVFSLPVSVFRRYHLPVHVTGHHAVSPYSIVLPLPTECLTLKPVSDM-LRIAWNLAWYHGSDNLLKQMTS--EAKIQEFLDTLQLSTEDILAL-KITYTDSGLK------------DCLQSIIQAGGHRDVRAAITRMSFYLLNDKLSLKDDIGPCGVTLKSLAWHTVLNRFLQVLPACTEDEKLLIDIIHFLNKLIK 1157          

HSP 2 Score: 64.6994 bits (156), Expect = 1.975e-9
Identity = 84/346 (24.28%), Postives = 159/346 (45.95%), Query Frame = 2
Query: 5402 SQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTI---------NTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTV--KLIFLLLSNLVWCPEGINILLRIRFLDKFEQIN-PNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLKSANLVTKL 6403
            S+  + + +R   IE+   ++K+++      AQ N+D+ +R  K  +  +         IKE+   ++LL+N  Y++   +  A+      +++ LW   L++  L+   L  L   +A+           N  + I   H+             S SLI  I +L S  + A    ENT   +L+F+ LSNL    +   ++ +  FL  F  +  P    +  S +AI  LWL L++++SF E+GQ  I++ +G   + +   +          LLI  N+C  P  K K++ N   ++  +  CL+S +   +++  ++L AL Y+  K +  LK+ ++  K+
Sbjct: 1874 SRRAQRHALRSDLIENCMEQMKHIN------AQLNLDL-LRPGKAVLKKKED-----GFIKELSITMQLLRNCLYQNEECKVAALEARLVPVLHSLWPWLLMEDSLMQIALQLLCVYTANFPAGCSSLCWSNYGQCIQTAHR----------GTPSSSLILCILKLAS-QMPA----ENTTIQQLVFMFLSNLALSHDCKGVIQKSNFLQHFLSLTLPKGGNQHLSTVAI--LWLKLLLNMSFGEDGQQMILRLDGCLDLLIEMSKYKHKSSPHMPLLIFHNICFSPANKPKILAN-EKVVTLLAACLESENQTAQRIGAASLWALTYNYQKAKATLKNPSIKRKV 2189          

HSP 3 Score: 53.9138 bits (128), Expect = 3.470e-6
Identity = 33/92 (35.87%), Postives = 52/92 (56.52%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQLK 324
            L   + KL H L E+R RALK+I  K+E  +I   DL + +    +LLEWFN   V   + VL L+    ++    + +I +G +EFL++L+
Sbjct:    3 LAGLIRKLGHQLAEIRERALKSILCKIEHNLICYADLIQERLLFLHLLEWFNFPSVPMKEEVLNLLSRLVKYSPAVQHLIDLGAVEFLSKLR 94          
BLAST of Rotatin vs. UniProt/SwissProt
Match: sp|Q8R4Y8|RTTN_MOUSE (Rotatin OS=Mus musculus OX=10090 GN=Rttn PE=1 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 1.864e-19
Identity = 217/1041 (20.85%), Postives = 406/1041 (39.00%), Query Frame = 2
Query:  593 LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFI-------SEKQYSTIAVKAISKLCYKMLQYINTCLDPNFF-------STKNTFGIINQNYGEYE-------------------------EDNHWNS------------DDLLGFHYEPNFG---LPE------------PLPVPVFCLQVINVCLYHILEIDTDSNWAELFHLICTAIELFRESFGSDLRQPYLLELWNLKDQINDVLTLWSRLLKQYSIIEDMNYRKLS-----------NKRQIYLCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQSSESLIKFFLN-NNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLI-----SSTEIFGNREDMFIKCDEILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRN-----FQNNIIKFLPLFYNKNYDVRKEACQYL------EQFLRFDRLWNCQLNIQNMTD-FLVSSVNDNKHERWFPRLLNGQSKSLDIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKI-LDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEIKILEIIGDRILLPFRV-GKYSANKTSKTEWTFSNFS---KIPNQKWNYQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLN-VDIYDIFNETSLWISTFHKFLLNIPSCSADFILLEFIMDVLENIIK 3412
            L+ SV P +PLT  D++VLS +  +LRS +  ++ +  +   DVI++DFP+ +FLQR  +++ LL  +        + + +  +V  + +LC  +   +N   DPNFF       S  ++    ++  G Y                          +   W++            +  +  H   +     LPE             L +P FC+  +      +L   +      +  L+   + L  ++  S++     L   N+K+++  VL          S+ E M YRK S           + R  ++ +       +  +   E A ++L E     L     D  + L   E    ++ Y+E  D     + K +   + S E    F  +   E  K   + +  A+ +L    Y       KE     S I     +S  + G  + +F+         +K   +  C        +IV+  L ++   KP S+  + I+FLL   +   +  FG+     E++  A A+   L +G+ +M+ + W + +      +  LQ   D    +G  IL L              K+S++           +   L L   K   VR  A + L      E+     R +     +  +T+ F+V    D K       L + +   + ++  KK+ DI+ S ++D+ +RKSAAEQL + +Q   MH        +  ++  L   +  D   +  L+   + +L +++     IR +L   + L+  L++++L F  D   VA++ ++  L++F+ V + D  S  +     +     LP  V  +Y            S +S    +P +    +   +  LRI W L  + G +N L+   S    KI +  D   L  E +  + K+T T+S L             D L  I  A  H  V++++  +   L+    +  + +    +  ++  W +  ++FL  +P+C+ D  LL  I+  L  +IK
Sbjct:  170 LRFSVFPWLPLTTTDRHVLSSNESSLRSSNHTLIWNTCELLKDVIMQDFPAEIFLQRPKIVQGLLCLVKLAFGGDGKHRLALQSVSCLQQLCTSLRNRLNFYRDPNFFSSRQDTVSQNSSLSYCHEARGPYHSPNPSPGSSSSRPSVVGRTGQRPRGDGQDWDAVSSSGSSSHTHVNSRISVHSPLDVAPVDLPELEAEDTLELQFQQLSLPQFCISTLEAA-APLLRTGSREMIIRVLELLAEDMLLIGQAISSEIWDDNSLFAINVKEKLLQVLG---------SLGETMCYRKTSFSMEQAEAVLVHHRMAFVSISLFTVRLLQLLLPVEKASEFLPESMSAALFFVSLDMPISLEYPEIHDTVVAYLEQLDSENYSIYKRTAEAVYSIECTCNFLSDVGKEGEKNLLELVELADQALRSFSYHQHSPLIKEIICICSKIWKSAQASPLLQGESQKVFLHMLSHPLPQVKVETYQCC-------LEIVKECLGVQNVTKPVSSLCSGIHFLLHPKVLYEISAFGIQESKNEVNAAAKAILLYLLQGRLMMTALTWNKFIESLAPVIPVLQGYADTEDPLGNCILLLS-------------KVSSEAGEGALPCTARLKSVLRLLLVKKPSVRSLALKLLAFHLTSEEGADKKRPFIDAGVLSRVTNLFIVKKPIDLK-------LDDRRELVIKLETVKKVCDIFTSDDVDLVLRKSAAEQLAVIMQDIKMHTVVKKLCLVEKIIGHLNEFVGQDGEVIECLIQPCLTLLRKVLYADPVIRVSLSQQASLLTLLLRVSLIFHEDCTVVAEVGALFCLLLFDEVSRMDTWSDTLSDKPSLSSVFSLPVSVFRRYHLPVHVTGHHAVSPYSIVLPLPTECLTLKPVSDM-LRIAWNLAWYHGSDNLLKQMTS--EAKIQEFLDTLQLSTEDILAL-KITYTDSGLK------------DCLQSIIQAGGHRDVRAAITRMSFYLLNDKLSLKDDIGPCGVTLKSLAWHTVLNRFLQVLPACTEDEKLLIDIIHFLNKLIK 1157          

HSP 2 Score: 64.6994 bits (156), Expect = 1.381e-8
Identity = 84/346 (24.28%), Postives = 159/346 (45.95%), Query Frame = 2
Query: 5402 SQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTI---------NTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTV--KLIFLLLSNLVWCPEGINILLRIRFLDKFEQIN-PNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLKSANLVTKL 6403
            S+  + + +R   IE+   ++K+++      AQ N+D+ +R  K  +  +         IKE+   ++LL+N  Y++   +  A+      +++ LW   L++  L+   L  L   +A+           N  + I   H+             S SLI  I +L S  + A    ENT   +L+F+ LSNL    +   ++ +  FL  F  +  P    +  S +AI  LWL L++++SF E+GQ  I++ +G   + +   +          LLI  N+C  P  K K++ N   ++  +  CL+S +   +++  ++L AL Y+  K +  LK+ ++  K+
Sbjct: 1874 SRRAQRHALRSDLIENCMEQMKHIN------AQLNLDL-LRPGKAVLKKKED-----GFIKELSITMQLLRNCLYQNEECKVAALEARLVPVLHSLWPWLLMEDSLMQIALQLLCVYTANFPAGCSSLCWSNYGQCIQTAHR----------GTPSSSLILCILKLAS-QMPA----ENTTIQQLVFMFLSNLALSHDCKGVIQKSNFLQHFLSLTLPKGGNQHLSTVAI--LWLKLLLNMSFGEDGQQMILRLDGCLDLLIEMSKYKHKSSPHMPLLIFHNICFSPANKPKILAN-EKVVTLLAACLESENQTAQRIGAASLWALTYNYQKAKATLKNPSIKRKV 2189          
BLAST of Rotatin vs. UniProt/SwissProt
Match: sp|Q86VV8|RTTN_HUMAN (Rotatin OS=Homo sapiens OX=9606 GN=RTTN PE=1 SV=3)

HSP 1 Score: 93.2041 bits (230), Expect = 3.020e-17
Identity = 218/1036 (21.04%), Postives = 412/1036 (39.77%), Query Frame = 2
Query: 1301 IYLCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQSSESLIKFFLN-NNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLI-----SSTEIFGNREDMFIKCDEILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVND---NKHERWFPRLLNGQSKSLDIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKI-LDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEIKILEIIGDRILLPFRV-GKYSANKTSKTEWTFSNFSKIPNQKWN--YQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLNVDIYDIFNETSL-WISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDFIQWLVQIMT--TPNNSLFYFLEKGDKLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYP-FDNLSKLLIHIHLMSRSLELKSNF--FQG-NTLKVISNVINLCG-------DLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWL--------------RKSPWLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLDISEAPIVRSEAISILQNLLGKLPFPNSM 4285
            I + LFA+    + ++   E A ++L E   T L     D  + L        ++ Y+E  +     + K +   + S E    F  +   E  K   + +  A+ +L    Y       KE     S I     +S  + G  + + +         +K+  +  C        +I +  L +    KP S+  N I+FLL   +   + +FG+     E++  A A+   L +G+ +M+ + W + +      +  LQ   D    +G  IL L  ++S                    +   L L   K   VR  A + L   L  +   + +  + +    ++S V D    K      RL + +   + ++  +K+++I+ S ++D+ +RKSAAEQL + +Q   MH        +  ++E L   +  D   +  LV   + +L +++     +R +L   S L+  L +++L F  D   V ++ ++  L++F+ V + D  S        +     LP  V  +Y            S +S +     +    +     LRI W L  + G +N L        K++       +++D        L L+  D+  L  +     L D LH I  A  H +V++++  +   L+    +             SL W +  ++FL  +P+C+ D  LL  I+  L  +IK    N   + + W+++++   + N  L   +    +   +TD  R T  + +++  L   F  L+    LN ++++ ++    S+++ + +    + L Q  +  + P F  L  L        R+L   +N   F G ++   ++  +++C        ++I  F+  R  ++++FMG GV    +  L+     HL  E+     +    + W               +   WL+ L   R  ++R  S  + S +   E     L   C  I    LW   + + LD SE  +VR EA  ILQNLL  +P P  +
Sbjct:  474 ISISLFAV--RLLQTLLPVEKASEFLSEPMSTALFLLSLDMPISLEYPNIHEAVVAYLEQLNSENYSIYKRTAEAVYSIECTCNFLSDIGKEGEKNLLELVELADQALRSFSYHQHFPLIKEIISICSKIWKSAQASPLLQGESQKVLLHMLSHPLPRVKAETYHCC-------LEITKECLGVHNVTKPVSSLCNGIHFLLHPKVLYEISVFGIQEPESEVNTAAKAILLYLLQGRLMMTALTWNKFIESLCPVIPILQGYADTEDPLGNCILLLSKASS---------DTEEMLPCTTRLKSMLRLLLVKKPSVRSLALKLLAFHLTSEEGADTKRPLIDAR--VLSRVTDLFIGKKPIEL-RLDDRRELVIKLETVEKVYEIFTSDDVDLVLRKSAAEQLAVIMQDIKMHAVVKKLCLIDKIIEYLNECVSQDGKVVECLVQPCLTLLRKVLCGDPVMRVSLSQQSSLLTVLFRVSLIFHEDCSVVTEVGALFCLLLFDEVSRMDMWSVNPSNKPSLPSVFSLPVSVFRRYHLPVHVIGHHAVSPYSIVLPLSADCLALKPVSDMLRIAWNLSWYHGSDNLL--------KQMNSETKTQEILD-------ALKLSTEDILTLKITHMASGLQDCLHSIVQAATHREVRAAVTRMSFYLLNDRLSLKGCPGPCGVTLKSLAWHTALNRFLQVLPACTEDEKLLIDIIHFLNKLIKEQRKNSSLELLNWILELLLRHSANPLLDLLVLTESQAREETDDIR-TAVRQQLQKELIALFDTLL----LNFMEVTDRKC---SELLYVFQTQLALKLLQCLKVTDAPHFYGLPSL-------ERTLRGMANLTAFPGWSSHSPLTKPLDICVKYLSGLLEVITSFYVERGGNAMSFMGKGVTKSTILCLL-----HLSHEMMAQAGSLEWMSLWFLPLGSHSEEHIPTQQGLAWLIPLWVDRDPEVRFTSLGLGSALTTLETGCVALANSCQNI-SGGLWGTVVNILLDQSECSMVRREAAFILQNLL-VIPMPTEI 1451          

HSP 2 Score: 59.6918 bits (143), Expect = 4.332e-7
Identity = 93/386 (24.09%), Postives = 177/386 (45.85%), Query Frame = 2
Query: 5375 NTLKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTV-KLIFLLLSNLVWCPEGINILLRIRFLDKFEQIN-PNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNG-----SGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLKSANL---VTKLMSL-REIYENDSKNGL-------LLDIISLLNA 6478
            N L  LL  S+  + + ++   I++   ++K+++      AQ N+D  +R  K ++  +        +IKE+   ++LL+N  Y++   +  A+      +++ LW   L+D  L+   L  L   +A+  N   ++                  S SL+  I +L S       L   TV +++F+LLSNL    +   ++ +  FL  F  +  P    K  S + I    L L++++S  E+GQ  I++ +G     + + K  +  + +L      LLI  N+C  P  K K++ N   +I  +  CL+S +   +++  + L AL+Y+  K +  LKS ++   V +  SL ++ + N   N L       L +++ LLN+
Sbjct: 1864 NALMSLLAVSRRAQKHALKANLIDNCMEQMKHIN------AQLNLD-SLRPGKAALKKKED-----GVIKELSIAMQLLRNCLYQNEECKEAALEAHLVPVLHSLWPWILMDDSLMQISLQLLCVYTANFPNGCSSLCWSSCGQHPVQATHRGAVSNSLMLCILKLAS----QMPLENTTVQQMVFMLLSNLALSHDCKGVIQKSNFLQNFLSLALPKGGNKHLSNLTILW--LKLLLNISSGEDGQQMILRLDGCLDLLTEMSKYKHKSSPLL-----PLLIFHNVCFSPANKPKILAN-EKVITVLAACLESENQNAQRIGAAALWALIYNYQKAKTALKSPSVKRRVDEAYSLAKKTFPNSEANPLNAYYLKCLENLVQLLNS 2225          

HSP 3 Score: 56.9954 bits (136), Expect = 2.730e-6
Identity = 42/123 (34.15%), Postives = 66/123 (53.66%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQLKLYSNT-SNFQI-LDQIIKNLLKVNSNDTILS 411
            L   + KL H L E+R RALK+I  K+E  +I   DL + ++   +LLEWFN   V   + VL L+    ++    + ++ +G +EFL++L+  SN   N Q  +D I+  L  + S    LS
Sbjct:    3 LAGLIRKLGHQLAEIRERALKSILCKIEHNLICYADLIQERQLFLHLLEWFNFPSVPMKEEVLNLLSRLVKYPPAVQHLVDVGAVEFLSKLR--SNVEPNLQAEIDGILDGLFLLPSEVPALS 123          

HSP 4 Score: 55.8398 bits (133), Expect = 6.485e-6
Identity = 38/119 (31.93%), Postives = 67/119 (56.30%), Query Frame = 2
Query:  593 LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFI------SEKQYSTIAVKAISKLCYKMLQYINTCLDPNFFSTKNTFGIINQN 931
            LK S  P +PLT  D++VLS +  +LRS +  ++ +  +   DVI++DFP+ +FLQR  +++ LL  +       + + +  +V  + +LC  +   +N   DP FFS K+    ++QN
Sbjct:  170 LKFSTFPWLPLTTTDRHVLSSNESSLRSSNHTLIWNTCELLKDVIMQDFPAEIFLQRPKIVQSLLSLLKLAFGDGKHRLALQSVSCLQQLCMYLRNRLNFHRDPGFFSNKH--DTVSQN 286          
BLAST of Rotatin vs. TrEMBL
Match: A0A210R0J0 (Rotatin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT13424 PE=4 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 4.889e-81
Identity = 422/1829 (23.07%), Postives = 772/1829 (42.21%), Query Frame = 2
Query: 1265 DMNYRKLSNKRQIYLCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQSSESLIKFF-LNNNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLISSTEIFGNREDMFIKCDEILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQL------NIQNMTDFLV----SSVNDNKHERWFPRLLNGQSKSLDIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKILDKSHLSIL--VP---STILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQD-----NLSAEIKILEIIGDRILLPFRVGKYSANKTSKTEWTFSNFSKIPNQKWNYQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLNVDIYDIFNETSLWISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKD-FIQWLVQIMTTPNNSLFYFLEKGDKLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYP----FDNLSKL------LIHIHLMS----RSLELKSNFFQGNTLKVISNVINLCGDLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWLRKSP--------------------WLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLDISEAPIVRSEAISILQNLLGKLPFPNSMEIPIDVNQN----DENEDISSLFIDRNSSGKYQEINGFYQKLLYL--DFFRKAGLSLTNFYTLPFINCSYFKHKPLYDPEYQINFDSDFQKSVNINQILSQMR------------------------------TACEI---NISTPLMISALVSFLCNLYYYLPDQVSSQFNELRINTLIM---NMFDPHTLKVYMESFQTEHYSTTVDLVLA-----FTNCVKLIRLQINMNSSLKDSFLIDEKFIETIIQLLIVTKPTSDFDESHDNRLMKLDLYKYISQLRVEILYLLISLVIPTPIKNHVQLMLAHV--ASHVTGIFNCIKEMIEIESRKSGNVALCFVSVFLCLSSSESKFNSLIRSLESQRFSNS--------ERVIIEDFTELLLKKRESLSRINAKSHS---YTDTSINERINVHNTLKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTVKLIFLLLSNLVWCPEGINILLRIRFLDKFEQINPNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLKSANLVTKL 6403
            D N   L   R  Y+ +       + ++   + A   L E+    +    +D+ L     E  + L+T ++L D++  ++  ++ ++ QS     KF  L   E  K + +  + AE SL  L+Y   +    EF    S + +       +D+   C ++L + +      + +  +  +  IV+ S+++ EA+ P S +     FL   ++   +++FGL ++  ++ +TA  L C L +   +M+  +W++ M+   + +  LQ   DL TR+G+ +L +     S        K  +  +    +   L   ++ +   R EA + +  FL  ++    +L      ++ N+T+  V     S++D+     F            ID  +K+ DI+ S ++D  V+KSAA+QL I LQ  N+H+ F  + GL  VLE LK  IL     S +  +P   + + IL  +V H   +R  L  D  +   LI+ A     D++   + +  L L++F+ V K D     N      I E++  R  LPFR      +KTS  +         P          +  L++ W +  HGG++  L +      K+           D+      KL L+ SD  ++  +  +  + + +  I NA +H  V ++L  +   L+    A  +  + D+FN    W +T  +FL   PS +AD  LL+ ++  +   I L +TN + D  +QWL +++  P+ +L   L +        D       K  ++  L +F  +            +SK        +KI ++  D+  +QLTQ LN      F NL+ L      L+HI         S EL S         + S V++   +++  FH GR  +S+++MG GV          L   HL  E    + T     +W R+                      W++ L  YR  ++RA    I   +   E  R ++  HC  I P  +W  A ++ LD +E  +VR +A  +L N+  +     S+E+  +V Q     D   ++S + +    +  +   + FYQ++L L  +F+ +  +   +   +P  + S            +   D   Q +   NQ  S+ R                              T  ++   +I+TP ++S++  FL NL    P      F  LR ++ I    NM D + L  YM   + E  S  ++LV       +   + L+R  +  ++ ++   L +E FI +   LL +      F+ S D       L+  +      +L L  +  +      H   M AH    S    + + +++ + +    S N  L F+S+     S E +       L     + +             +D  E+    +     IN   HS     D   ++ I+    L+ LL  S   K+  ++ G +ES    +K  H+KL      N++  I+  K +   ++       ++ ++I   +LL+NF ++ + A+      G   I++RLW    LD  ++   L+ L    A       ++          GQ   Q S+ SL+  + RLT  +     +++ T++ +F LL+ L    EG NI+ +  FL +F  +NP + +KS     ++  WL L+++LSF+ EGQ  ++K+     + +  V++    ++   +LI+RNMC H   K KL+ +   L+ ++  CL S++  I+ ++ S L AL+++N K +V +K+AN++ KL
Sbjct:  505 DNNKSGLIPHRLAYIGVCGFLNQLLKNLVPFQKARSLLPENLVKAVTVVVYDESLSHSYPEIQITLLTVLQLLDKDRYQVYVDTAKVAQSMHKSCKFLMLCQQEAYKGSVELATLAEASLLSLQYHLHLPLVSEFVKLTSSVCARH--SGDQDLQGHCRQVLLKYLSYPLVQVRQQAYNTVLQIVKGSVSVSEASDPSSEACLLGRFLFDTDVLYQIMVFGLDDKDIKVAKTAADLLCHLLDSPLMMTSQMWQEFMDSLLRPLPVLQSYSDLETRLGKCVLAMSDPQMS--------KGPSSLSSLEKLRATLRHMFSSDVRTRAEALKRVAWFLSNEKGSTTKLPVFSDLDVTNLTNIFVMETPRSIDDDLGRSVF-----------QIDGLRKVNDIFKSMSVDPGVKKSAADQLAIILQDHNLHSAFKRDRGLESVLEHLKLAILRDQGPSKIDSLPYLNACVTILRYLVHHDYTLRHRLASDEEIYTCLIRAAFIHQRDERTCYEAAHTLTLLLFDEVAKFDMGGGQNPVVTFSIPEVLKKRYRLPFR--PVCHHKTSPHQG-----PSAPEPDPLENGPPDEMLKVVWNVAWHGGMDKLLSHLKLLKAKQ-----------DKFTEFSVKLHLSCSDRVIIQATHLRQGMQEAVFDISNATSHKGVSAALNRLLTYLVT---AQGHPGVEDVFNLD--WFTTIGRFLKVTPSLTADESLLQEVLKFI--CIALKLTNGVPDNTLQWLGEMLYQPSGTLIGLLHRASVKGEARDVPENVNIKRTLDKELLSFIAM-----------YNSKLPYLLCRRLKIQQLRGDLS-HQLTQRLNVTDAPHFYNLASLEGTLQCLMHITARPGWSHESTELDSG-------ALCSQVLHCLLEVVSAFHIGRGGTSMSYMGKGVTKS-----ATLCLRHLAHE----MATYSDDKNWARQWSHMQQKSDASRSVLTGDSGLIWMLTLWAYRDPEVRAAGLGIAVALTSTEPGRIVMTSHCKHI-PGGIWGAAFSVLLDQAECSMVRQQAALLLVNMTSQTMPCGSVELEQNVWQGPIVTDTEFEVSLVGLTALLALLHH--SQFYQEMLVLLCNFYAQPTIQPVSVLEVPVGHLSSTGSDSTLSTLAEFGTDG-LQSTSGSNQPRSKGRQHIHQTSISSGSKTRNSTTDPTGNSSSSTLTGEQLEYQSIATPSLVSSVCQFLRNLVILAPQDT---FTCLRKDSYIQVLTNMVDTNLLDAYMTEME-EGCSDQLELVFCDLLHMYAAILDLLRACVVYDTPIRQEVLANEGFIRSTAALLTIR-----FEGSADVDGCCQALWSSVLSFLTALLQLQGASAL------HSFTMAAHTLWTSMAETLQSVLQKRLHLNKHLSDN-CLQFLSILF---SEEGRLVGRQPQLAEDTITVTGLLNTPLKSETTDKDEGEVTTGGQLCKVLINVYEHSCLKSPDYKQSDHIHAATCLRTLLAISSSAKDTALQSGLVESVIDHVKQTHAKL------NME-SIQPGKPNTRKKD-----DPLLSDLILTFDLLRNFIFQSLEAKMACYYSGLHNIIHRLWAWCQLDLAVMSSALSLLTTFIAHCPTATSSLAYTTTSASSGGQKSQQLSNNSLVHCLIRLTGRE----GIKDTTLRTLFSLLATLTLSSEGRNIVFKSNFLREFLSLNPRKSKKSKRMQNLELYWLELLVNLSFSVEGQQMLLKTGDCVDLLLDFVESGQGKVQECAVLILRNMCCHTSNKPKLLAS-DKLLPHLLECLTSDNTQIQCVAASALWALVFNNQKAKVMMKNANVIPKL 2219          
BLAST of Rotatin vs. TrEMBL
Match: K1QRC4 (Rotatin OS=Crassostrea gigas OX=29159 GN=CGI_10027200 PE=4 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 2.298e-49
Identity = 241/1068 (22.57%), Postives = 452/1068 (42.32%), Query Frame = 2
Query: 1415 FDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQSSESLIKFF-LNNNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLISSTEIFGNREDMFI--KCDEILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWN------CQLNIQNMTDFLVSSVNDNKHERWFPRLLNGQSKSLDIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKIL----DKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEIKIL-----EIIGDRILLPFRVGKYSANKTSKTEWTFSNFSKIPNQKWNYQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLNVDIYDIFNETSLWISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDFIQWLVQIMTTPNNSLFYFLEKGDKLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYP----FDNLSKL------LIHIHLM----SRSLELKSNFFQGNTLKVISNVINLCGDLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWL-----------------RKSPWLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLDISEAPIVRSEAISILQNLLGKLPFP-NSMEIPIDVNQNDENEDISSLFIDRNSSGKYQEINGFYQKLLYLDFFRKAGLSLTNFYTLPFIN 4468
            FD+ L     +  + ++ YI+    +   L  ++ ++ QS +   +F  L   E  K + + I  AE S+  L Y   +    EF    S I +       +D  +  KC E+L + +      + +  ++ I  +V+ SL + EAA P S +     FL  ++I   +I+FGL +   ++ +TA+ + C + +GQ +M+  +W++V+N   + +  L+   D+ T++G        S   ++ +  + +      +   +   L + ++ +   R E+ + L  FL  ++  N        L++ N+T   +  +  +  E        G+S    ID  +K+++I+ SS++D SV+KSA +QL I LQ  N+H  F + GG+  VL+ LK  ++     +S     +P+   IL  +V    ++R  L  D  +   L+++A     D++   +++ IL L++F+ V K D     + ++      ++  R  LPFR   +  N     E         P+      +     LRI W +  HGG+   L++         +    N    D++     +L L+  +  ++  S     +   L+ + NA +H  V  + +   L  ++ ++ +   ++  +F +   W+S+  +FL   PS   D  LL+ ++  +   ++LS     +  +Q L +++  P+  L     +   + G+T   R       I+  L    L  +   N     +  ++       +K  ++  D+C +QL Q LN      F NL+ L      L+H+       S S EL         L  +  V++        FH GR  +S+++MG GV       L      HL +E+    E       W+                 +   WL+ L  YR  ++R     I   +   E  R++L  HC  I P  +W VA ++ LD SE  +VR +A  +L N+  + P P  S+E+       +EN     +  D  S      +      L +  F+++  +  TNFY  P I 
Sbjct:  545 FDEALAYSYPDIQITVLAYIQNLSPDMYTLFVDTAKISQSVQKSCQFLMLCQEEAYKGSSELIDMAEASIQSLPYHLHLPLVSEFVKLSSSICAR----TSQDKALQNKCVEVLLKFLSHPLPEVKEQTYSTIKQVVKGSLNVNEAADPSSRACYLSRFLFSSDIMYEIIVFGLNDSNPKVSQTASDVICHILDGQLLMTEDLWKEVLNALMRSLPVLETYVDMGTKLG--------STLLSLTDPTEVQAEGGLVYLEKLRGCLRMMFSTDVRARAESLKRLAWFLSNEQNSNEKLPIFASLDVTNLTSIFIVDMQRSLDEDL------GRS-VFQIDGMRKVYEIFSSSSVDPSVKKSAVDQLAIILQDHNLHAPFKAEGGVETVLKHLKLGLVRNDDAQSEYIHYLPACAAILRSLVHFDYKLRHRLARDQEVYLVLLRVAFLHQRDERTCYEVAHILILLLFDEVAKFDLGGGTVPVVHFSIPSVLRKRCRLPFRPACHHDNSPHTVELP-------PDPDPVQTDRPLEMLRISWNVAWHGGMEKLLKH---------LAQSKNSSQKDKMTEFSPRLQLSFIERKIVQCSHLAEGIKQTLYSVSNATSHNAVS-AALGQLLSYLVNSYGYAGSEV--MFGQE--WLSSIGRFLKVHPSMPDDESLLQEVLRFISMALRLS-GEVTEGTLQALGEVLYQPSGPLIGLSHR-TSVRGET---RDVPENVNIKRTLDKELLSFISTYNCKLPYVLCRR-------LKFQQLRGDLC-HQLLQRLNVTDAPHFYNLASLEGTLQCLMHVTARPGWSSESTELGGEALCSQLLACLLEVVS-------AFHIGRGGTSMSYMGKGVTKAATMCL-----RHLAYEMSTTAENKKWAEQWIYVQQRADGQNSAEVEEHQGLDWLLTLWSYRDPEVRVAGLGIGVALTLTESGRTVLTSHCVHI-PGGVWGVAFSILLDQSECSMVRQQAALLLVNMTSQ-PMPCGSVEL-------EENVWQGPVVADTESKVSLVGLTALMALLHHSHFYQEMLVVFTNFYAQPTIQ 1538          

HSP 2 Score: 95.5153 bits (236), Expect = 1.696e-15
Identity = 93/368 (25.27%), Postives = 177/368 (48.10%), Query Frame = 2
Query: 5339 TDTSINERINVHNTLKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXI----SLIENICRLTSADLTAYYLRENTVKLIFLLLSNLVWCPEGINILLRIRFLDKFEQINPNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLKSANLVTKLMSLREIYEN 6430
            TD    +R++    L+ LL  SQ  K   +++GF+E+T   IK LHSK++  A        ++ + ++V             ++I  L++L+N  + + +A+      G   +++++W    ++  L+   ++ L   +A  +    ++         + Q     S      SL+  + +L   D     ++E  +K ++ LL+ L    E  NI+ +  F  +F ++NP + +KS     ++  WL L+++LSF+ EGQ  I+K+  S  + +  V          ++LIIRNMC H   K KL+ N   L   +   L+ +   ++ ++ S L  L+++N K +V +K+ANL+ K   L+EI  N
Sbjct: 1868 TDHKNTDRLHSAAALRNLLAVSQKAKGTALQMGFVETTIENIKQLHSKINMEALQLGKTAAKKKEDALV------------PDLIITLDVLRNLLFMNEDAKMACYHSGLPTVIHKIWPWCQMEPQLMLSTVSLLSTYAAKCLTATSSLAYTSPSTTSTTQNARSSSQQLGANSLVHCLLKLAGRD----NIKEPLLKALYGLLATLALSSECRNIMFKSNFFREFLELNPRKTKKSKHVKKMEVYWLELMLNLSFSTEGQQMILKTGDSVDLLLDFVDCGSGPGLEYSVLIIRNMCCHCSSKPKLLANDKLLPLLLSC-LNKDSGKVQTIAASALLGLVFNNQKAKVMMKNANLLPK---LQEILSN 2215          
BLAST of Rotatin vs. TrEMBL
Match: A0A2C9M5Y7 (RTTN_N domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106052869 PE=4 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 1.243e-48
Identity = 307/1356 (22.64%), Postives = 563/1356 (41.52%), Query Frame = 2
Query:  572 DIEQENLLKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFIS--EKQYSTIAVKAISKL-CY-KMLQY-INTCLDPNFFSTKNTF------------------GIINQ--NYGEYEEDNHWN--------------------SDDLLGFHYEPNFGLPEPLPVPVFCLQVINVCLYHILEIDTDSNWAELFHLICTAIELFRESFGSDLRQPYL-LELW--------NLKDQINDVLTLWSRLL-----KQYSII-EDMNYRKLSNKRQIYLCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQSSESLIKFFLNNNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLISSTEIFGNREDMFIKCDEILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQL----NIQNMTDFLVSSVNDNKHERWFPRLL-NGQSKSL-DIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKILDKS-----HLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQD-----------NLSAEIKILEIIGDRILLPFRVGKYSANKTSKTEWTFSNFSKIPNQKWNYQESFERNLRIHWTLLKHGGLNNYL-RYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLNVDIYDIFNETSLWISTFHKFLLNIPSCSADFILLEFIMDVLENI---IKLSMTNHMKDFIQWLVQIMTTPNNSLFYFLEKGDKLIG---KTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQS------NTRSDIIKIHKMVFDICLNQLTQYLNYP-FDNL----SKLLIHIHLMSR---SLELKSNFFQGNTLKVISNVINLCGDLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWL--RKSP---------WLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLDISEAPIVRSEAISILQNLLGK-LPFPNSMEIP 4294
            D +   L  LS  P +PLT  D+ V+  +  TL++ D  ++I   +F  DV+ +DFP+ +FLQR  +LK LL   S  +     I ++A   L CY K LQ  I++  DP+ ++ K  F                  G   Q  NY ++    H                       DD L    EP+  +   L VP FC+ V+   L    ++ T S       L    IEL +E+   +L  P L + +W        ++ D++ D +  ++ LL     +Q++I  ++ +  ++S  R +Y+ L     +F++ +    + +  L E  K  +    +D+ L L        ++   +    +     +    + +S     +F +  +            AE S+  L Y   + F   F  F S + S++       +  +C  +L +LM     S+    +  I D ++ +L + +A  PKS S     FL+  ++   +  FGL + + ++   +      L + Q +M+  +W++ +    K +  LQ   D  T +GR +  +L   ++  +  L +K+             L L    +  +R +A ++++ FLR + +   +L    ++  M+  L+            P+L+ +  S+S+   +  K+++DI+ S  +D  V+KSA EQ+ I L+  ++H  F S+GG+  V  +++  +L K      + +  +P+ I IL  +  +   +R  L  D  L  +LI++ L     +   AD+S IL L++F+ V K D             S  ++I++    R  LPF+   +    TS +  T  +    P++           ++I W      G++  L  +K  F+      S+ N +  D+++       LT  +  VL  S   + L  N+  I  A +H  V +++  +           L V +   +     W   F+KF++  P+  +D  LL  I+  + ++   +K S+ +     + WL+  +  P   +   L K    +    K   RRL    NK           L+ YL   N+ L  + S        R +I++  +  F+I         + P F NL    S L   +H+ +R   S E  S     +++ + + ++N   +++  FH GR  +S ++MG GV          L   HL +E+    +       WL  R+ P         WL+ L  YR  ++RA    I   +   E  R ++  +C  I P  LW  A ++ LD  E  +V+ +A  +L NL  + +P  N    P
Sbjct:  209 DSQDLGLFHLSTFPWLPLTQTDQQVIESTKSTLQTKDPTMLIGACEFLADVVFQDFPAELFLQRPEILKNLLSITSLPDPLDCLIVIQACKTLTCYLKCLQVRIHSFQDPSMYTLKQDFNASSSTDTSAMHSTDSSRGAYPQRRNYFDWGNQRHRGDGQDVETTPSDSRSSSVNTEPDDQLDMDDEPSL-IQHQLTVPQFCVSVLQRILP---KMHTSSKV-----LGVAVIELIQEAL--NLLMPTLDMGIWTDNRSTSRDVVDRLVDCVDCFTDLLTYHHHRQHTITPKESSLAEVSTHRILYMGLVHTLTSFLTMM---PLDMVQLPEKLKLIVPSIVYDEALALANSRYRSVMLAVAQKLGLSVPTDFQHVVDICRSLNKTCQFCMQVDAKNVSVSDLADMAEESISSLSYHLHLPFVSRFVCFISKLCSSK--AAERSVVTQCTGVLLQLMSYPIDSVRLVCYVTIADTIKKNLQVSQATDPKSQSCLLTKFLINPDVLYEITCFGLADSVAKVRSCSADSLNHLLQSQLLMTEGLWQEFLLALMKSLPVLQGYTDHTTPLGRSLWYILDPTTTTHNLPLFEKLRGS----------LRLMCLSDKKLRMDAAKHVKWFLRSETMAENKLPDNFDVDKMSSLLILPS---------PQLVEDDTSRSVFKEEGLKQVYDIFTSHPVDPGVKKSAGEQMAIMLKDPHLHAAFKSSGGVEVVCFIVQHSVLKKEENVQDNSNSNLPACIFILRYLTHYDYALRHTLAKDQPLYYSLIRVGLIHQESESIRADVSHILTLLLFDEVAKFDVSFGQSQTPGTKFSLPVQIVQ----RYRLPFKPQVHYL--TSPSAITLPD----PSKDIMTTSGPSEMMKITWNCAWQAGIDQLLDSFKTPFF------SETNKEFSDQLI-------LTPVEREVLEISHIPWCLKSNILTIQQATDHSTVMAAVDRMMSYTTA-----LPVPLVIQYFSNQEWFLVFNKFMMVTPTSQSDQSLLLHILSFMNSVLHCLKPSVGSPCP-ALAWLMDKIYQPEGPMISLLNKPGLPVEPEYKNTFRRL----NK----------ELLNYLTSVNLSLPYQLSYRVKPLQLRGEIVRTLQRGFNIG--------DAPHFYNLASLESSLFCLMHITARPGWSCECGSM----DSISLCNQLLNSLLEVVWSFHIGRGGASRSYMGKGVTKS-----CSLCLRHLAYEMITKSDDPGWVKSWLYTRQDPSNGVDQGLNWLLTLWAYRDPEVRAAGLGIAVALTSTEAGRLLVNSNCKHI-PGGLWGAAFSILLDPLECCVVQQQAALLLINLTSQTMPSGNVETTP 1468          

HSP 2 Score: 102.834 bits (255), Expect = 1.129e-17
Identity = 105/377 (27.85%), Postives = 179/377 (47.48%), Query Frame = 2
Query: 5300 ESLSRINAKSHSYTDTSINERINVHNTLKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTVKLIFLLLSNLVWCPEGINILLRIRFLDKFEQINPNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLS-----TLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQL-SLSTLKALLYSNNKIRVYLKSANLVTKLMSL 6412
            ES+ +IN +     + S   ++ V +  K LL  SQ  K + +  G +E     +K  H+ L     + V V  R+                 ++E++ + + L N  + + N +      G  ++V +LW     D+ LL  IL+ L   SA   + A ++     +   +         ++++  + +L   +L         +KL F LL+NLV   E  NILL+  FL++F Q+NP + ++S   +AI  LW  L+ +LSF+ +GQ  I+K     I  VL V  ++L    +     + LIIRN+C H   K KL+     LI  +   +D+     KQL ++S L A +Y+N+K RV +K AN++ +L+ L
Sbjct: 1864 ESVIKINVEEKGTKEAS--RKLKVISAFKSLLAISQSAKEFALDAGLVEVALDYLKQTHASLSLETLDMVKVGGRKEG-------------PYLQELVLMFDFLHNLMFNNANVKVTCYHGGLIVVVQKLWAWCHQDTSLLSSILSLLTVYSAHCNSAAGSL----SLPMSAQSSTKPSGQLTILHGVLKLAQRELDRDECSP-ILKLTFSLLTNLVMNAECRNILLKSTFLNQFSQLNPRR-KRSKVRVAIDMLWCDLLTALSFSVDGQQIILK-----IPDVLTVLLDMLEAGSTHCQHCSTLIIRNLCCHSTNKPKLLAV-DRLIAVLMDQMDNTSDEKKQLVAISALWAFIYNNHKARVQVKLANVLPRLVDL 2213          
BLAST of Rotatin vs. TrEMBL
Match: A0A1S3GZK1 (rotatin OS=Lingula unguis OX=7574 GN=LOC106150846 PE=4 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 1.178e-45
Identity = 287/1367 (20.99%), Postives = 544/1367 (39.80%), Query Frame = 2
Query:  539 NENSNFMKEIADIEQENL-------LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFI---SEKQYS---TIAVKAISKLCYKMLQYINTCLDPNFFSTKNTFGII-----------------------------NQNYGEYEEDNHWNS--------DDLLGFHYEPNFGLPE-------PLPVPVFCLQVINVCLYHILEIDTDSNWAELFHLICTAIELFRESFGSDLRQPYLLELWNLKDQINDVLTLWSRLLKQYSIIEDMNYRKLSNKRQIYLCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQSSESLIKFFLN-NNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLISSTEIFGNREDMFIKCDEILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVND---NKHERWFPRLLNGQSKSLDIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKILDKSHL-----SILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEI-----------KILEIIGDRILLPFR------VGKYSANKTSKTEWTFSNFSKIPNQKWNYQESFERNLRIHWTLLKHGGLNNY---LRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQV-QXXXXXXXXXXXXRNHAFLNVDIYDIFNETSLWISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDFIQWLVQIMTTPNNSLFYFLEKGDKLIGKTDSRRLTLAKNKIE--SRL--PNFFLLLMRYLN--LNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYPFDNLSKLLIHIHLMSRSLELKSNFFQGNTLKVISNVINLCGDLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDW---------LRKSP-------WLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLDISEAPIVRSEAISILQNLLGKLPFPNSMEIPIDVNQN 4312
            +++  F  ++A + +E L       +K S  P +PLT  D++V+S +  +L S D  +VIS  +F +DV+  DFP+ VFLQR  ++K+LL+ +   SE   S   T AVK +  LC  +   I+   DP  ++ K  FG                               NQ  G+  + +  +S        D  +G H + +  + E        L +P  CL+ +      +L  D      ++  L+  ++++   S    +     +   ++ +++ + L +    +  Y   +          R  +L +      F+  +   E A   + EH    +    FD+ L   L       + Y+E  D    +   ++  ++ S +   +F LN  N   + A + I  AE+SL  L Y   +   +E+    S + S         +     ++L E++  +   +    F+    +V+++L I+   KP S    KI FLL  ++   +  FG+ +  + +   A  +   L + Q +M   IW ++M I    M  LQ    L + +G      + S        +   +     F+      L + ++K+   R EA   L  FL  +   + +  +   T+  V+ ++D    +  R+       +     +D+  K+ +I  S ++DI V+KSA +QL I LQ  ++H  F   GGL  VL+ +K  +L ++       +I +P+ + +L  +V     +R  L  +S     +++ ++    ++Q   D S +L L++F+ V   D  S  +            +   +  R  +PF+      + ++  +  S T+         P Q     E     L+I W +  HG + +    LR K     +    +               KL LT +D  +L  +     +   L+ + NA +H +V Q+       + + R H      +Y +      W     +FL  IP+ S+D  LL  I+  L  +++       +    WL  ++     +L         +I   D R+     + ++  +RL        + R++N     I  +S ++  R DI++   ++  + L    Q+ N P  +L   L  +  ++      S     ++  +   ++N   +++  FH GR   S+++MG GV          L   HL +E    +     + DW         L + P       WL+ L  YR  ++RA    I   +   E  R  +  HC +++   +W  A ++ LD  E  +VR +A  +L NL        S+E+  ++ Q 
Sbjct:  191 DQDGQFAGQVAGVTREQLDRDISGCIKFSTFPWLPLTPTDRHVMSSTENSLHSGDQTMVISACEFLSDVVFLDFPAEVFLQRPSIVKILLQLLQVPSEGGTSGVVTAAVKTLRDLCVHLQHRIHFYQDPTLYTPKIDFGASPPSSVASPSNQTLNSSDTRPSVIGRSDTRNQGDGQDRDTSPSDSSRPVSPQEDQDMGNHQQEDTDVDEMDALQFSQLTLPQCCLRTLTRA-APLLRTDRKDTLVDVALLMDESLDVLGLSLTGQVWTDGSITARDMVEKLQEFLQILGE-VSSYHHHQSGTSGDKEQHRLGFLVVSVFLHKFLKLLVPVEQAQSVISEHLSQSVSWIVFDEALSQSLPALRPAFLPYLEAVDGEGYQRFLQAETIVVSMQKTCQFLLNCQNRCDQDATELIQIAEDSLPSLPYHCNLTLVEEYVRLCSDVCSP--VNASPIVMTNSRKVLLEVLAHSLVEVKLRAFSVCLALVKDTLHIDGPGKPSSC--QKILFLLDRHVLYEICCFGMDDANERVLGVAQQVVLYLLQSQLLMPDHIWSRLMQIVAAIMPILQGYAGLQSPLG----SSIRSLCEVTPTPVKGTLPKLERFRG----VLRMMFSKDVRTRAEALSKLAWFLSDEE--DSEKKLPVFTELDVAGLSDLYVIREPRYLEDSDEARRSVFQVDSMMKVVNILRSPSVDIGVKKSALDQLAIMLQDTSLHKVFREEGGLEMVLDSMKTAVLKENSTVQFSETIFLPACVTLLRHLVHSDYHLRHQLAHESQTYYMIVRASILHNKNEQVHYDASHLLLLLLFDEVASIDVWSVAVDSSPKKSVQCFSLPAFMAHRYHIPFKPITHHVISQHRIDLVSSTD---------PLQTGPPAEM----LKIAWNVAWHGDMESLMVDLRKKKEEEKETEFSA---------------KLHLTPADRAILETTHLISAIQQCLYSMCNATSHTEVSQALGRLKTYMTVCRVHGLGAEILYRLK-----WREAIGRFLQVIPASSSDESLLMEILSFLNLMLEAGPVPQAEQV--WLGDLLVKKKGAL-------PNMISLQDGRQQDGEGDHVDDITRLLRKEVLCFVRRFVNRLPQMIAKTSLKTWLRGDIVR--SLLLRLNLADAPQFYNLP--SLESTLPCLTNVTARPGWSSGCKDTDSSTLCLQLLNCLLEVLSAFHIGRGGMSMSYMGRGVTRN-----ATLCLRHLAYE----MSDQSTEEDWPKCWLFTKQLPEHPSTDPAYNWLIPLWTYRDPEVRAAGLGIAVALTSTEAGRITMTTHCQQLI-GGVWGAAFSVLLDHYECSMVRQQAALLLVNLTSDTMPSGSVELGANIWQG 1485          

HSP 2 Score: 89.3521 bits (220), Expect = 1.238e-13
Identity = 138/654 (21.10%), Postives = 284/654 (43.43%), Query Frame = 2
Query: 4592 NISTPLMISALVSFLCNLYYYLPDQVSSQFNELRINTLIMNMFDPHTLKVYMESFQTEHYSTT-------------------VDLVLAFTNCVKLIRLQINMNSSLKDSFLIDEKFIETIIQLLI--VTKPTSDFDESHDNRLMKLDLYKYISQLRVEILYLLISLVIPTPIKNHVQLMLAHV------ASHVTGIFNCIKEMIEIESRKSGNVALCFVSVFLCLSS--SESKFNSL-----IRSLESQRFSNSERVIIED-------FTELLLKKRESLSRINAKSHSYTDTSINERINVHNTLKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXI-SLIENICRLTSAD---LTAYYLRENTVKLIFLLLSNLVWCPEGINILLRIRFLDKFEQINPNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHC----LDSN-HICIKQLSLSTLKALLYSNNKIRVYLKSANLVTKL 6403
            +I+TP ++SA+   L NL   +P        +  +   ++++ DP  L VY    Q     ++                   V LV  +T+ ++L+     +++ +++  L +   ++  ++LL   +T P                + +    L+  +   LISL+  +  +  + +  A V      A  +  IF+     ++       + AL F++V LC      ES    L     I S+  +    +E+   ED        ++ L+K  +++   N   H    T      ++   L+ LL      K   +  G +E     ++ LH++L+     ++ +      G V +  K      +++ ++  LELL++F ++    ++ A   G   +++++W    +D  L++ +L+ L N +A  +  A ++ +   +            +  SL+  + +LT+ +   L+   L  + V+ +F +LSN+V   E   I+ +  F  +F  + P +  K+    A+  +WL L+++LSFT +GQ  I+K   S  + +   ++       S L+++RNMC H   K K++ N     E +  C    L++N  +    +++S L AL+Y+N K +  LK++N++ KL
Sbjct: 1621 SIATPSLVSAVSQLLTNLVVLMPQDTLDCLKKEGLLRALVSLTDPDLLAVYTRDMQQSKTPSSSPSSGSSEDEGMLRQLVILVGLVEMYTSILQLVTHCCELDTEVREEILQEAVILDGTLRLLEYNITDPI---------------VIEKCQALQTAVYNFLISLLQHSGQQGFLNIAQACVKQWDILAGSLAKIFSGSPSEVQ-------DAALNFITVLLCEEGKIQESYVKKLGHKKSILSMLDKTGGKNEKG--EDSPTSGAILSQALIKLYDTVVVKNVTVHLEARTR-----HISVALRSLLSQCATAKMAALEAGLMEILMEHLRKLHNQLN---MESLQI------GKVTSGRKKDD--PLLESMVLTLELLRSFMHDQAEVKTAAQLSGLSSVLHQMWGWCHVDQALMNAVLHVLANYTAKCLAAASSLALTSALSSVDLPNAKPQHNNNSLVHCLLKLTTRECERLSKTSL--SMVRTLFAILSNIVLSSECRGIMWKSNFFHRFSSLCPLKPSKTKVQQALDVMWLELLVNLSFTTDGQQMILKMGDSLALLLEFCESEHSQAASSALMVLRNMCHHSANKPKILGN-----EKVVPCLLRYLETNLDVGDATVAMSALWALVYNNQKAKATLKNSNMLRKL 2227          

HSP 3 Score: 67.3958 bits (163), Expect = 6.300e-7
Identity = 37/113 (32.74%), Postives = 66/113 (58.41%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQLKLYSNTSNFQILDQIIKNLLKV 387
            L     KL H L+E+R RAL+N+ +K++  II   DL + K  +  LLEWFN     + D V+ L+   ++     + +  IGG+EFLTQL++  +     ++DQ+++ ++++
Sbjct:   11 LQPLFRKLGHQLEEIRVRALRNVQSKLDHHIICDADLVQEKHLLIRLLEWFNFPTCPHQDEVMTLLARLAKHSSAAQLLQDIGGVEFLTQLRVNCDKVLHPLIDQVLEYMMRL 123          
BLAST of Rotatin vs. TrEMBL
Match: A0A1S3K5M3 (rotatin-like OS=Lingula unguis OX=7574 GN=LOC106178910 PE=4 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 5.714e-44
Identity = 294/1341 (21.92%), Postives = 537/1341 (40.04%), Query Frame = 2
Query:  593 LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFI---SEKQYS---TIAVKAISKLCYKMLQYINTCLDPNFFSTKNTFGIINQNYGEYEEDNHWNSDD----LLGFHYEPNFG-------LPEPLPVPVFCLQVINVCLYHILEIDTDS----NWAELFHLICTAIELFRES--FGSDLRQPYLLELWNLKDQINDVLTL------WS-----------------RLLKQYSIIEDMNYRKLSNKRQ---IYLCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQSSESLIKFFLN-NNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLISSTEIFGNREDMFIKCDEILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVND---NKHERWFPRLLNGQSKSLDIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKILDKSHLS-----ILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEI-----------KILEIIGDRILLPFR------VGKYSANKTSKTEWTFSNFSKIPNQKWNYQESFERNLRIHWTLLKHGGLNNY---LRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQV-QXXXXXXXXXXXXRNHAFLNVDIYDIFNETSLWISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDFIQWLVQIMTTPNNSLFYFLEKGDKLIGKTDSRRLTLAKNKIE--SRL--PNFFLLLMRYLNL--NNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYPFDNLSKLLIHIHLMSRSLELKSNFFQGNTLKVISNVINLCGDLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDW---------LRKSP-------WLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLDISEAPIVRSEAISILQNLLGKLPFPNSMEIPIDVNQN 4312
            +K S  P +PLT  D++V+S +  +L S D  +VIS  +F +DV+  DFP+ VFLQR  ++K+LL+ +   SE   S   T AVK +  LC  +   I+   DP  ++ K  FG    +      +   NS D    ++G     N G        P     PV   +  ++  +   + D D      +++L    C    L R +    +D R+  L+++  L D+  DVL L      W+                 ++L + S           +K Q    +L +      F+  +   E A   + EH    +    FD+ L   L       + Y+E  D    +   ++  ++ S +   +F LN  N   + A + I  AE+SL  L Y   +   +E+    S + S         M     ++L E++  +   +    ++    +V+++L I+   KP S    KI FLL  ++   +  FG+ +  + +   A  +   L + Q +M   IW ++M I    M  LQ    L + +G      + S      + +   +     F+      L + ++K+   R EA   L  FL  +   + +  +   T+  V+ ++D    +  R+             +D+  K+ +I  S ++DI V+KSA +QL I LQ  ++H  F   GGL  VL+ +K  +L ++  +     I +P+ + +L  +V     +R  L  +S     +++ ++    ++Q   D+S +L L++F+ V   D  S  +            +   +  R  LPF+      + ++  +  S T+         P Q     E     L+I W +  HG + +    LR K     +    +               KL LT +D  +L  +     +   L+ + NA +H +V Q+       + + R H      +Y +      W     +FL  IP+ S D  LL  I+  L  +++       +    WL  ++     +L         +I   D R+     + ++  +RL        + R++N     I  +S ++  R DI++   ++  + L    Q+ N P  +L   L  +  ++      S     ++  +   ++N   +++  FH GR   S+++MG GV          L   HL +E    +     + DW         L + P       WL+ L  YR  ++RA    I   +   E  R  +  HC +++   +W  A ++ LD  E  +VR +A  +L NL        S+E+  ++ Q 
Sbjct:   10 IKFSTFPWLPLTPTDRHVMSSTENSLHSGDQTMVISACEFLSDVVFLDFPAEVFLQRPSIVKILLQLLQVPSEGGTSGVVTAAVKTLRDLCVHLQHRIHFYQDPTLYTPKIDFGASPPSSVASPSNQTLNSSDTRPSVIGRSDTRNQGDGQDRDTSPSDSSRPVSPQEDQDMGNHQQEDTDVDEMDALQFSQLTLPQCCLRTLTRAAPLLRTD-RKDTLVDVALLMDESLDVLGLSLTGQVWTDGSITARDMVEKLQEFLQILGEVSSYHHHQSGTSGDKEQHRLGFLVVSVFLHKFLKLLVPIEQAQSVISEHLSQSVSWIVFDEALSQSLPALRPAFLPYLEAVDGEGYQRFLQAETIVVSMQKTCQFLLNCQNRCDQDATELIQIAEDSLPSLPYHCNLTLVEEYVRLCSDVCSP--VNASPLMMTNSRKVLLEVLAHSLVEVKLRAYSVCLALVKDTLHIDGPCKPSSC--QKILFLLDRHVLYEICCFGMDDANERVLGVAQQVVLYLLQSQLLMPDHIWSRLMQIVAAIMPILQGYAGLQSPLG----SSIRSLCEVTPSPVKGTLPKLERFRG----VLRMMFSKDVRTRAEALSKLAWFLSDEE--DSEKKLPVFTELDVAGLSDLYVIREPRYLEDSDEAGRSVFQVDSMMKVVNILRSPSVDIGVKKSALDQLAIMLQDTSLHKVFREEGGLEMVLDSMKTAVLKENSTAQFSETIFLPACVTLLRHLVHSDYHLRHQLAHESQTYYMIVRASILHNKNEQVHYDVSHLLLLLLFDEVASIDVWSVAVDSSPKKSVQCFSLPAFMAHRYHLPFKPITHHVISQHRIDLVSSTD---------PLQTGPPAE----MLKIAWNVAWHGDMESLMVDLRKKKEEEKETEFSA---------------KLHLTPADRAILVTTHLISAIQQCLYSMCNATSHTEVSQALGRLKTYMTVYRVHGLGAEILYRLK-----WREAIGRFLQVIPASSLDESLLMEILSFLNLMLEAGPVPRAEQV--WLGDLLVKKKGAL-------PNMISLQDGRQQDGEGDHVDDITRLLRKEVLCFVRRFVNRLPQMIAKTSLKTWLRGDIVR--SLLLRLNLADAPQFYNLP--SLESTLPCLTNVTARPGWSSGCKDTDSSTLCLQLLNCLLEVLSAFHIGRGGMSMSYMGRGVTRN-----ATLCLRHLAYE----MSDQSTEEDWPKCWLFTKQLPEHPSTDPAYNWLIPLWTYRDPEVRAAGLGIAVALTSTEAGRITMTTHCQQLI-GGVWGAAFSVLLDHYECSMVRQQAALLLVNLTSDTMPSGSVELGANIWQG 1279          
BLAST of Rotatin vs. Ensembl Cavefish
Match: rttn (rotatin [Source:NCBI gene;Acc:103043851])

HSP 1 Score: 72.0182 bits (175), Expect = 9.393e-12
Identity = 73/346 (21.10%), Postives = 157/346 (45.38%), Query Frame = 2
Query: 1805 FDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNII--------KFLPLFYNKNYDVRKEACQYLEQFL-RFDRLWNCQ--LNIQNMTD----FLVSSVNDNKHERWFPRLLNGQSKS-LDIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKILDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQD 2794
             ++V+  L ++  AKP S+    ++FL  + +   +  FGL ++ +E++  A  +   L +G+ +M+   W +     +  +  LQ        +G  IL                 IS     Q + +          L L +NK + VR  A ++L   L   +R+ NC+  L+   ++     ++ +   D K        L+  S+S L +D+  K+++I  S  +D+ +R+SAAEQL + LQ   MH+   + G    ++  +   + +  ++  L+  T+ +L ++V     +R +L   S  + +L++ +L    ++  V + + ++  ++F+ + + D
Sbjct:  624 LNVVKECLGVQNVAKPASSVCAGVHFLFHSRVLYEIGTFGLQDQAREVNSAAKDVLLYLLKGRLMMTASSWTRFNEALYPVIPVLQSYAGSTDALGNCILL----------------ISGVSGDQGDGVCSPAGRLRAALRLLFNKQHTVRSTAVEHLLHHLTSSERIKNCRPVLDKTALSSLPSLYVTNKCVDIK--------LDDASRSFLKVDSVTKLYNILASETVDMVLRRSAAEQLVVVLQDSAMHSVLKTQGLPDKLISFITESV-NSLNVDCLLEPTVGMLRKLVYADPSLRHSLAQQSDFLIHLLRASLLIKANQGDVTEAAVLMCFLLFDEIARVD 944          

HSP 2 Score: 61.6178 bits (148), Expect = 1.086e-8
Identity = 43/124 (34.68%), Postives = 66/124 (53.23%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQLKLYSNTSNFQILDQIIKNL--LKVNSNDTILSE 414
            L+  + K  H L E+R RALKNI +K++  +I+  DL + +     LLEWFN   V   + VL+L+   S    G   +  +G +EFLTQL      S   I+D I  +L  L V+ + +++ E
Sbjct:    3 LSALIKKTAHSLVEIRVRALKNIRSKLDHGLISRPDLVQERTLFINLLEWFNFPEVPMQEEVLELLSTLSTHPTGAHMLSDVGAVEFLTQLSPSVEPSLQTIIDSIFDHLFHLPVSPSPSVILE 126          
BLAST of Rotatin vs. Ensembl Cavefish
Match: rttn (rotatin [Source:NCBI gene;Acc:103043851])

HSP 1 Score: 71.2478 bits (173), Expect = 1.642e-11
Identity = 73/347 (21.04%), Postives = 157/347 (45.24%), Query Frame = 2
Query: 1805 FDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNII--------KFLPLFYNKNYDVRKEACQYLEQFL-RFDRLWNCQ--LNIQNMTD----FLVSSVNDNKHERWFPRLLNGQSKS-LDIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKILD-KSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQD 2794
             ++V+  L ++  AKP S+    ++FL  + +   +  FGL ++ +E++  A  +   L +G+ +M+   W +     +  +  LQ        +G  IL                 IS     Q + +          L L +NK + VR  A ++L   L   +R+ NC+  L+   ++     ++ +   D K        L+  S+S L +D+  K+++I  S  +D+ +R+SAAEQL + LQ   MH+   + G    ++  +   +    +++  L+  T+ +L ++V     +R +L   S  + +L++ +L    ++  V + + ++  ++F+ + + D
Sbjct:  639 LNVVKECLGVQNVAKPASSVCAGVHFLFHSRVLYEIGTFGLQDQAREVNSAAKDVLLYLLKGRLMMTASSWTRFNEALYPVIPVLQSYAGSTDALGNCILL----------------ISGVSGDQGDGVCSPAGRLRAALRLLFNKQHTVRSTAVEHLLHHLTSSERIKNCRPVLDKTALSSLPSLYVTNKCVDIK--------LDDASRSFLKVDSVTKLYNILASETVDMVLRRSAAEQLVVVLQDSAMHSVLKTQGLPDKLISFITESVNSLAANVDCLLEPTVGMLRKLVYADPSLRHSLAQQSDFLIHLLRASLLIKANQGDVTEAAVLMCFLLFDEIARVD 961          

HSP 2 Score: 64.6994 bits (156), Expect = 1.367e-9
Identity = 45/131 (34.35%), Postives = 69/131 (52.67%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQLKLYSNTSNFQILDQIIKNL--LKVNSNDTILSENEGFSCS 435
            L+  + K  H L E+R RALKNI +K++  +I+  DL + +     LLEWFN   V   + VL+L+   S    G   +  +G +EFLTQL      S   I+D I  +L  L V+ + +++ E +  S S
Sbjct:    3 LSALIKKTAHSLVEIRVRALKNIRSKLDHGLISRPDLVQERTLFINLLEWFNFPEVPMQEEVLELLSTLSTHPTGAHMLSDVGAVEFLTQLSPSVEPSLQTIIDSIFDHLFHLPVSPSPSVICETQFLSSS 133          

HSP 3 Score: 55.4546 bits (132), Expect = 9.681e-7
Identity = 32/110 (29.09%), Postives = 56/110 (50.91%), Query Frame = 2
Query:  593 LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLK------LLLRFISEKQYSTIAVKAISKLCYKMLQYINTCLDPNFFSTK 904
            LK SV P + LT  D+++LS +  +LRS+   +V +  +   DVI++DFP+ +FLQR  +++       +            A+  + +LC  +   +    DP+F S K
Sbjct:  169 LKFSVFPWLALTPTDRHILSSNESSLRSESQDLVRTTCELLQDVIMQDFPAEIFLQRPRIVQNLLLLLNVSSESDSSSLPLRALACLQQLCRNLRSRLRFHRDPSFCSAK 278          
BLAST of Rotatin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007193.1 (pep scaffold:Pmarinus_7.0:GL476541:87500:145477:-1 gene:ENSPMAG00000006436.1 transcript:ENSPMAT00000007193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.39 bits (285), Expect = 2.158e-25
Identity = 200/862 (23.20%), Postives = 345/862 (40.02%), Query Frame = 2
Query: 1814 VQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKE---IHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVNDNKHERWFPRL-----LNGQSKSL-DIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELL-KGKILDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSA--EIKILEIIGDRILLPFRV-GKYSANKTSKTEWTFSNFSKIPNQKWN--YQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLN-NSIPQFI-LCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLNVDIYDIFNETSL----WISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDFIQWLVQIMT-TPNNSLFYFLEKGDKLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYPFDNLSKLLIHIHLMSRSLEL-----KSNFFQGNTLKVISNVINLCGDLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWLRKSP------------WLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLDISEAPIVRSEAISILQNLLGKLPFPNS 4282
            VQ SL I    K  S +   + FLL + +   L  FGL +  KE   +   A A+   L + + +M    W Q++      +  LQ        +G  I+ L  + S + +  +           + +   L L   K   VR    Q L   L  +               L  +V   +     P +       G  KS+   D   K++ I++S  +D++V+KSAAEQL I +Q   +H      G +  V+ LL +    D   L  +V   + +L R+V H   +R  L     L+ +L+++ L +  +     ++S ++ L++F+ V   +   A      L I  + + LP  V  ++       T    S    IP    +          +R+ W L  H G+   L+   +             +  ++  P  + L +  SD+  L    +P  + LC  L  +  A +H + + +L+ + L L+  N A L     +      L    W ST  +FL+  P  +AD  LL  ++  L+ ++           +QW++ ++    +N L   L K +  +    +   +  +  +   L +FF  L+R L  +      KQS   S+ ++ H  +  + L +L +  +  F  L  L   +  M+ +  L      S+  Q N L++    +    +++L F  GRE + ++F+G GV    +  L +L     D   +   +  V    W RK              WL+ L   R +++R  S  + + +   EQ    L   C  I    LW  AL + LD  E+ +VR EA SILQNLL  LP P S
Sbjct:  568 VQESLGIHNVTKSVSTACLGVRFLLHSRVLYELCAFGLQDSHKENVKVFLAARAIVLYLLQSRLLMCAATWGQLLEALTPVLPVLQGFAGEEGALGSAIVNLSETESQSGEGPIPRT--------DRLRASLRLLMAKQLPVRSAGVQQLAWHLVTEE------QAGQKRPHLPGTVLAGEPNLLIPDVPLCLDTKGIGKSVFKEDAVCKVYGIFMSEAVDLAVKKSAAEQLTIMMQDTILHGVLKKQGAVEKVISLLHQAAHKDGRGLECMVRPCLTLLRRLVYHDPCLRHRLAYQPTLLLSLLRVLLVYQSEAVVQLEVSVLMSLLLFDEVAHIEKWQALHHSLALNIKLEPLSLPLVVEQRFHLPLVMATHHVVSPHRVIPPPPSDPLVAPPARDAIRLGWNLAWHQGVEAMLQAHAA----------SQLEATNQGFP--ELLRMNGSDVMGLRLTHLPSSLQLC--LEAVSRAASHGEAKLALLRLRLQLL--NDALLPQPGAESKAAQMLLSMDWRSTLKRFLVVRPVSNADEKLLGEVLAFLQALLHAQGDIPDHSMLQWILLLLKEQESNHLLDLLNKSNTQVDARHTVTESPTRKGLLKELSSFFNALVRALGCS----PDKQSLAASNGVRCH--LAALLLGRLKEADSSGFYELPSLEATLRGMAHATALPGWSVASSATQSNNLRL--QYLASLQEIVLSFSIGREGNGLSFLGKGVTKSSVVCLRQLASEMSDQAEN---QDWVSPWSWSRKGSGRGETAAQLGLTWLISLWVDRDLEVRLASLGLGTALTSEEQGCMALVAACQNI-SGGLWGTALKILLDQYESSMVRLEAASILQNLL-VLPMPAS 1386          

HSP 2 Score: 57.7658 bits (138), Expect = 4.115e-8
Identity = 37/111 (33.33%), Postives = 58/111 (52.25%), Query Frame = 2
Query:  593 LKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFI-------SEKQYSTIAVKAISKLCYKMLQYINTCLDPNFFSTK 904
            LK S  P + LT  DK+VL+ +  +LRS +  ++ S   F  DV++ DFP+  FLQR  +++ LL  +          Q +  A++ +  LC  +   +    DP FFSTK
Sbjct:   95 LKFSTFPWLSLTPNDKHVLTSTERSLRSKNASLIRSSCDFLLDVMMCDFPAETFLQRPNIVENLLLLLRLAGGADGTHQLALHALRCLHHLCRNLTSRLCFHRDPAFFSTK 205          
BLAST of Rotatin vs. Ensembl Nematostella
Match: EDO36600 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI71])

HSP 1 Score: 93.5893 bits (231), Expect = 8.939e-19
Identity = 98/364 (26.92%), Postives = 171/364 (46.98%), Query Frame = 2
Query: 5381 LKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQ----IIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLREN----------TVKLIFLLLSNLVWCPEGINILLRIRFLDKF---EQINPNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNG--SGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLKSANLVTKLMSLR 6415
            L  LL  SQ  K   ++ G +E+T  +IK++H +L      N+D  ++  +G         SWK+    +I E+++ L++L+N  Y+    +   +  G    +Y+LW    ++S L+  +L  L  L+A     A  I     +        +  S  + + N+ + T++      L  N          T K +F LL+NL    E   I+ +  FL +F   E + P Q +      A+   WL L+++LSF  +GQ  +MK  G  + +++  +V ++        LL++RN+C H   K  L+ N   LI+ +   LD     ++ L+ S L +L+++  K RV LK+A LV KL  +R
Sbjct: 1278 LTSLLAVSQTSKASALKDGLVETTLDQIKHIHVQL------NMD-SLQLGRGP--------SWKKRENPLIDEMVACLDVLRNLVYQYEEGKLACMESGLIGTLYKLWAWCTVESNLMSAVLLLLSTLTARCPKVAACIAGGSSI------SRASQSGTTFLNNLLK-TASSTNRKILSSNSCPDLDTHLATHKALFTLLANLAMSAECRGIIWKSNFLQQFSSLEPLKPIQGRPKHFSRAVGGAWLSLLVNLSFHTDGQAMLMKVPGCVNVLLEFCHVTHSKQANSELALLVLRNLCFHGNTKAVLLSN-DDLIQLLIGQLDQLSDHVRTLAASALWSLVHNCQKARVSLKNAGLVKKLEEMR 1618          

HSP 2 Score: 55.0694 bits (131), Expect = 4.161e-7
Identity = 87/419 (20.76%), Postives = 165/419 (39.38%), Query Frame = 2
Query: 3125 DLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLNVDIYDIFNETSL-------WISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDFIQWLVQIMTTPNNSLFYFLEKGDKLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIH------KMVFDICLNQLTQYLNYPFDNLSKLLIHIHLMSRSLELKSNFFQG---------------NTLKVISNVINLCGDLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWLRK-----SP--WLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLW---SVALTLYLDISEAPIVRSEAISILQNLLGKL 4267
            D ++L +S     + D L  +  A +H   + ++  +      R H   ++ +    ++ ++       W     ++L  +P+ + D  LL  I+ VL +I+        +  + W+ +++      L   L           S  +T ++  +   L  F   L++ L  ++       +N R D  +++       + F++ L    QY + P    S L    H+ SRS E   +  QG               + +++ S+++     ++  FH GR  S  +FMG GV  +       L   HL  E+  L         WLR       P  WLV L   RS ++R M  +I S ++  E  +  L     + L    W   +V LT+ +   +  +VR +A  +++N +  L
Sbjct:  399 DSHILRSSYTTTCIADQLTTLQRAASHHPARRAVGVV------RTHLITDLGLAGRGSKLAVETVYTLQWQEALERYLQVLPNNTEDDELLLEILSVLSDILTSPSPP-PEPVVAWMARVVINNEGPLLTLLRMPQNDSAHPTSEAVTDSRRTLRKTLLAFLSTLVKALLRSS-------ANWRFDSERVYIGDLAYAVAFNLDLADNPQYYDLPVLE-SALECLGHVTSRSHE---HSRQGQEPYGDVQYHVSECKSPMEMCSSMLRSLIQVVTAFHAGRLGSRSSFMGKGVTIHAC-----LCLTHLAREMQILDPDKSWAEHWLRARDTGDQPLNWLVTLWSDRSPEVRWMGLSIASTLVTCEAGQGGLV----QALQGDAWAVFAVGLTILMSDGDCGMVRHQAAHLVRNFVRTL 790          
BLAST of Rotatin vs. Ensembl Nematostella
Match: EDO36601 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI72])

HSP 1 Score: 71.633 bits (174), Expect = 3.109e-12
Identity = 43/113 (38.05%), Postives = 68/113 (60.18%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQLKLYSNTSNFQILDQIIKNLLKV 387
            L  F+ KL+H ++E+R RALKNI  K+E  +I + DL + +E +  LLEWFN         VL+L+E  S+     + ++ IG IEFL+QL+   +   +Q +D +I  LL++
Sbjct:   24 LQQFILKLSHQVEEIRVRALKNILFKLEHKLICMSDLVQERELLIRLLEWFNSPSAPLKKEVLELLEKLSKHVSAAQILLSIGTIEFLSQLRQDISPDLYQDVDNVIHQLLRL 136          

HSP 2 Score: 52.7582 bits (125), Expect = 1.824e-6
Identity = 38/152 (25.00%), Postives = 68/152 (44.74%), Query Frame = 2
Query:  521 PLSKNRNENSNFMKEIADIEQENLLKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFISEKQYST------IAVKAISKLCYKMLQYINTCLDPNFF----------STKNTFGIINQ 928
            P   N  + S       D  Q     L+    + L+V+D++VL+ +   L+S    +V    +F +DV+ +DFP+ +FLQR  V + LL  +   + +T        +  ++ LC  + + +    DP  F          S+K T G+ +Q
Sbjct:  217 PSQSNMPQGSLSTSRSHDTAQLESTALTFFRWMSLSVSDRHVLTATDSRLQSRSPTLVAQSCEFLSDVLFKDFPAEIFLQRPSVFRTLLDILDTSRNTTDDTLLLSTLNCLTSLCQHVQRRLMATSDPALFCPDNDCWKRTSSKPTAGVPSQ 368          
BLAST of Rotatin vs. Ensembl Medaka
Match: rttn (rotatin [Source:NCBI gene;Acc:100302007])

HSP 1 Score: 97.8265 bits (242), Expect = 1.375e-19
Identity = 217/1045 (20.77%), Postives = 421/1045 (40.29%), Query Frame = 2
Query: 1793 FTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSV-NDNKHERWFPRLLNGQSKSL-DIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKILDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEIKILEIIGDRILLPFRVGKYSANK-----TSKTEWTFSNFSKIPNQKWNYQE--SFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDN-YDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLNVDIYDIFN--ETSLWISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDF----IQWLVQIMTTPNNSLFYFLEKGDKLIGKTDSRRLTLAKNKIESRLP--------NFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYPFDNLSKLLIHIHLMSRSLELKSNFFQGNTLKVISNVINLCGDLILKFHTGREESSITFMGSGV----VYYLLRILIELICNHLDFEVDRL----IETTVCQTDWLRKSP----WLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLDISEAPIVRSEAISILQNLLGKLPFPNSMEIPIDVNQNDENEDISSLFIDRNSSGKYQEINGFYQKLLYLDFFRKAGLSLTNFYT------LPF-------------INCSYFKHKP--------LYDPE-----YQINFDSDFQKSVNINQILSQMRTACEINISTPLMISALVSFLCNLYYYLPDQVSSQFNELRINTLIMNMFD 4723
            +    ++V++ L I+  ++ +  +   +NFLL + +   +  FGL +  +++   A  +   L +G+ +M+   W +        +  LQ   +    +G  +L +  ++ + +       +SN    +      L L ++K   VR  A Q +   +      +   +  +M   +++S+ N    +      L+ +SKSL  +++ +K+F +  S ++DIS+++SAAEQL + LQ   MH    S G    V+ L+ G +        L+     IL ++V     +R +L   +LL+  L++ +L    +K   ++I+ ++ L++F+ +      S+E+ + +   D  + PF +   +A        + T    S +  +P    +        + L++ W    H G+NN L      +G   + SD N Y+   +       L L+ES L  +  +     L D +  I  A  H  V S L  + L L++   A  +V  Y+  +  ++  W +   +FL   P+C  D  LL  I+  L    K      + D     ++W+++++     ++   L  G   +    S + T    ++++R+         +FF  L+  L+    +L    +      + + +++  + ++   ++   P  +L + L  +  ++      S+        + S  ++   ++I  F+     +S++FMG GV    V  LL +  E++  + + +   L     E T   T+    SP    WL+ L   R  ++R  S  + + +         L R C  I    LW   L + LD  E  +VR EA  ILQNLL        M +P +  +   +        D  S      +      L +  +F+    S T  Y       LP              ++     H P          +P       Q   D+D   SV   +  SQ+       I TP +++A    L NL   LPD V +   + ++  L+ N+ D
Sbjct:  618 YERTLNLVKDCLGIQNVSRQEPAACAAVNFLLHHRVLYEISTFGLQDSAEKVSLAAKDILLFLLKGRLMMTASAWARFTEALHPVIPILQGYANTEESLGNCVLLISDTSDAGV-------LSNTAKLK----AALRLLFSKKPTVRMAAVQQILPHITSGE--DASTSRPDMDQSVIASLPNIFCGKNLVDVTLDTRSKSLLKVESVEKLFHLLSSDSVDISLKRSAAEQLSVVLQDTTMHPVLKSLGITDKVVSLMMGSVHGNKSFDCLLEPCACILRKLVYADPSLRHSLAQRNLLLLWLLRASLILKENKGNGSEIAVLMTLLLFDEIA-----SSEMWLEKANTDVKISPFSLPLTAARSHNIPFQAATHHAVSPYRCLPAPSDDLLALIPARQALQVAWNTAWHSGINNLLE---KLHG---VASDANEYEFNPD-------LKLSESQLLSVRVAHLPSALRDCVQAIATAAGHRSVASGLSGLSLYLLIDRLALPHVPTYNCRDTLQSLSWHTALARFLQVRPACIEDERLLVGIVTFLNAYFKRVHAEFVPDEEDRDLRWILELLLNQETAVLLHLLHG---VETQSSNQSTEQPEELKNRMSQTLQRELISFFNTLLLRLSHTTDRLCLASAGLFKSQLAV-RLLQSLRVSDAPRFYGLP--SLERTLQGMVSLTAQPGWSSHCPDLEPSSLCSKYLSGLLEVISSFYVEWGGNSLSFMGKGVTKNAVICLLHLSHEMMTENKEKDSIPLWYLGSERT---TEDAGASPLGLAWLIPLWVDRDQEVRFASLGLGAALSSVASGCQALCRSCQNI-SGGLWGTLLNILLDQQETSMVRREAAFILQNLL-------VMPMPANAEEAKNSHWQHPCVHDEVSGISLVGLPALQALLHHCQYFQNVAFSATTCYRGRHTFHLPPCFDEPSGPGLKSDVSGGSGSHTPNISSAVSIADEPPACRLTAQGQSDTDTSNSVTSQE--SQLSAVEATLIVTPDLLTAHCGVLTNLLAILPDFVLTAIRQNQLLHLLANLVD 1612          

HSP 2 Score: 62.7734 bits (151), Expect = 6.182e-9
Identity = 33/91 (36.26%), Postives = 54/91 (59.34%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQL 321
            L+  + K+ H L E+R RALKNI  K++  +I++ D+ + K    YLLEWFN   V   + VL L+ ++S+     + +  +G ++FLT L
Sbjct:    3 LSSLIKKIGHSLVEIRVRALKNILCKLDHSLISVNDIVQEKMLFVYLLEWFNFPEVPMKEEVLGLIYLSSKHPSAAQMLRDVGAVDFLTSL 93          

HSP 3 Score: 56.225 bits (134), Expect = 5.098e-7
Identity = 37/116 (31.90%), Postives = 60/116 (51.72%), Query Frame = 2
Query:  578 EQENLLKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLK------LLLRFISEKQY-STIAVKAISKLCYKMLQYINTCLDPNFFSTK 904
            E    LK SV P + LT  D+++LS +  +L S +  +V +  +   DVI++DFP+ +FLQR G++K       L     E  Y  + A+  + +LC  + + +    DP F S K
Sbjct:  149 ESVRCLKFSVFPWLALTNTDRHILSSNESSLGSTNPNLVRTTCELLCDVIMQDFPAEIFLQRPGIVKNLLSLLRLSSCKGEVNYLRSPALSCLRQLCVGLRRRLRFHQDPGFCSAK 264          

HSP 4 Score: 51.9878 bits (123), Expect = 9.988e-6
Identity = 91/358 (25.42%), Postives = 155/358 (43.30%), Query Frame = 2
Query: 5381 LKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTVKLIFLLLSNLVWCPEGINILLRIRFLDKFEQI----NPNQLQKSASGI-AIQNLWLGLIISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLKSANLVTKLMSLREIYENDSK 6439
            L  LL  S   +N+  + G I+S   ++K  +S+L+S                 V   K+S  K++       +  L+ F    ++  + A        V+ LW   LLD   +   L  L   +A+      A+           +  S  S+ SL+ ++ +LTS  L++    +N   L F LL+NLV   +   IL +  FL  F  +     P      A G  ++  LWL L++SLS  E+GQ +I+K  GS     L +  ++   R   LLI+ N+C     K  ++ +  + +  +  CLDS  I  + +  S L ALL++N + +  LK   +  K+     I + D++
Sbjct: 1778 LMTLLTCSPSAQNFASKAGLIDSCVEQLKQSYSQLES-----------------VRPGKVSLHKKV------GIVWLETF---HLSMSTAATDARLSQAVHGLWPWLLLDDPTMEAALEALCVYTANCTTACSALCGSGPGVVPGVKGSSSSSNSSLMHSVMKLTS--LSSNGPIQN---LAFFLLANLVASRDCRGILQKNNFLQVFLSVPVPKAPGVKATPAGGSGSLLGLWLRLLVSLSSAEDGQQSILKVTGS-----LEMLADLATHRRHALLILHNLCFCSANKSHVLTSDKA-VNVLLSCLDSKDIEARCIGASALWALLHNNQRAKTSLKCPTVRLKIEEAHAISKKDAE 2098          
BLAST of Rotatin vs. Ensembl Medaka
Match: rttn (rotatin [Source:NCBI gene;Acc:100302007])

HSP 1 Score: 58.9214 bits (141), Expect = 5.344e-8
Identity = 42/131 (32.06%), Postives = 68/131 (51.91%), Query Frame = 2
Query:  560 KEIADIEQENLLKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLK------LLLRFISEKQY-STIAVKAISKLCYKMLQYINTCLDPNFFSTKNTFGIINQN 931
            K+IA  E    LK SV P + LT  D+++LS +  +L S +  +V +  +   DVI++DFP+ +FLQR G++K       L     E  Y  + A+  + +LC  + + +    DP F S K     ++QN
Sbjct:  159 KKIAVNESVRCLKFSVFPWLALTNTDRHILSSNESSLGSTNPNLVRTTCELLCDVIMQDFPAEIFLQRPGIVKNLLSLLRLSSCKGEVNYLRSPALSCLRQLCVGLRRRLRFHQDPGFCSAKQ--DAVSQN 287          

HSP 2 Score: 57.7658 bits (138), Expect = 1.262e-7
Identity = 33/91 (36.26%), Postives = 51/91 (56.04%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQL 321
            L+  + K+ H L E+R RALKNI  K++  +I++ D+ + K    YLLEWFN   V   + VL L+   S      + +  +G ++FLT L
Sbjct:    3 LSSLIKKIGHSLVEIRVRALKNILCKLDHSLISVNDIVQEKMLFVYLLEWFNFPEVPMKEEVLGLLLTLSRHPSAAQMLRDVGAVDFLTSL 93          
BLAST of Rotatin vs. Ensembl Medaka
Match: rttn (rotatin [Source:NCBI gene;Acc:100302007])

HSP 1 Score: 58.5362 bits (140), Expect = 6.498e-8
Identity = 40/122 (32.79%), Postives = 64/122 (52.46%), Query Frame = 2
Query:  560 KEIADIEQENLLKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLK------LLLRFISEKQY-STIAVKAISKLCYKMLQYINTCLDPNFFSTK 904
            K+IA  E    LK SV P + LT  D+++LS +  +L S +  +V +  +   DVI++DFP+ +FLQR G++K       L     E  Y  + A+  + +LC  + + +    DP F S K
Sbjct:  159 KKIAVNESVRCLKFSVFPWLALTNTDRHILSSNESSLGSTNPNLVRTTCELLCDVIMQDFPAEIFLQRPGIVKNLLSLLRLSSCKGEVNYLRSPALSCLRQLCVGLRRRLRFHQDPGFCSAK 280          

HSP 2 Score: 58.151 bits (139), Expect = 8.059e-8
Identity = 33/91 (36.26%), Postives = 51/91 (56.04%), Query Frame = 1
Query:   49 LTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQL 321
            L+  + K+ H L E+R RALKNI  K++  +I++ D+ + K    YLLEWFN   V   + VL L+   S      + +  +G ++FLT L
Sbjct:    3 LSSLIKKIGHSLVEIRVRALKNILCKLDHSLISVNDIVQEKMLFVYLLEWFNFPEVPMKEEVLGLLLTLSRHPSAAQMLRDVGAVDFLTSL 93          
BLAST of Rotatin vs. Planmine SMEST
Match: SMESG000018486.1 (SMESG000018486.1)

HSP 1 Score: 3902.06 bits (10118), Expect = 0.000e+0
Identity = 1986/1999 (99.35%), Postives = 1993/1999 (99.70%), Query Frame = 2
Query:  512 FNSPLSKNRNENSNFMKEIADIEQENLLKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFISEKQYSTIAVKAISKLCYKMLQYINTCLDPNFFSTKNTFGIINQNYGEYEEDNHWNSDDLLGFHYEPNFGLPEPLPVPVFCLQVINVCLYHILEIDTDSNWAELFHLICTAIELFRESFGSDLRQPYLLELWNLKDQINDVLTLWSRLLKQYSIIEDMNYRKLSNKRQIYLCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQSSESLIKFFLNNNEPIKYAEQCISAAENSLDCLEYVYGVRFCKEFAHFFSLISSTEIFGNREDMFIKCDEILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRXXXXXXXXXXXXXXXXXXXKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVNDNKHERWFPRLLNGQSKSLDIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKILDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEIKILEIIGDRILLPFRVGKYSANKTSKTEWTFSNFSKIPNQKWNYQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQXXXXXXXXXXXXRNHAFLNVDIYDIFNETSLWISTFHKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDFIQWLVQIMTTPNNSLFYFLEKGDKLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYPFDNLSKLLIHIHLMSRSLELKSNFFQGNTLKVISNVINLCGDLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWLRKSPWLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLDISEAPIVRSEAISILQNLLGKLPFPNSMEIPIDVNQNDENEDISSLFIDRNSSGKYQEINGFYQKLLYLDFFRKAGLSLTNFYTLPFINCSYFKHKPLYDPEYQINFDSDFQKSVNINQILSQMRTACEINISTPLMISALVSFLCNLYYYLPDQVSSQFNELRINTLIMNMFDPHTLKVYMESFQTEHYSTTVDLVLAFTNCVKLIRLQINMNSSLKDSFLIDEKFIETIIQLLIVTKPTSDFDESHDNRLMKLDLYKYISQLRVEILYLLISLVIPTPIKNHVQLMLAHVASHVTGIFNCIKEMIEIESRKSGNVALCFVSVFLCLSSSESKFNSLIRSLESQRFSNSERVIIEDFTELLLKKRESLSRINAKSHSYTDTSINERINVHNTLKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSMGFQIIVYRLWTVALLDSGXXXXXXXXXXXXSADTINTAKAIVICHQVHXXXXXXXXXXXXISLIENICRLTSADLTAYYLRENTVKLIFLLLSNLVWCPEGINILLRIRFLDKFEQINPNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLKSANLVTKLMSLREIYENDSKNGLLLDIISLLNAFQDPKEFRTQ 6508
            FNSPLSKNRNENSNFMKEIADIEQENLLKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFISEKQYSTIAVKAISKLCYKMLQYINTCLDPNFFSTKNTFGIINQNYGEYEEDNHWNSDDLLGFHYEPNFGLPEPLPVPVFCLQVINVCLYHILEIDTDSNWAELFHLICTAIELFRESFGSDLRQPYLLELWNLKDQINDVLTLWSRLLKQ SIIEDMNYRKLSNKRQIYLCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQS ESLIKFFLNNNEPIKYAEQCISAAENSLDCLEYVYGV+FCKEFAHFFSLISSTEIFGNREDMFIKCDEILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRQILQLLLSNSSNIDNFLDDKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVNDNKHERWFPRLLNGQSKSLDIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKILDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEIKILEIIGDRILLPFRVGKYSANKTSKTEWTFSNFSKIPNQKWNYQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQSSLISIEL+LILRNHAFLNVDIYDIFNETSLWISTF KFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDFIQWLVQIMTTPNNSLFYFLEKGDKLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYPFDNLSKLLIHIHLMSRSLELKSNFFQGNTLKVISNVINLCGDLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWLRKSPWLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLDISEAPIVRSEAISILQNLLGKLPFPNSMEIPIDVNQNDENEDISSLFIDRNSSGKYQEINGFYQKLLYLDFFRKAGLSLTNFYTLPFINCSYFKHKPLYDPEYQINFDSDFQKSVNINQILSQMRTACEINISTPLMIS+LVSFLCNLYYYLPDQVSSQFNELRINTLIMNMFDPHTLKVYMESFQTEHYSTTVDLVLAFTNCVKLIRLQINMNSSLKDSFLIDEKFIETIIQLLIVTKPTSD DESHDNRLMKLDLYKYISQLRVEILYLLISLVIPTPIKNHVQLMLAHVASHVTGIFNC+KEMIEIE RKSGNVALCFVSVFLCLSSSESKFNSLIRSLESQRFSNSERVIIEDFTELLLKKRESLSRINAKSHSYTDT INERINVHNTLKILLGTSQV+KNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVS+GFQIIVYRLWTVALLDSGLLHCILNCLINLSADTINTAKAIVICHQVHQQSGQPPSQGSSISLIENICRLTSADLTAY+LRENTVKLIFLLLSNLVWCPEGINILLRIRFLDKFEQINPNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLKSANLVTKLMSLREIYENDSKNGLLLDIISLLNAFQDPKEFRTQ
Sbjct:  163 FNSPLSKNRNENSNFMKEIADIEQENLLKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGIQFFTDVILEDFPSPVFLQRQGVLKLLLRFISEKQYSTIAVKAISKLCYKMLQYINTCLDPNFFSTKNTFGIINQNYGEYEEDNHWNSDDLLGFHYEPNFGLPEPLPVPVFCLQVINVCLYHILEIDTDSNWAELFHLICTAIELFRESFGSDLRQPYLLELWNLKDQINDVLTLWSRLLKQCSIIEDMNYRKLSNKRQIYLCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSVQLITYIELFDQNFAKLNKESNRLMQSFESLIKFFLNNNEPIKYAEQCISAAENSLDCLEYVYGVQFCKEFAHFFSLISSTEIFGNREDMFIKCDEILQELMKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFKNLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIYLQPLCDLNTRVGRQILQLLLSNSSNIDNFLDDKISNQRNFQNNIIKFLPLFYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVNDNKHERWFPRLLNGQSKSLDIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGNMHNYFISNGGLHYVLELLKGKILDKSHLSILVPSTILILLRIVQHTNEIRKNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSAEIKILEIIGDRILLPFRVGKYSANKTSKTEWTFSNFSKIPNQKWNYQESFERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQKLTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQSSLISIELILILRNHAFLNVDIYDIFNETSLWISTFQKFLLNIPSCSADFILLEFIMDVLENIIKLSMTNHMKDFIQWLVQIMTTPNNSLFYFLEKGDKLIGKTDSRRLTLAKNKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQLTQYLNYPFDNLSKLLIHIHLMSRSLELKSNFFQGNTLKVISNVINLCGDLILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVCQTDWLRKSPWLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEILPESLWSVALTLYLDISEAPIVRSEAISILQNLLGKLPFPNSMEIPIDVNQNDENEDISSLFIDRNSSGKYQEINGFYQKLLYLDFFRKAGLSLTNFYTLPFINCSYFKHKPLYDPEYQINFDSDFQKSVNINQILSQMRTACEINISTPLMISSLVSFLCNLYYYLPDQVSSQFNELRINTLIMNMFDPHTLKVYMESFQTEHYSTTVDLVLAFTNCVKLIRLQINMNSSLKDSFLIDEKFIETIIQLLIVTKPTSDIDESHDNRLMKLDLYKYISQLRVEILYLLISLVIPTPIKNHVQLMLAHVASHVTGIFNCVKEMIEIEGRKSGNVALCFVSVFLCLSSSESKFNSLIRSLESQRFSNSERVIIEDFTELLLKKRESLSRINAKSHSYTDTRINERINVHNTLKILLGTSQVIKNYLVRVGFIESTSVEIKYLHSKLDSCAQNNVDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAVSIGFQIIVYRLWTVALLDSGLLHCILNCLINLSADTINTAKAIVICHQVHQQSGQPPSQGSSISLIENICRLTSADLTAYHLRENTVKLIFLLLSNLVWCPEGINILLRIRFLDKFEQINPNQLQKSASGIAIQNLWLGLIISLSFTEEGQNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNGSSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLKSANLVTKLMSLREIYENDSKNGLLLDIISLLNAFQDPKEFRTQ 2161          

HSP 2 Score: 295.819 bits (756), Expect = 4.777e-80
Identity = 160/161 (99.38%), Postives = 160/161 (99.38%), Query Frame = 1
Query:   28 MSFEAKFLTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDXXXXXXXXXXXXEFLTQLKLYSNTSNFQILDQIIKNLLKVNSNDTILSENEGFSCSLLPKVNKLTKNKIDSEEKHFQQAIG 510
            MSFEAKFLTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDGGGKQIIKIGGIEFLTQLKLYSNTSNFQILDQIIKNLLKVNSNDTILSENEG SCSLLPKVNKLTKNKIDSEEKHFQQAIG
Sbjct:    1 MSFEAKFLTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEFIPYLLEWFNHDVVKYHDSVLKLVEMASEFDGGGKQIIKIGGIEFLTQLKLYSNTSNFQILDQIIKNLLKVNSNDTILSENEGISCSLLPKVNKLTKNKIDSEEKHFQQAIG 161          
The following BLAST results are available for this feature:
BLAST of Rotatin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RTTN4.333e-1821.04rotatin [Source:HGNC Symbol;Acc:HGNC:18654][more]
RTTN6.289e-1821.04rotatin [Source:HGNC Symbol;Acc:HGNC:18654][more]
RTTN1.508e-1120.87rotatin [Source:HGNC Symbol;Acc:HGNC:18654][more]
RTTN1.064e-723.83rotatin [Source:HGNC Symbol;Acc:HGNC:18654][more]
RTTN3.149e-734.96rotatin [Source:HGNC Symbol;Acc:HGNC:18654][more]
back to top
BLAST of Rotatin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rotatin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rotatin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rttn1.849e-2220.74rotatin [Source:ZFIN;Acc:ZDB-GENE-090609-5][more]
rttn2.540e-2120.33rotatin [Source:ZFIN;Acc:ZDB-GENE-090609-5][more]
back to top
BLAST of Rotatin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RTTN1.835e-1719.55rotatin [Source:NCBI gene;Acc:100379860][more]
RTTN2.143e-1719.59rotatin [Source:NCBI gene;Acc:100379860][more]
RTTN2.177e-1719.59rotatin [Source:NCBI gene;Acc:100379860][more]
RTTN2.477e-1719.80rotatin [Source:NCBI gene;Acc:100379860][more]
RTTN3.090e-1719.80rotatin [Source:NCBI gene;Acc:100379860][more]
back to top
BLAST of Rotatin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rttn2.664e-2020.85rotatin [Source:MGI Symbol;Acc:MGI:2179288][more]
back to top
BLAST of Rotatin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8R4Y8|RTTN_MOUSE1.864e-1920.85Rotatin OS=Mus musculus OX=10090 GN=Rttn PE=1 SV=2[more]
sp|Q86VV8|RTTN_HUMAN3.020e-1721.04Rotatin OS=Homo sapiens OX=9606 GN=RTTN PE=1 SV=3[more]
back to top
BLAST of Rotatin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210R0J04.889e-8123.07Rotatin OS=Mizuhopecten yessoensis OX=6573 GN=KP79... [more]
K1QRC42.298e-4922.57Rotatin OS=Crassostrea gigas OX=29159 GN=CGI_10027... [more]
A0A2C9M5Y71.243e-4822.64RTTN_N domain-containing protein OS=Biomphalaria g... [more]
A0A1S3GZK11.178e-4520.99rotatin OS=Lingula unguis OX=7574 GN=LOC106150846 ... [more]
A0A1S3K5M35.714e-4421.92rotatin-like OS=Lingula unguis OX=7574 GN=LOC10617... [more]
back to top
BLAST of Rotatin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rttn9.393e-1221.10rotatin [Source:NCBI gene;Acc:103043851][more]
rttn1.642e-1121.04rotatin [Source:NCBI gene;Acc:103043851][more]
back to top
BLAST of Rotatin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000007193.12.158e-2523.20pep scaffold:Pmarinus_7.0:GL476541:87500:145477:-1... [more]
back to top
BLAST of Rotatin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rotatin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO366008.939e-1926.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366013.109e-1238.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rotatin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rttn1.375e-1920.77rotatin [Source:NCBI gene;Acc:100302007][more]
rttn5.344e-832.06rotatin [Source:NCBI gene;Acc:100302007][more]
rttn6.498e-832.79rotatin [Source:NCBI gene;Acc:100302007][more]
back to top
BLAST of Rotatin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000018486.14.777e-8099.35SMESG000018486.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003301 ID=SMED30003301|Name=Rotatin|organism=Schmidtea mediterranea sexual|type=transcript|length=6579bp
CTTTAATTTAACCCTAACGACATAAATATGTCTTTTGAAGCAAAATTTTT
AACTGATTTCGTAAGCAAATTAAATCATCCCCTAGACGAAGTTCGATTCA
GGGCTTTAAAAAATATCTCAAATAAAGTTGAAAGATGCATTATAACAATA
GAAGATTTATGTAAACATAAAGAATTTATTCCTTATTTATTAGAATGGTT
TAATCATGATGTTGTTAAATATCATGACTCTGTCTTGAAGTTAGTTGAAA
TGGCCAGTGAATTTGATGGTGGTGGAAAACAAATTATTAAAATAGGCGGA
ATAGAATTTTTAACACAACTTAAATTATATTCTAATACTTCAAATTTCCA
AATTTTAGACCAAATAATTAAAAATTTATTAAAAGTTAATTCAAATGATA
CAATTTTAAGTGAAAATGAGGGGTTTTCCTGTTCGCTTTTACCTAAAGTT
AATAAATTGACAAAGAATAAAATAGATTCTGAAGAAAAACATTTTCAACA
GGCTATTGGATTTCAATTCACCACTTTCAAAAAACAGAAATGAGAATTCT
AATTTTATGAAAGAAATAGCTGACATTGAGCAAGAAAATTTACTAAAATT
ATCTGTACACCCAATAATTCCGCTAACCGTCGCTGACAAAAATGTGTTAA
GCGGTTCATTGGGAACATTGAGATCGGATGATTTTCGAGTTGTAATTAGT
GGAATTCAATTTTTCACTGATGTTATCCTAGAAGACTTTCCTTCTCCAGT
TTTTCTTCAGCGACAAGGAGTTCTTAAATTATTGCTTCGATTCATATCAG
AAAAGCAATATTCAACTATCGCAGTGAAAGCTATATCGAAATTATGTTAT
AAAATGTTGCAATATATTAATACATGTTTGGATCCGAATTTCTTTAGTAC
AAAAAATACATTTGGAATAATCAACCAAAATTATGGTGAATACGAAGAGG
ATAATCATTGGAATTCTGATGACTTATTAGGTTTTCACTATGAACCAAAT
TTTGGATTGCCTGAACCATTACCAGTTCCAGTGTTTTGCTTACAAGTTAT
TAATGTTTGCCTCTATCATATCTTAGAAATTGATACTGATTCTAATTGGG
CTGAATTGTTTCATTTAATCTGTACAGCAATTGAGTTATTTCGAGAAAGT
TTTGGTAGTGATCTTCGACAGCCGTACCTGTTGGAATTGTGGAATTTAAA
AGATCAAATAAATGATGTTTTAACATTATGGTCGCGTTTGTTGAAACAAT
ATTCAATTATAGAAGATATGAACTATAGAAAACTATCAAATAAAAGACAA
ATCTATTTATGCCTATTCGCAATTTTTTGGAATTTTATTTCGAGTATTTT
TTCTCCAGAAATGGCATTAAAATATTTACAAGAGCATACGAAAACTGAAC
TATGTCGTGCACAATTCGATAAATGTTTGCTATTAGGTCTTGGTGAAAAT
TCTGTACAATTAATTACATATATAGAATTGTTTGATCAGAATTTTGCTAA
ATTGAACAAGGAGTCTAATCGTTTAATGCAATCTTCTGAATCACTGATTA
AATTCTTTCTTAATAATAATGAACCTATAAAATATGCGGAACAATGCATA
TCCGCGGCTGAAAATTCACTTGATTGTTTGGAATATGTTTATGGAGTACG
ATTCTGTAAGGAATTCGCACATTTTTTCAGTTTGATCTCTTCGACGGAAA
TCTTTGGTAACAGGGAAGATATGTTTATAAAATGTGATGAAATTCTACAA
GAACTGATGAAATCTACGAATCACAGTATTTGCAAATCAATTTTCACAGA
AATTTTTGATATTGTCCAAAACAGTTTAACTATTGAAGAAGCAGCTAAAC
CAAAATCAAATTCTGAGAACAAAATAAATTTCCTACTACGAAACAATATT
TTCAAAAATTTAATTTTATTTGGTTTATACAATGAATTAAAAGAAATACA
TGAAACTGCGACAGCATTGTTTTGTAAATTATGGGAGGGTCAAAGAATCA
TGTCTGTTATTATTTGGAGACAAGTTATGAATATTACTTGGAAACATATG
ATATATTTACAGCCGTTATGTGATCTGAATACAAGAGTTGGTCGACAAAT
TTTACAACTTTTATTAAGTAATTCTTCAAACATTGATAATTTTCTGGATG
ACAAAATATCAAATCAACGGAATTTTCAAAATAATATAATTAAATTTCTA
CCACTTTTCTACAATAAAAATTATGACGTGAGAAAAGAAGCTTGTCAGTA
TTTAGAACAATTTCTTCGTTTTGATCGTTTGTGGAATTGCCAACTTAATA
TTCAAAATATGACGGATTTTCTCGTTTCTTCTGTTAATGATAATAAACAT
GAAAGGTGGTTTCCAAGACTGTTAAATGGGCAGAGCAAATCATTAGATAT
TGACAACTTTAAAAAGATTTTTGATATATATTTATCATCCAATATTGATA
TAAGTGTTCGAAAATCTGCTGCTGAACAACTTGAAATTTTTTTGCAAATG
GGAAATATGCACAATTATTTCATTTCAAATGGTGGATTACATTATGTTTT
AGAGTTACTCAAAGGCAAGATACTTGACAAAAGTCACTTGTCTATTCTGG
TACCTAGTACTATTTTAATTTTGTTGAGAATTGTTCAACACACGAATGAA
ATTCGAAAGAATCTCTATGACGATTCTTTGTTAATTGATAATCTAATTCA
AATGGCATTATATTTTTGCTATGACAAGCAATGCGTAGCTGATATTAGTT
CAATTTTATTCCTTGTGATTTTTAATTCAGTTTTAAAACAAGATAACCTA
AGTGCAGAAATCAAAATATTGGAAATAATAGGTGATCGTATATTATTACC
ATTTCGAGTTGGAAAATATTCTGCTAATAAAACTTCTAAAACTGAATGGA
CTTTTTCGAATTTCAGTAAAATACCCAATCAAAAATGGAATTACCAAGAA
TCATTTGAACGAAATCTAAGAATACATTGGACTTTACTGAAACATGGTGG
TCTTAATAACTATTTAAGATATAAATACAGTTTTTACGGAAAGAAAATTA
TTGATTCCGATGATAATTATGATTTAATTGATGAAATTTTACCATGTGTT
CAAAAATTGACATTAACCGAAAGTGATTTATATGTTCTTAATAATTCGAT
TCCTCAATTTATTTTGTGTGATAATCTTCATCAGATTGATAATGCTATTA
ATCATTGCCAAGTCCAATCATCTTTAATTTCAATTGAATTGGTTTTGATA
TTACGGAATCATGCATTTCTCAATGTCGACATTTATGATATTTTTAATGA
AACTTCTTTATGGATTTCTACATTTCATAAATTCTTGTTAAATATTCCAT
CTTGTTCCGCTGACTTTATTTTACTCGAATTCATTATGGATGTTCTGGAA
AATATTATAAAACTTTCAATGACAAATCACATGAAAGATTTCATTCAATG
GCTTGTACAAATAATGACAACTCCTAACAATTCTTTGTTTTACTTTTTAG
AGAAAGGCGATAAATTAATTGGCAAAACGGATAGCCGCAGATTAACTTTA
GCTAAAAATAAAATTGAATCACGATTACCAAATTTTTTTCTCTTACTGAT
GAGATATCTTAATTTAAATAATATTCAGTTGTCATCAAAACAATCAAACA
CAAGATCAGATATAATCAAAATCCATAAAATGGTTTTTGATATATGTCTC
AATCAATTAACACAATATTTAAATTATCCATTTGACAATTTGAGCAAATT
ATTAATTCATATTCATTTGATGTCTAGATCATTAGAGTTAAAATCAAATT
TCTTTCAAGGAAACACTTTAAAAGTTATTTCTAATGTAATTAATTTATGT
GGAGATTTAATTTTGAAATTTCATACTGGTAGAGAAGAAAGTTCAATTAC
ATTCATGGGAAGCGGTGTTGTATATTATCTGCTGCGTATTTTAATTGAGC
TAATTTGTAACCACTTGGATTTCGAAGTTGATCGTTTAATTGAGACGACA
GTTTGTCAGACTGACTGGCTAAGAAAATCGCCTTGGTTAGTTGAATTAAT
CGGCTATAGGTCTGTTGATATAAGGGCTATGAGTGCAACGATAATAAGCA
AAATGATTCAGTATGAACAATCCAGAAGTATTTTGTTTCGACATTGTTCT
GAAATTCTTCCCGAATCTTTGTGGTCAGTGGCTCTGACTCTCTATTTAGA
TATCTCAGAAGCGCCGATTGTTCGATCTGAAGCTATAAGTATCCTTCAGA
ATTTATTGGGTAAATTACCATTTCCAAATAGTATGGAAATTCCAATTGAT
GTCAATCAAAATGATGAGAATGAAGATATTTCTTCACTTTTTATCGATCG
AAATTCATCAGGAAAATATCAAGAAATAAATGGATTTTACCAGAAACTTC
TTTATCTAGATTTTTTTCGAAAAGCTGGTTTATCTCTGACAAATTTTTAC
ACACTTCCATTCATTAATTGCTCTTATTTTAAACATAAACCATTGTACGA
TCCAGAATATCAAATTAATTTTGATAGTGATTTCCAAAAATCTGTAAACA
TAAATCAGATCTTGAGTCAGATGAGAACAGCTTGCGAGATTAACATTTCT
ACACCGTTGATGATATCTGCACTGGTTTCGTTTCTATGTAATCTTTATTA
CTACCTTCCTGATCAAGTATCATCTCAATTCAATGAATTACGAATCAATA
CACTTATAATGAATATGTTTGATCCTCATACATTGAAAGTATATATGGAA
TCTTTTCAAACAGAGCATTATTCAACCACTGTTGACCTAGTTTTAGCTTT
TACGAATTGTGTAAAGCTTATAAGATTGCAAATAAATATGAATTCTAGCT
TGAAGGATTCATTTTTGATTGATGAAAAATTCATTGAAACCATCATTCAA
TTATTAATAGTAACAAAGCCGACGTCTGATTTCGATGAATCTCATGACAA
TAGGTTAATGAAACTAGATCTTTACAAATATATTAGTCAGTTGAGAGTGG
AAATTCTATATCTATTAATTAGTTTAGTCATACCAACTCCAATCAAAAAT
CACGTCCAACTAATGCTAGCGCATGTTGCCTCACATGTTACCGGAATTTT
TAATTGTATTAAAGAAATGATTGAAATAGAAAGTAGGAAATCGGGAAACG
TTGCATTGTGTTTCGTTTCTGTTTTTCTGTGTCTTAGTTCTAGTGAATCT
AAATTTAATTCACTAATAAGATCATTAGAAAGTCAAAGATTTTCAAATTC
AGAGAGAGTTATTATTGAAGATTTTACAGAGTTGTTGTTAAAAAAACGCG
AAAGTCTATCTCGAATAAATGCAAAGTCACATTCCTATACAGATACAAGC
ATAAATGAAAGAATAAATGTTCATAACACTTTGAAAATTTTATTGGGAAC
TTCACAAGTTGTAAAAAATTACTTGGTAAGAGTGGGCTTTATCGAAAGTA
CTTCAGTTGAAATAAAATATTTACATTCGAAATTGGATAGTTGTGCTCAA
AATAATGTAGATGTGTGCATTAGACAGAATAAAGGAAGTGTGGTTAATGA
AAATAAAATTTCATCATGGAAACAAATAATTAAAGAAATAATTTCTGTAT
TAGAATTATTGCAAAATTTTTTTTATGAAGATGTCAATGCTCAATCAGTT
GCTGTGTCAATGGGTTTTCAAATTATTGTATATCGTTTATGGACAGTGGC
GCTCCTTGATTCTGGATTATTACATTGCATTCTGAATTGTTTAATCAATT
TATCTGCTGATACAATTAACACTGCAAAAGCCATCGTAATATGCCATCAA
GTTCACCAACAATCTGGCCAACCTCCATCACAAGGGTCGAGTATTTCTCT
CATTGAAAACATTTGTCGCTTAACATCAGCTGATTTGACAGCTTATTATT
TGAGAGAAAATACTGTGAAATTAATTTTTCTTTTGCTATCGAATCTTGTA
TGGTGTCCCGAAGGAATAAATATTCTATTACGAATTCGGTTTCTTGACAA
ATTTGAACAAATTAATCCTAATCAATTACAGAAAAGTGCTTCAGGCATCG
CAATCCAAAATCTTTGGCTTGGATTGATCATTAGTTTGTCTTTCACAGAA
GAAGGCCAAAATGCTATTATGAAATCTAATGGTTCAGGAATAATGAAAGT
TCTTAATGTACAAAACAATATACTGGTACTTAGGTTATCCACTTTATTGA
TTATTAGGAATATGTGTACTCACCCTGTTATAAAAGTTAAACTCATGGTT
AATGGATCAAGTTTAATAGAAAATATAAAACATTGTCTTGATTCAAATCA
TATTTGCATTAAACAACTTTCTTTATCGACATTAAAAGCACTATTATATT
CAAATAACAAGATTCGAGTCTATTTGAAATCAGCTAACCTTGTGACAAAA
TTGATGAGTCTCAGAGAAATTTATGAAAATGATTCGAAAAATGGTTTATT
GTTGGATATTATTTCATTACTCAATGCATTTCAAGACCCAAAGGAATTTC
GAACACAATAATTTTATAAAATTTATTTTTAAAAACATTTCTTTGTTATG
CTGTTCATATAATTACTAAATTTTTATAC
back to top

protein sequence of SMED30003301-orf-1

>SMED30003301-orf-1 ID=SMED30003301-orf-1|Name=SMED30003301-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=172bp
MSFEAKFLTDFVSKLNHPLDEVRFRALKNISNKVERCIITIEDLCKHKEF
IPYLLEWFNHDVVKYHDSVLKLVEMASEFDGGGKQIIKIGGIEFLTQLKL
YSNTSNFQILDQIIKNLLKVNSNDTILSENEGFSCSLLPKVNKLTKNKID
SEEKHFQQAIGFQFTTFKKQK*
back to top

protein sequence of SMED30003301-orf-2

>SMED30003301-orf-2 ID=SMED30003301-orf-2|Name=SMED30003301-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1985bp
MKEIADIEQENLLKLSVHPIIPLTVADKNVLSGSLGTLRSDDFRVVISGI
QFFTDVILEDFPSPVFLQRQGVLKLLLRFISEKQYSTIAVKAISKLCYKM
LQYINTCLDPNFFSTKNTFGIINQNYGEYEEDNHWNSDDLLGFHYEPNFG
LPEPLPVPVFCLQVINVCLYHILEIDTDSNWAELFHLICTAIELFRESFG
SDLRQPYLLELWNLKDQINDVLTLWSRLLKQYSIIEDMNYRKLSNKRQIY
LCLFAIFWNFISSIFSPEMALKYLQEHTKTELCRAQFDKCLLLGLGENSV
QLITYIELFDQNFAKLNKESNRLMQSSESLIKFFLNNNEPIKYAEQCISA
AENSLDCLEYVYGVRFCKEFAHFFSLISSTEIFGNREDMFIKCDEILQEL
MKSTNHSICKSIFTEIFDIVQNSLTIEEAAKPKSNSENKINFLLRNNIFK
NLILFGLYNELKEIHETATALFCKLWEGQRIMSVIIWRQVMNITWKHMIY
LQPLCDLNTRVGRQILQLLLSNSSNIDNFLDDKISNQRNFQNNIIKFLPL
FYNKNYDVRKEACQYLEQFLRFDRLWNCQLNIQNMTDFLVSSVNDNKHER
WFPRLLNGQSKSLDIDNFKKIFDIYLSSNIDISVRKSAAEQLEIFLQMGN
MHNYFISNGGLHYVLELLKGKILDKSHLSILVPSTILILLRIVQHTNEIR
KNLYDDSLLIDNLIQMALYFCYDKQCVADISSILFLVIFNSVLKQDNLSA
EIKILEIIGDRILLPFRVGKYSANKTSKTEWTFSNFSKIPNQKWNYQESF
ERNLRIHWTLLKHGGLNNYLRYKYSFYGKKIIDSDDNYDLIDEILPCVQK
LTLTESDLYVLNNSIPQFILCDNLHQIDNAINHCQVQSSLISIELVLILR
NHAFLNVDIYDIFNETSLWISTFHKFLLNIPSCSADFILLEFIMDVLENI
IKLSMTNHMKDFIQWLVQIMTTPNNSLFYFLEKGDKLIGKTDSRRLTLAK
NKIESRLPNFFLLLMRYLNLNNIQLSSKQSNTRSDIIKIHKMVFDICLNQ
LTQYLNYPFDNLSKLLIHIHLMSRSLELKSNFFQGNTLKVISNVINLCGD
LILKFHTGREESSITFMGSGVVYYLLRILIELICNHLDFEVDRLIETTVC
QTDWLRKSPWLVELIGYRSVDIRAMSATIISKMIQYEQSRSILFRHCSEI
LPESLWSVALTLYLDISEAPIVRSEAISILQNLLGKLPFPNSMEIPIDVN
QNDENEDISSLFIDRNSSGKYQEINGFYQKLLYLDFFRKAGLSLTNFYTL
PFINCSYFKHKPLYDPEYQINFDSDFQKSVNINQILSQMRTACEINISTP
LMISALVSFLCNLYYYLPDQVSSQFNELRINTLIMNMFDPHTLKVYMESF
QTEHYSTTVDLVLAFTNCVKLIRLQINMNSSLKDSFLIDEKFIETIIQLL
IVTKPTSDFDESHDNRLMKLDLYKYISQLRVEILYLLISLVIPTPIKNHV
QLMLAHVASHVTGIFNCIKEMIEIESRKSGNVALCFVSVFLCLSSSESKF
NSLIRSLESQRFSNSERVIIEDFTELLLKKRESLSRINAKSHSYTDTSIN
ERINVHNTLKILLGTSQVVKNYLVRVGFIESTSVEIKYLHSKLDSCAQNN
VDVCIRQNKGSVVNENKISSWKQIIKEIISVLELLQNFFYEDVNAQSVAV
SMGFQIIVYRLWTVALLDSGLLHCILNCLINLSADTINTAKAIVICHQVH
QQSGQPPSQGSSISLIENICRLTSADLTAYYLRENTVKLIFLLLSNLVWC
PEGINILLRIRFLDKFEQINPNQLQKSASGIAIQNLWLGLIISLSFTEEG
QNAIMKSNGSGIMKVLNVQNNILVLRLSTLLIIRNMCTHPVIKVKLMVNG
SSLIENIKHCLDSNHICIKQLSLSTLKALLYSNNKIRVYLKSANLVTKLM
SLREIYENDSKNGLLLDIISLLNAFQDPKEFRTQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR030791Rotatin
IPR029249Rotatin_N
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
Vocabulary: cellular component
TermDefinition
GO:0005813centrosome
GO:0036064ciliary basal body
Vocabulary: biological process
TermDefinition
GO:0044782cilium organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029249Rotatin, N-terminalPFAMPF14726RTTN_Ncoord: 21..117
e-value: 3.8E-20
score: 72.5
IPR030791RotatinPANTHERPTHR31691FAMILY NOT NAMEDcoord: 11..136
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 8..127