EF-hand domain-containing protein

Overview
NameEF-hand domain-containing protein
Smed IDSMED30003300
Length (bp)2267
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EF-hand domain-containing protein (SMED30003300) t-SNE clustered cells

Violin plots show distribution of expression levels for EF-hand domain-containing protein (SMED30003300) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EF-hand domain-containing protein (SMED30003300) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EF-hand domain-containing protein (SMED30003300) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003300

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003300h1SMcG0009513 dd_Smed_v4_6200_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003300h1SMcG0009513 dd_Smed_v4_6200_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003300h1SMcG0009513 dd_Smed_v4_6200_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003300h1SMcG0009513 dd_Smed_v4_6200_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003300h1SMcG0009513 dd_Smed_v4_6200_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF-hand domain-containing protein vs. Ensembl Celegans
Match: olrn-1 (pep chromosome:WBcel235:X:15543012:15546323:1 gene:WBGene00007260.1 transcript:C02C6.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:olrn-1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.137e-17
Identity = 46/151 (30.46%), Postives = 82/151 (54.30%), Query Frame = 1
Query:  343 PQGSLPKHQKARWDVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQGRNLILVIPSERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALK 795
            P    P   +  +DVFLGG+C  T WR    IPFLK++ IT+Y+PQ S W  ++I  E +AKES+ + LFV+D   T    S +E A+ + +    ++V+   + +  +  +  +L +      NR+   +  +++   +P+  ++ DAL+
Sbjct:   64 PNDEKPTSSRETYDVFLGGSCGTTVWRRQSVIPFLKKRGITYYDPQRSFWSENMIYEESIAKESSSLFLFVID-PATVNATSFLEIAYFAARKSPKLVVVFLGKTEWAEKAHPDDLPDR-----NRTCQLLDRILECHQVPMLHTIPDALE 208          

HSP 2 Score: 67.781 bits (164), Expect = 1.698e-11
Identity = 28/91 (30.77%), Postives = 54/91 (59.34%), Query Frame = 1
Query: 1432 ENYDVYLGGTCGNSNWREKIAIPLLQKSGCTYFNPKMYNTDWSRKLLPIEAEARDRAKILVYVITNECTSTATLVEVGHFIGQGKKILLFI 1704
            E YDV+LGG+CG + WR +  IP L+K G TY++P+   + WS  ++  E+ A++ + + ++VI     +  + +E+ +F  +    L+ +
Sbjct:   74 ETYDVFLGGSCGTTVWRRQSVIPFLKKRGITYYDPQ--RSFWSENMIYEESIAKESSSLFLFVIDPATVNATSFLEIAYFAARKSPKLVVV 162          
BLAST of EF-hand domain-containing protein vs. Ensembl Celegans
Match: olrn-1 (pep chromosome:WBcel235:X:15537662:15546323:1 gene:WBGene00007260.1 transcript:C02C6.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:olrn-1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.578e-17
Identity = 46/151 (30.46%), Postives = 82/151 (54.30%), Query Frame = 1
Query:  343 PQGSLPKHQKARWDVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQGRNLILVIPSERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALK 795
            P    P   +  +DVFLGG+C  T WR    IPFLK++ IT+Y+PQ S W  ++I  E +AKES+ + LFV+D   T    S +E A+ + +    ++V+   + +  +  +  +L +      NR+   +  +++   +P+  ++ DAL+
Sbjct:   71 PNDEKPTSSRETYDVFLGGSCGTTVWRRQSVIPFLKKRGITYYDPQRSFWSENMIYEESIAKESSSLFLFVID-PATVNATSFLEIAYFAARKSPKLVVVFLGKTEWAEKAHPDDLPDR-----NRTCQLLDRILECHQVPMLHTIPDALE 215          

HSP 2 Score: 67.781 bits (164), Expect = 1.576e-11
Identity = 28/91 (30.77%), Postives = 54/91 (59.34%), Query Frame = 1
Query: 1432 ENYDVYLGGTCGNSNWREKIAIPLLQKSGCTYFNPKMYNTDWSRKLLPIEAEARDRAKILVYVITNECTSTATLVEVGHFIGQGKKILLFI 1704
            E YDV+LGG+CG + WR +  IP L+K G TY++P+   + WS  ++  E+ A++ + + ++VI     +  + +E+ +F  +    L+ +
Sbjct:   81 ETYDVFLGGSCGTTVWRRQSVIPFLKKRGITYYDPQ--RSFWSENMIYEESIAKESSSLFLFVIDPATVNATSFLEIAYFAARKSPKLVVV 169          
BLAST of EF-hand domain-containing protein vs. Ensembl Fly
Match: raw (gene:FBgn0003209 transcript:FBtr0079746)

HSP 1 Score: 137.502 bits (345), Expect = 4.881e-33
Identity = 69/145 (47.59%), Postives = 97/145 (66.90%), Query Frame = 1
Query:  382 DVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQG-RNLILVIPSERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATRICL 813
            +VFLGG+CNPTTWR DVAIP LKE  I+FYNPQVS W P LIE+E  AKE ARVL FV+D   TR  A  +EAA ++GQ  + L+LV+   +P   Q +  + + + E+  +NR+ L + +LV R+G+P+  ++   L+ T+  L
Sbjct:  352 EVFLGGSCNPTTWRADVAIPALKELGISFYNPQVSDWTPDLIELEHRAKEKARVLFFVMD-SETRASAGAIEAAHIAGQNCKQLVLVLHPYKPN--QKILNEPISQQEYLDLNRNQLILKELVSRRGLPVLDNIPLGLQRTKDIL 493          

HSP 2 Score: 79.337 bits (194), Expect = 9.123e-15
Identity = 31/91 (34.07%), Postives = 60/91 (65.93%), Query Frame = 1
Query: 1432 ENYDVYLGGTCGNSNWREKIAIPLLQKSGCTYFNPKMYNTDWSRKLLPIEAEARDRAKILVYVITNECTSTATLVEVGHFIGQGKKILLFI 1704
            E  +V+LGG+C  + WR  +AIP L++ G +++NP++  +DW+  L+ +E  A+++A++L +V+ +E  ++A  +E  H  GQ  K L+ +
Sbjct:  349 EPVEVFLGGSCNPTTWRADVAIPALKELGISFYNPQV--SDWTPDLIELEHRAKEKARVLFFVMDSETRASAGAIEAAHIAGQNCKQLVLV 437          
BLAST of EF-hand domain-containing protein vs. Ensembl Fly
Match: raw (gene:FBgn0003209 transcript:FBtr0303868)

HSP 1 Score: 137.502 bits (345), Expect = 4.881e-33
Identity = 69/145 (47.59%), Postives = 97/145 (66.90%), Query Frame = 1
Query:  382 DVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQG-RNLILVIPSERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATRICL 813
            +VFLGG+CNPTTWR DVAIP LKE  I+FYNPQVS W P LIE+E  AKE ARVL FV+D   TR  A  +EAA ++GQ  + L+LV+   +P   Q +  + + + E+  +NR+ L + +LV R+G+P+  ++   L+ T+  L
Sbjct:  352 EVFLGGSCNPTTWRADVAIPALKELGISFYNPQVSDWTPDLIELEHRAKEKARVLFFVMD-SETRASAGAIEAAHIAGQNCKQLVLVLHPYKPN--QKILNEPISQQEYLDLNRNQLILKELVSRRGLPVLDNIPLGLQRTKDIL 493          

HSP 2 Score: 79.337 bits (194), Expect = 9.123e-15
Identity = 31/91 (34.07%), Postives = 60/91 (65.93%), Query Frame = 1
Query: 1432 ENYDVYLGGTCGNSNWREKIAIPLLQKSGCTYFNPKMYNTDWSRKLLPIEAEARDRAKILVYVITNECTSTATLVEVGHFIGQGKKILLFI 1704
            E  +V+LGG+C  + WR  +AIP L++ G +++NP++  +DW+  L+ +E  A+++A++L +V+ +E  ++A  +E  H  GQ  K L+ +
Sbjct:  349 EPVEVFLGGSCNPTTWRADVAIPALKELGISFYNPQV--SDWTPDLIELEHRAKEKARVLFFVMDSETRASAGAIEAAHIAGQNCKQLVLV 437          
BLAST of EF-hand domain-containing protein vs. Ensembl Fly
Match: raw (gene:FBgn0003209 transcript:FBtr0340232)

HSP 1 Score: 137.502 bits (345), Expect = 4.881e-33
Identity = 69/145 (47.59%), Postives = 97/145 (66.90%), Query Frame = 1
Query:  382 DVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQG-RNLILVIPSERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATRICL 813
            +VFLGG+CNPTTWR DVAIP LKE  I+FYNPQVS W P LIE+E  AKE ARVL FV+D   TR  A  +EAA ++GQ  + L+LV+   +P   Q +  + + + E+  +NR+ L + +LV R+G+P+  ++   L+ T+  L
Sbjct:  352 EVFLGGSCNPTTWRADVAIPALKELGISFYNPQVSDWTPDLIELEHRAKEKARVLFFVMD-SETRASAGAIEAAHIAGQNCKQLVLVLHPYKPN--QKILNEPISQQEYLDLNRNQLILKELVSRRGLPVLDNIPLGLQRTKDIL 493          

HSP 2 Score: 79.337 bits (194), Expect = 9.123e-15
Identity = 31/91 (34.07%), Postives = 60/91 (65.93%), Query Frame = 1
Query: 1432 ENYDVYLGGTCGNSNWREKIAIPLLQKSGCTYFNPKMYNTDWSRKLLPIEAEARDRAKILVYVITNECTSTATLVEVGHFIGQGKKILLFI 1704
            E  +V+LGG+C  + WR  +AIP L++ G +++NP++  +DW+  L+ +E  A+++A++L +V+ +E  ++A  +E  H  GQ  K L+ +
Sbjct:  349 EPVEVFLGGSCNPTTWRADVAIPALKELGISFYNPQV--SDWTPDLIELEHRAKEKARVLFFVMDSETRASAGAIEAAHIAGQNCKQLVLV 437          
BLAST of EF-hand domain-containing protein vs. Ensembl Fly
Match: raw (gene:FBgn0003209 transcript:FBtr0340231)

HSP 1 Score: 137.117 bits (344), Expect = 5.439e-33
Identity = 68/142 (47.89%), Postives = 96/142 (67.61%), Query Frame = 1
Query:  382 DVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQG-RNLILVIPSERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATR 804
            +VFLGG+CNPTTWR DVAIP LKE  I+FYNPQVS W P LIE+E  AKE ARVL FV+D   TR  A  +EAA ++GQ  + L+LV+   +P   Q +  + + + E+  +NR+ L + +LV R+G+P+  ++   L+ T+
Sbjct:  195 EVFLGGSCNPTTWRADVAIPALKELGISFYNPQVSDWTPDLIELEHRAKEKARVLFFVMD-SETRASAGAIEAAHIAGQNCKQLVLVLHPYKPN--QKILNEPISQQEYLDLNRNQLILKELVSRRGLPVLDNIPLGLQRTK 333          

HSP 2 Score: 78.9518 bits (193), Expect = 9.267e-15
Identity = 31/91 (34.07%), Postives = 60/91 (65.93%), Query Frame = 1
Query: 1432 ENYDVYLGGTCGNSNWREKIAIPLLQKSGCTYFNPKMYNTDWSRKLLPIEAEARDRAKILVYVITNECTSTATLVEVGHFIGQGKKILLFI 1704
            E  +V+LGG+C  + WR  +AIP L++ G +++NP++  +DW+  L+ +E  A+++A++L +V+ +E  ++A  +E  H  GQ  K L+ +
Sbjct:  192 EPVEVFLGGSCNPTTWRADVAIPALKELGISFYNPQV--SDWTPDLIELEHRAKEKARVLFFVMDSETRASAGAIEAAHIAGQNCKQLVLV 280          
BLAST of EF-hand domain-containing protein vs. Ensembl Fly
Match: raw (gene:FBgn0003209 transcript:FBtr0079745)

HSP 1 Score: 137.117 bits (344), Expect = 6.017e-33
Identity = 68/142 (47.89%), Postives = 96/142 (67.61%), Query Frame = 1
Query:  382 DVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQG-RNLILVIPSERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATR 804
            +VFLGG+CNPTTWR DVAIP LKE  I+FYNPQVS W P LIE+E  AKE ARVL FV+D   TR  A  +EAA ++GQ  + L+LV+   +P   Q +  + + + E+  +NR+ L + +LV R+G+P+  ++   L+ T+
Sbjct:  168 EVFLGGSCNPTTWRADVAIPALKELGISFYNPQVSDWTPDLIELEHRAKEKARVLFFVMD-SETRASAGAIEAAHIAGQNCKQLVLVLHPYKPN--QKILNEPISQQEYLDLNRNQLILKELVSRRGLPVLDNIPLGLQRTK 306          

HSP 2 Score: 78.9518 bits (193), Expect = 9.885e-15
Identity = 31/91 (34.07%), Postives = 60/91 (65.93%), Query Frame = 1
Query: 1432 ENYDVYLGGTCGNSNWREKIAIPLLQKSGCTYFNPKMYNTDWSRKLLPIEAEARDRAKILVYVITNECTSTATLVEVGHFIGQGKKILLFI 1704
            E  +V+LGG+C  + WR  +AIP L++ G +++NP++  +DW+  L+ +E  A+++A++L +V+ +E  ++A  +E  H  GQ  K L+ +
Sbjct:  165 EPVEVFLGGSCNPTTWRADVAIPALKELGISFYNPQV--SDWTPDLIELEHRAKEKARVLFFVMDSETRASAGAIEAAHIAGQNCKQLVLV 253          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: T1IR01 (EF-hand domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 1.712e-74
Identity = 176/536 (32.84%), Postives = 272/536 (50.75%), Query Frame = 1
Query:  181 WKFGVYPSTSQIYEIRACQQD-EDVTSG--IEFYEFCLLIATIKYAIANQ--------KHSFKVQPQGSLPKHQKA---RWDVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQGRNLILVIPSERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATRICLISKSMVQDLTDIDGVVPVKHSFVNVSRTVKTLNKIFQSLDSTNSGVISQNDVKLAIQTLFKQDVQLISKEKKLFRFSDFCIEYSILLLNSVQHRKEQLRSNSVVNFKIRCNSLENLEILDREISLKSSINIKQQMDAV--------CVCEENENKSAGITFLCNCI--NTNNKLAYSVYRLLRCPFRRSAVKPLQSLEAVSNRETMKIDPHLLIPEENYDVYLGGTCGNSNWREKIAIPLLQKSGCTYFNPKMYNTDWS-RKLLPIEAEARDRAKILVYVITNECTSTATLVEVGHFIGQGKKILLFIQML 1713
            +K G++PS SQI+E+  C  D  D  S   + F EFC+  + +K    NQ        K S +   +G L   +     +++VFLGG+CNPTTWR ++AIP LK+  IT+YNPQV  W P LIE+E+ AKE+A VL FV+D  +TR +AS++EAA ++G  + LILV+  E     Q +  + L E EFQ +      + D+V+RQGIP+F  +  AL+ T   L      QDLT  D   PV  + V +   +  + + F ++D++NSG++  NDVK+A + L   D+                                               + E+L+ + R   + +S++   + D +        C+  E +NKS+    +   I   T N L + +  L +             +E +  R  +++  H       +DVYLGG+C  ++WRE IAIP+L+K+G T+FNP+     WS  +  PIEA A D  ++L++VITN C S +T+    H+IG   K++L IQ L
Sbjct:    7 YKLGLFPSKSQIHEMLHCASDCSDRCSANCLSFGEFCVFSSELKNCYENQTPRPTPLSKISDQNGTRGKLLSTETKSNLKYEVFLGGSCNPTTWRQNIAIPLLKKWRITYYNPQVGHWKPELIELENQAKENAEVLFFVID-NQTRSVASVIEAAHIAGCQKKLILVV-KEFQCPGQMILGEPLSEKEFQDLCHGQAILQDVVERQGIPVFDDIHKALECTARLLREGLWPQDLTLKDNAQPVCKAHVQLGDKLIKVYEAFNAMDTSNSGLLGLNDVKMAFRILTNYDL-----------------------------------------------TSEDLDAIIRTKKVNNSMDGNNKADDITVTFDQFCCIVSEFKNKSSNGRCILKSIIVKTANVLNFFILPLFK------------MMEWIVPRRRIRLASH------QHDVYLGGSCDTTSWREDIAIPILRKTGLTFFNPQ--TNYWSGNRFTPIEATAIDNCRVLLFVITNTCRSLSTMAIAAHYIGLNCKVVLCIQYL 473          

HSP 2 Score: 88.9669 bits (219), Expect = 1.175e-14
Identity = 51/157 (32.48%), Postives = 85/157 (54.14%), Query Frame = 1
Query:  355 LPKHQKARWDVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPS-LIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQGRNLILVIPSERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATRICLISK 822
            L  HQ    DV+LGG+C+ T+WR D+AIP L++  +TF+NPQ + W  +    IE  A ++ RVLLFV+     R ++++  AA   G    ++L I       +  +N   L     +  NR   +++DL  R+ IP+F  + +A++    C++ K
Sbjct:  378 LASHQH---DVYLGGSCDTTSWREDIAIPILRKTGLTFFNPQTNYWSGNRFTPIEATAIDNCRVLLFVIT-NTCRSLSTMAIAAHYIGLNCKVVLCIQYLPENCI--MNFDRLSVGSIKDYNRGRTYLSDLANRENIPVFDEIDEAVQ----CVVDK 524          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A4Y2UT47 (EF-hand domain-containing protein OS=Araneus ventricosus OX=182803 GN=AVEN_167229_1 PE=4 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 2.993e-70
Identity = 174/563 (30.91%), Postives = 284/563 (50.44%), Query Frame = 1
Query:   79 YMDNIFIYRELKSEYCKYVDDTNKFSEIDVQKASWKFGVYPSTSQIYEIRAC------QQDEDVTSGIEFYEFCLLIATIKYAIANQ-----------KHSFKVQPQGSLPKHQKARWDVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQGRNLILVIPS-ERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATRICLISKSMVQDLTDIDGVVPVKHSFVNVSRTVKTLNKIFQSLDSTNSGVISQNDVKLAIQTLFKQDVQLISKEKKLFRFSDFCIEYSILLLNSVQHRKEQLRSNSVVNFKIRCNSLENLEILDREISLKSSINIKQQMDAVCVCEENENKSAGITFLCNCINTNNKLAYSVYRLLRCPFRRSAVKPLQSLEAVSNRETMKIDPHLLIPEENYDVYLGGTCGNSNWREKIAIPLLQKSGCTYFNPKMYNTDWSRKLLPIEAEARDRAKILVYVITNECTSTATLVEVGHFIGQGKKILLFIQML 1713
            YM    I+ E         D  NK     V        ++PS+SQ++E+  C      +Q+ D    I F EFC+  + +K    N+           K + ++  +      + +++ VFLGG+CNPTTWR D+AIP  K  NIT+YNPQV+QW P LIE+E+ AK++A V+ FV+D  +TR +AS++EAA ++G  R LILV+   E+P +V  V  + + E EF+ + +   ++ DLV+RQGIP+F ++  A++ T   L      QDLT  D   PVK +++ +   +  L ++F  LDS N   I+  D+ +A + L   D+  +   K +    + C   S+         +++   N  V+F   C  +  L                Q  + +       NK++ I  +C+ +   +KL   V      P  R  V+   +   ++   T +            DVYLGG+   S WRE++AIPLL+K G TYF P+  +  WS +L+P+EA   + +++L++VI N+  S A ++   H++G G +I+L IQ +
Sbjct:   21 YMKLFLIWNE-------RADSLNKMGSQVVPHTFHDMDMFPSSSQVHEMLQCASECSKRQNGDY---ITFGEFCVYASELKSCYDNKIPRPTPLSKPSKETRRLNSRRRSTLTRPSKYQVFLGGSCNPTTWRRDIAIPTFKRLNITYYNPQVAQWGPELIELENQAKQNAEVMFFVID-NQTRSVASMIEAAQVAGTQRKLILVVHEFEKPGSV--VMGETITEKEFRDLQQGQRYLQDLVERQGIPVFDNINHAVQCTATILQKNIKPQDLTIQDAAHPVKMAYLQIGDKLIKLREVFDDLDSDNCSTITLKDIGMAFKILTSTDLP-VDNLKAIVSQQNGCCGNSL---------EDEAFDNVRVDFNQFCCIMTELR--------------NQTENGISNLSALRNKASNI--ICSVLTPLSKLLDWVR-----PESRPTVEGKNNGNDITYATTYR------------DVYLGGSRKPSLWREEVAIPLLKKKGLTYFIPQ--DGVWSERLIPMEATNMENSQVLLFVIKNDSRSLADMIVAAHYVGLGCQIVLCIQYI 525          

HSP 2 Score: 95.9005 bits (237), Expect = 8.615e-17
Identity = 51/145 (35.17%), Postives = 87/145 (60.00%), Query Frame = 1
Query:  382 DVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQGRNLILVIPSERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALK-ATRICL 813
            DV+LGG+  P+ WR +VAIP LK+K +T++ PQ   W   LI +E    E+++VLLFV+    +R +A ++ AA   G G  ++L I      T  +++ ++L     +  NR  ++++DL  R G+P+F  V +A++ A ++CL
Sbjct:  437 DVYLGGSRKPSLWREEVAIPLLKKKGLTYFIPQDGVWSERLIPMEATNMENSQVLLFVIK-NDSRSLADMIVAAHYVGLGCQIVLCIQYIEEDT--EIDGEKLSSQAVKDYNRGRVYLSDLATRAGVPVFDQVDEAVECAVKLCL 578          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A2L2XXL0 (EF-hand domain-containing protein (Fragment) OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 7.601e-70
Identity = 163/520 (31.35%), Postives = 282/520 (54.23%), Query Frame = 1
Query:  193 VYPSTSQIYEIRACQQD---EDVTSGIEFYEFCLLIATIKYAIANQ-------KHSFKVQPQGSLPKHQKARWDVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQGRNLILVIPS-ERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATRICLISKSMVQDLTDIDGVVPVKHSFVNVSRTVKTLNKIFQSLDSTNSGVISQNDVKLAIQTLFKQDVQLISKEKKLFRFSDFCIEYSILLLNSVQHRKEQLRSNSVVNF-KIRCNSLENLEILDREISLKSSINIKQQMDAVCVCEENENKSAGITFLCNCINTNNKLAYSVYRLLRCPFRRSAVKPLQSLEAVSNRETMKIDPHLLIPEENY-DVYLGGTCGNSNWREKIAIPLLQKSGCTYFNPKMYNTDWSRKLLPIEAEARDRAKILVYVITNECTSTATLVEVGHFIGQGKKILLFIQML 1713
            ++PS+SQ++E+  C  +         I F EFC+  + +K    N+         + +++ + ++P+ + +++ VFLGG+CNPTTWR D+AIP  K   I++YNPQV++W P LIE+E+ AK++A V+ FV+D  +TR +AS++EAA ++G  R L+LV+   E+P +V  V  +++ E EF+ + +   ++ DLV+RQGIP+F ++  A++ T   L      QDLT  D   PVK +++ +   +  L ++F  LD  N GVI+  DV +A + L  +++ + S +  + +    C +     LN      ++   N +++F +  C   E  +  D +    S++               +NK++ I  LC+ +    KL                V+P   L+        K   H +I E  Y D+YLGGT  +S WRE IAIPLL+K G TYF P+  +  WS +L+P+E    + +++L++VI+ +  S A ++   H++G   +++L IQ +
Sbjct:   11 IFPSSSQVHEMLHCANECSKRHNADYITFGEFCVYASELKSCYDNKIPRPTPLSKTKRLRRRNTVPQ-RSSKYQVFLGGSCNPTTWRKDIAIPTFKSLKISYYNPQVAEWGPQLIELENQAKQNAEVMFFVID-NQTRSVASMIEAAQVAGTQRKLMLVVHEFEKPGSV--VMGEKITEKEFKDLQQGQRYLQDLVERQGIPVFDNIHHAVQCTATILKKNIKPQDLTIEDAAQPVKMAYIQIGDKLIKLREVFDDLDCDNRGVITLKDVCMAYKILTDKEMHMDSLKSIVNQHKHSCTDD----LN------DEAFDNCLIDFNQFCCIMTEFRKQADSQFPNLSAL---------------KNKASDI--LCSVLTPLAKLV-------------DWVRPETRLDD-------KNSSHDIIYETTYRDIYLGGTRRSSTWREDIAIPLLKKQGLTYFIPQ--DGIWSERLIPMEITNMENSQVLLFVISKDSRSLADMIVAAHYVGLMCQVVLCIQYI 477          

HSP 2 Score: 94.3597 bits (233), Expect = 2.416e-16
Identity = 50/145 (34.48%), Postives = 88/145 (60.69%), Query Frame = 1
Query:  382 DVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQGRNLILVIPSERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALK-ATRICL 813
            D++LGG    +TWR D+AIP LK++ +T++ PQ   W   LI +E    E+++VLLFV+  K +R +A ++ AA   G    ++L I      T  +++ ++L E   +  NR  ++++DL  R GIP+F S+ ++++ A ++CL
Sbjct:  389 DIYLGGTRRSSTWREDIAIPLLKKQGLTYFIPQDGIWSERLIPMEITNMENSQVLLFVIS-KDSRSLADMIVAAHYVGLMCQVVLCIQYIEDGT--EIDGEKLSEQAVKDYNRGRVYLSDLATRAGIPVFDSIEESVECAAKMCL 530          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A0N8AR29 (RalBP1-associated Eps domain-containing protein (Fragment) OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 1.376e-62
Identity = 183/604 (30.30%), Postives = 283/604 (46.85%), Query Frame = 1
Query:   82 MDNIFIY----RELKSEYCKYVDDTNKF-SEID-VQKASWKFGVYPSTSQIYEIRAC--------------------------------QQDEDVTSG-------IEFYEFCLLIATIKYAIANQ-----KHSFKVQPQGSLPK-------HQKARWDVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQGRNLILVIPS-ERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATRICLISKSMVQDLTDIDGVVPVKHSFVNVSRTVKTLNKIFQSLDSTNSGVISQNDVKLAIQTLFKQDVQLISKEKKLFRFSDFCIEYSILLLNSVQHRKEQLRSNSVVNFKIRCNSLENLEILDREISLKSSINIKQQMDAVCVCEENENKSAG--ITFLCNCINTNNKLAYSVYRLLRCPFRRSAVKPLQSLEAVSNRETMKIDPHLLIPEENYDVYLGGTCGNSNWREKIAIPLLQKSGCTYFNPKMYNTDWSRKLLPIEAEARDRAKILVYVITNECTSTATLVEVGHFIGQGKKILLFIQML 1713
            M + FIY    REL   +C+ V + +   +E   +Q    +  VYPS SQI E+  C                                 +D   T G       + F EFCL    ++ +   +     + S  V  +G+  K          A++ VFLGG+CNPTTWR D+AIP LK   +T++NPQV QW P LIE E  AK++A VL FV+D K+TR +A++VEAA+ +   +  ILVI + + P   Q +  + + E E++ +    L + D+V+R GIP+F+++  AL  T   L  +  VQ+L   DG+ P+K+    +   +  L   F +LD++NSG IS                            +D C+ + IL                  N  +  + L+N+     E   ++S++  Q     C+  E  N  A     F     +    L YSV   +     R + K +   ++ S   TM             D+YLGG+CG++ WRE+ AIPLL+KSG TYFNP+     WSR+ +PIEA A D +++L++V++ E  S +++    H+IG G  ++L IQ L
Sbjct:  211 MSDNFIYGDITRELYEIWCRVVPNGSAVVAETQRLQSLFHQASVYPSQSQILEMIHCARERELQLQQQQQQEESVVMPAASTSTALGCGSKDPPQTDGNLQQRNFLTFGEFCLFAHELRKSYEREIPRPTQLSKVVDIKGNDKKMSDRKISKSAAKYQVFLGGSCNPTTWRQDIAIPLLKTWGLTYFNPQVPQWGPELIEKEHHAKQTADVLFFVID-KQTRSVATIVEAAYYTAAQKTFILVIHALDGPG--QLIQGEPITEREYEDLATGQLVLQDMVERLGIPVFSNIRLALDCTAKILKERITVQELGLSDGISPLKNPHYPIGDKLIKLRDAFNALDTSNSGEIS---------------------------MADVCMAFRIL-----------------TNRDLSVDDLKNIVASSNE---QTSVSFDQ---FCCILTEFRNLPADNQRRFWDVMASKAATLLYSVVSPVSRILCRPSPKGVARCDSSSPEVTMG---------GARDIYLGGSCGSTTWREQTAIPLLKKSGLTYFNPQ--TCGWSRRFIPIEAAAMDASRVLLFVVSLETRSLSSMALAAHYIGLGCNVVLCIQRL 750          

HSP 2 Score: 106.686 bits (265), Expect = 6.669e-20
Identity = 57/147 (38.78%), Postives = 84/147 (57.14%), Query Frame = 1
Query:  382 DVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQGRNLILVIPSERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATRICLISK 822
            D++LGG+C  TTWR   AIP LK+  +T++NPQ   W    I IE  A +++RVLLFV+ L+ TR ++S+  AA   G G N++L I  +R     ++N   L     +  NR   +++DL  R+GIP    VFD +K    C I +
Sbjct:  662 DIYLGGSCGSTTWREQTAIPLLKKSGLTYFNPQTCGWSRRFIPIEAAAMDASRVLLFVVSLE-TRSLSSMALAAHYIGLGCNVVLCI--QRLPDNAEINGDRLSAFAIKDYNRGRNYLSDLANREGIP----VFDEIKEAVECAIQR 801          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A0P5J7B1 (RalBP1-associated Eps domain-containing protein (Fragment) OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 1.431e-62
Identity = 183/604 (30.30%), Postives = 283/604 (46.85%), Query Frame = 1
Query:   82 MDNIFIY----RELKSEYCKYVDDTNKF-SEID-VQKASWKFGVYPSTSQIYEIRAC--------------------------------QQDEDVTSG-------IEFYEFCLLIATIKYAIANQ-----KHSFKVQPQGSLPK-------HQKARWDVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQGRNLILVIPS-ERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATRICLISKSMVQDLTDIDGVVPVKHSFVNVSRTVKTLNKIFQSLDSTNSGVISQNDVKLAIQTLFKQDVQLISKEKKLFRFSDFCIEYSILLLNSVQHRKEQLRSNSVVNFKIRCNSLENLEILDREISLKSSINIKQQMDAVCVCEENENKSAG--ITFLCNCINTNNKLAYSVYRLLRCPFRRSAVKPLQSLEAVSNRETMKIDPHLLIPEENYDVYLGGTCGNSNWREKIAIPLLQKSGCTYFNPKMYNTDWSRKLLPIEAEARDRAKILVYVITNECTSTATLVEVGHFIGQGKKILLFIQML 1713
            M + FIY    REL   +C+ V + +   +E   +Q    +  VYPS SQI E+  C                                 +D   T G       + F EFCL    ++ +   +     + S  V  +G+  K          A++ VFLGG+CNPTTWR D+AIP LK   +T++NPQV QW P LIE E  AK++A VL FV+D K+TR +A++VEAA+ +   +  ILVI + + P   Q +  + + E E++ +    L + D+V+R GIP+F+++  AL  T   L  +  VQ+L   DG+ P+K+    +   +  L   F +LD++NSG IS                            +D C+ + IL                  N  +  + L+N+     E   ++S++  Q     C+  E  N  A     F     +    L YSV   +     R + K +   ++ S   TM             D+YLGG+CG++ WRE+ AIPLL+KSG TYFNP+     WSR+ +PIEA A D +++L++V++ E  S +++    H+IG G  ++L IQ L
Sbjct:  211 MSDNFIYGDITRELYEIWCRVVPNGSAVVAETQRLQSLFHQASVYPSQSQILEMIHCARERELQLQQQQQQEESVVMPAASTSTALGCGSKDPPQTDGNLQQRNFLTFGEFCLFAHELRKSYEREIPRPTQLSKVVDIKGNDKKMSDRKISKSAAKYQVFLGGSCNPTTWRQDIAIPLLKTWGLTYFNPQVPQWGPELIEKEHHAKQTADVLFFVID-KQTRSVATIVEAAYYTAAQKTFILVIHALDGPG--QLIQGEPITEREYEDLATGQLVLQDMVERLGIPVFSNIRLALDCTAKILKERITVQELGLSDGISPLKNPHYPIGDKLIKLRDAFNALDTSNSGEIS---------------------------MADVCMAFRIL-----------------TNRDLSVDDLKNIVASSNE---QTSVSFDQ---FCCILTEFRNLPADNQRRFWDVMASKAATLLYSVVSPVSRILCRPSPKGVARCDSSSPEVTMG---------GARDIYLGGSCGSTTWREQTAIPLLKKSGLTYFNPQ--TCGWSRRFIPIEAAAMDASRVLLFVVSLETRSLSSMALAAHYIGLGCNVVLCIQRL 750          

HSP 2 Score: 106.686 bits (265), Expect = 6.965e-20
Identity = 57/147 (38.78%), Postives = 84/147 (57.14%), Query Frame = 1
Query:  382 DVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQGRNLILVIPSERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATRICLISK 822
            D++LGG+C  TTWR   AIP LK+  +T++NPQ   W    I IE  A +++RVLLFV+ L+ TR ++S+  AA   G G N++L I  +R     ++N   L     +  NR   +++DL  R+GIP    VFD +K    C I +
Sbjct:  662 DIYLGGSCGSTTWREQTAIPLLKKSGLTYFNPQTCGWSRRFIPIEAAAMDASRVLLFVVSLE-TRSLSSMALAAHYIGLGCNVVLCI--QRLPDNAEINGDRLSAFAIKDYNRGRNYLSDLANREGIP----VFDEIKEAVECAIQR 801          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000051245.1 (SMESG000051245.1)

HSP 1 Score: 1372.84 bits (3552), Expect = 0.000e+0
Identity = 696/698 (99.71%), Postives = 698/698 (100.00%), Query Frame = 1
Query:   82 MDNIFIYRELKSEYCKYVDDTNKFSEIDVQKASWKFGVYPSTSQIYEIRACQQDEDVTSGIEFYEFCLLIATIKYAIANQKHSFKVQPQGSLPKHQKARWDVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQGRNLILVIPSERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATRICLISKSMVQDLTDIDGVVPVKHSFVNVSRTVKTLNKIFQSLDSTNSGVISQNDVKLAIQTLFKQDVQLISKEKKLFRFSDFCIEYSILLLNSVQHRKEQLRSNSVVNFKIRCNSLENLEILDREISLKSSINIKQQMDAVCVCEENENKSAGITFLCNCINTNNKLAYSVYRLLRCPFRRSAVKPLQSLEAVSNRETMKIDPHLLIPEENYDVYLGGTCGNSNWREKIAIPLLQKSGCTYFNPKMYNTDWSRKLLPIEAEARDRAKILVYVITNECTSTATLVEVGHFIGQGKKILLFIQMLSYMSSPPCTPMSQLLQSSCSFPLTSLNTSISHSFFSSVKKTEXXXXXXXXXXXXXXXXFSLPQISNKLSISDAGFLGLTQDYSEMAXXXXXXXXXXXXXHEACKDHNRGRKYLIDLANRSKVPILPSIEETINQAILWSQKPSPSHGWTNKSNS 2175
            MDNIFIYRELKSEYCKYVDDTNKFSEIDVQKASWKFGVYPSTSQIYEIRACQQDEDVTSGIEFYEFCLLIATIKYAIANQKHSFKVQPQGSLPKHQKARWDVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQGRNLILVIPSERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATRICLISKSMVQDLTDIDGVVPVKHSFVNVSRTVKTL+KIFQSLDSTNSGVISQNDVKLAIQTLFKQDVQLISKEKKLFRFSDFCIEYSILLLNSVQHRKEQLRSNSVVNFKIRCNSLENLEILDRE+SLKSSINIKQQMDAVCVCEENENKSAGITFLCNCINTNNKLAYSVYRLLRCPFRRSAVKPLQSLEAVSNRETMKIDPHLLIPEENYDVYLGGTCGNSNWREKIAIPLLQKSGCTYFNPKMYNTDWSRKLLPIEAEARDRAKILVYVITNECTSTATLVEVGHFIGQGKKILLFIQMLSYMSSPPCTPMSQLLQSSCSFPLTSLNTSISHSFFSSVKKTESTTTGYQSSYGTGNSQFSLPQISNKLSISDAGFLGLTQDYSEMAISINNISQINSLSHEACKDHNRGRKYLIDLANRSKVPILPSIEETINQAILWSQKPSPSHGWTNKSNS
Sbjct:    1 MDNIFIYRELKSEYCKYVDDTNKFSEIDVQKASWKFGVYPSTSQIYEIRACQQDEDVTSGIEFYEFCLLIATIKYAIANQKHSFKVQPQGSLPKHQKARWDVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKESARVLLFVLDLKRTRGIASLVEAAFLSGQGRNLILVIPSERPKTVQDVNVKELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATRICLISKSMVQDLTDIDGVVPVKHSFVNVSRTVKTLHKIFQSLDSTNSGVISQNDVKLAIQTLFKQDVQLISKEKKLFRFSDFCIEYSILLLNSVQHRKEQLRSNSVVNFKIRCNSLENLEILDREMSLKSSINIKQQMDAVCVCEENENKSAGITFLCNCINTNNKLAYSVYRLLRCPFRRSAVKPLQSLEAVSNRETMKIDPHLLIPEENYDVYLGGTCGNSNWREKIAIPLLQKSGCTYFNPKMYNTDWSRKLLPIEAEARDRAKILVYVITNECTSTATLVEVGHFIGQGKKILLFIQMLSYMSSPPCTPMSQLLQSSCSFPLTSLNTSISHSFFSSVKKTESTTTGYQSSYGTGNSQFSLPQISNKLSISDAGFLGLTQDYSEMAISINNISQINSLSHEACKDHNRGRKYLIDLANRSKVPILPSIEETINQAILWSQKPSPSHGWTNKSNS 698          
The following BLAST results are available for this feature:
BLAST of EF-hand domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
olrn-12.137e-1730.46pep chromosome:WBcel235:X:15543012:15546323:1 gene... [more]
olrn-12.578e-1730.46pep chromosome:WBcel235:X:15537662:15546323:1 gene... [more]
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
raw4.881e-3347.59gene:FBgn0003209 transcript:FBtr0079746[more]
raw4.881e-3347.59gene:FBgn0003209 transcript:FBtr0303868[more]
raw4.881e-3347.59gene:FBgn0003209 transcript:FBtr0340232[more]
raw5.439e-3347.89gene:FBgn0003209 transcript:FBtr0340231[more]
raw6.017e-3347.89gene:FBgn0003209 transcript:FBtr0079745[more]
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1IR011.712e-7432.84EF-hand domain-containing protein OS=Strigamia mar... [more]
A0A4Y2UT472.993e-7030.91EF-hand domain-containing protein OS=Araneus ventr... [more]
A0A2L2XXL07.601e-7031.35EF-hand domain-containing protein (Fragment) OS=Pa... [more]
A0A0N8AR291.376e-6230.30RalBP1-associated Eps domain-containing protein (F... [more]
A0A0P5J7B11.431e-6230.30RalBP1-associated Eps domain-containing protein (F... [more]
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000051245.10.000e+099.71SMESG000051245.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003300 ID=SMED30003300|Name=EF-hand domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2267bp
TTTCGTTTTTATTTAAATAGCAAAAATTCTATTCATAATGTTCTGGTTTT
AAAATTTTTATGAAGATTTATATTATTTTATATGGATAATATTTTCATTT
ATAGAGAATTAAAATCAGAATATTGTAAGTATGTCGATGATACTAATAAA
TTCTCAGAAATCGACGTTCAGAAGGCGTCATGGAAGTTTGGAGTGTACCC
GTCGACTTCTCAGATTTATGAAATACGAGCTTGTCAACAAGATGAAGATG
TAACCAGCGGAATAGAATTTTACGAATTTTGTTTACTAATCGCCACGATT
AAATATGCAATAGCAAATCAAAAACATTCATTCAAAGTCCAGCCGCAAGG
AAGCCTTCCTAAACATCAGAAAGCCCGCTGGGATGTCTTTCTTGGAGGTG
CTTGTAATCCGACAACATGGAGATTTGACGTGGCAATTCCATTTCTCAAG
GAGAAAAATATCACTTTCTATAACCCGCAAGTTTCACAGTGGGATCCAAG
TCTTATTGAAATAGAAGATATGGCAAAGGAGTCTGCTAGAGTTTTGCTAT
TTGTATTAGATCTCAAACGTACGCGAGGAATCGCGAGTCTTGTCGAAGCA
GCTTTTTTATCTGGACAAGGTCGTAATCTGATTCTTGTTATCCCTTCTGA
AAGACCGAAAACTGTCCAAGACGTTAACGTAAAGGAATTAGAGGAAAATG
AATTTCAATCTATTAATCGAAGCTATTTGTTTATTGCGGATTTAGTTCAA
AGACAGGGTATTCCATTATTCACGAGTGTCTTTGATGCTTTGAAGGCTAC
TCGGATCTGTTTGATTTCGAAATCTATGGTGCAAGACCTTACTGATATTG
ACGGGGTTGTCCCTGTGAAACATTCTTTTGTAAATGTCTCAAGAACTGTG
AAAACTCTAAACAAAATTTTCCAATCATTAGACTCTACGAATTCAGGAGT
GATCTCTCAAAATGACGTAAAATTAGCAATTCAAACTCTGTTTAAACAAG
ACGTCCAGTTGATCAGCAAGGAGAAAAAATTGTTCAGATTTTCCGATTTT
TGTATCGAATATTCAATTTTACTGTTGAACAGCGTCCAACATCGCAAGGA
ACAGCTTCGGTCTAATTCTGTGGTGAATTTCAAAATTCGATGCAATTCTC
TGGAAAATCTCGAGATCCTGGACAGAGAAATCAGCCTGAAATCTTCCATT
AACATCAAGCAACAGATGGACGCAGTCTGTGTTTGCGAGGAGAACGAAAA
TAAATCAGCCGGAATAACATTTCTTTGCAACTGTATCAATACAAACAATA
AATTAGCTTACAGTGTTTATCGCTTATTGCGTTGCCCATTTCGTCGTTCA
GCTGTCAAGCCACTGCAGTCTTTGGAAGCGGTATCTAATCGTGAAACGAT
GAAAATTGATCCTCATTTACTGATTCCGGAAGAAAATTACGACGTGTATT
TAGGTGGCACTTGTGGAAACAGTAATTGGAGAGAAAAAATTGCAATACCT
TTGCTGCAAAAATCGGGTTGCACATATTTCAACCCCAAAATGTATAACAC
GGATTGGAGTAGGAAATTACTCCCGATTGAAGCGGAAGCGCGCGACCGCG
CAAAGATATTGGTTTATGTAATAACCAATGAGTGCACCTCTACCGCAACA
TTAGTTGAAGTAGGTCACTTTATTGGCCAAGGAAAAAAGATATTGCTATT
TATTCAAATGCTATCTTACATGTCCTCACCTCCGTGTACTCCTATGTCTC
AATTACTCCAGTCTTCATGTTCTTTTCCACTTACCTCACTCAACACTAGT
ATCAGTCATTCCTTTTTCTCTTCAGTAAAAAAGACTGAATCAACAACTAC
TGGTTACCAATCAAGTTATGGTACAGGTAACAGTCAATTTAGTCTTCCTC
AAATATCAAATAAGCTTTCCATTTCTGATGCTGGTTTTCTTGGTTTAACA
CAGGATTATTCAGAAATGGCAATCTCAATTAACAATATTTCACAAATAAA
TTCTTTGTCTCATGAAGCCTGTAAAGATCACAATCGAGGCAGAAAATACC
TCATAGACCTGGCCAACCGTTCCAAAGTGCCAATTCTACCTTCTATCGAA
GAAACTATCAATCAAGCTATTCTATGGTCTCAAAAACCTAGTCCTAGTCA
TGGTTGGACGAACAAATCTAATTCCTGATGATTTTATTTATTCATTTTAT
TGTGCCAATATTATGTTCTCATTAAATTTATTTTATTTCAATAAACAGTG
TCGCTTTGAAAAAAAAA
back to top

protein sequence of SMED30003300-orf-1

>SMED30003300-orf-1 ID=SMED30003300-orf-1|Name=SMED30003300-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=699bp
MDNIFIYRELKSEYCKYVDDTNKFSEIDVQKASWKFGVYPSTSQIYEIRA
CQQDEDVTSGIEFYEFCLLIATIKYAIANQKHSFKVQPQGSLPKHQKARW
DVFLGGACNPTTWRFDVAIPFLKEKNITFYNPQVSQWDPSLIEIEDMAKE
SARVLLFVLDLKRTRGIASLVEAAFLSGQGRNLILVIPSERPKTVQDVNV
KELEENEFQSINRSYLFIADLVQRQGIPLFTSVFDALKATRICLISKSMV
QDLTDIDGVVPVKHSFVNVSRTVKTLNKIFQSLDSTNSGVISQNDVKLAI
QTLFKQDVQLISKEKKLFRFSDFCIEYSILLLNSVQHRKEQLRSNSVVNF
KIRCNSLENLEILDREISLKSSINIKQQMDAVCVCEENENKSAGITFLCN
CINTNNKLAYSVYRLLRCPFRRSAVKPLQSLEAVSNRETMKIDPHLLIPE
ENYDVYLGGTCGNSNWREKIAIPLLQKSGCTYFNPKMYNTDWSRKLLPIE
AEARDRAKILVYVITNECTSTATLVEVGHFIGQGKKILLFIQMLSYMSSP
PCTPMSQLLQSSCSFPLTSLNTSISHSFFSSVKKTESTTTGYQSSYGTGN
SQFSLPQISNKLSISDAGFLGLTQDYSEMAISINNISQINSLSHEACKDH
NRGRKYLIDLANRSKVPILPSIEETINQAILWSQKPSPSHGWTNKSNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR039470Nuc_deoxyri_tr2
IPR011992EF-hand-dom_pair
IPR002048EF_hand_dom
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR039470Nucleoside 2-deoxyribosyltransferase-likePFAMPF15891Nuc_deoxyri_tr2coord: 453..541
e-value: 1.1E-16
score: 61.1
coord: 100..188
e-value: 1.4E-17
score: 64.0
NoneNo IPR availablePANTHERPTHR36300FAMILY NOT NAMEDcoord: 9..545
coord: 640..680
NoneNo IPR availableSUPERFAMILYSSF52309N-(deoxy)ribosyltransferase-likecoord: 453..548
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 271..306
score: 9.743
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 8..303