Zinc finger, C2H2 type

Overview
NameZinc finger, C2H2 type
Smed IDSMED30003297
Length (bp)5062
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger, C2H2 type (SMED30003297) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger, C2H2 type (SMED30003297) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger, C2H2 type (SMED30003297) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger, C2H2 type (SMED30003297) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003297

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30003297h1SMcG0007993 SmedASXL_017435SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior sideSMED30003297h1SMcG0007993 dd_Smed_v4_8871_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30003297h1SMcG0007993 dd_Smed_v4_8871_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger, C2H2 type vs. Ensembl Human
Match: ZNF236 (zinc finger protein 236 [Source:HGNC Symbol;Acc:HGNC:13028])

HSP 1 Score: 211.075 bits (536), Expect = 3.427e-54
Identity = 204/764 (26.70%), Postives = 319/764 (41.75%), Query Frame = 1
Query:  703 YKCVICSCLFSRKKAHQAHCLIHQV-DEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDE-MKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNM--------------------------------NTHIKVIHKNGTEVLSQSQE--HLLNESNXXXXXXQKDPNR----------------FKKIASLAE-----TNQSPSDDAEIT-----------QYLWNEN---------PTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQ------LHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPT----ANSNNP-PDV---KPLIWNEL-LNQPIPIAEIDKRKLSNN------RLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            +KC IC   F ++   Q H   H+  D+   C+ CP  F  +  L  H   H  GE+            C +C+  F  V ++K H +  H K       E G       ++   +EE  +         AC+  K   +  S+L E MK      +S   R    +   +    +C  CGK F+ P  L RH   HTG + F+C  C K F QK +++ HM+ H   K   C FC  AF+ + N+                                NTHI  +H  G +  + S E  H+L  +       Q+   +                 +++  L+E     + QSP    +++           Q L N           P +  H      H  N D    S E     D ++  +     E  E++DK+  ++       L   I+++  G R   C +C K +RK  DL RHIRIHT +KPF+C  C ++F +KS L  H K+H  +K F C+ C K F+   +LKVH +LH   +  F C  CD++F T  H + H + SH +                  +  +    + KP       +N P PD+   +P++  +L L QPIP  +  +   +NN      R +KC +C ++YK   +L +H++ H +      C  C + FV+   ++ H+RT H   + F CL C   F T  SL RH  +H++ +PY CP C + FK  + C +H+
Sbjct:   37 HKCEICLLSFPKESQFQRHMRDHERNDKPHRCDQCPQTFNVEFNLTLHKCTHS-GED----------PTCPVCNKKFSRVASLKAH-IMLHEKEENLICSECGDEFTLQSQLAVHMEEHRQELAGTRQH-ACKACKKEFETSSELKEHMKTHYKIRVSST-RSYNRNIDRSGFTYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPHACAFCPAAFSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKMHMGGPQNSTSSTETAHVLTATLFQTLPLQQTEAQATSASSQPSSQAVSDVIQQLLELSEPAPVESGQSPQPGQQLSITVGINQDILQQALENSGLSSIPAAAHPNDSCHAKTSAPHAQNPDVSSVSNEQTDPTDAEQEKE----QESPEKLDKKEKKMIKKKSPFLPGSIREE-NGVRWHVCPYCAKEFRKPSDLVRHIRIHTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCMKSFSTSGSLKVHIRLHTGVR-PFACPHCDKKFRTSGHRKTHIA-SHFK-----------------HTELRKMRHQRKPAKVRVGKTNIPVPDIPLQEPILITDLGLIQPIPKNQFFQSYFNNNFVNEADRPYKCFYCHRAYKKSCHLKQHIRSH-TGEKPFKCSQCGRGFVSAGVLKAHIRT-HTGLKSFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHM 760          

HSP 2 Score: 128.257 bits (321), Expect = 8.980e-29
Identity = 95/333 (28.53%), Postives = 147/333 (44.14%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFR----CRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTG----FHLRYHYSTSHHRSIANPDP 2199
            C  C K FK    L++H  +HTG K ++C +C +GF     +K H   H  VK F C  C  +FT   ++  H+   H +    +   +     E        +K   R + + S      S + + E       E    E H     + +S  +    + E   +L   +  +   +SE V  +     + ++ E+   Q       +    C +C K ++K  DL RH+RIHT +KP++C  C KSF +KS L  H K+H   K FSC +C+  F+ K +LKVH +LH   K  F C  C+ RF T      H+++HY          PDP
Sbjct:  969 CDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCSVCNASFTTNGSLTRHM-ATHMS----MKPYKCPFCEEGFRTTVHCKKHMKRHQTVPSAV----SATGETEGGDICMEEE---EEHSDRNASRKSRPEVITFTEEETAQLAKIRPQESATVSEKV-LVQSAAEKDRISELRDKQAELQDEPKHANCCTYCPKSFKKPSDLVRHVRIHTGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAK-PFKCPHCELRFRTSGRRKTHMQFHY---------KPDP 1278          

HSP 3 Score: 122.479 bits (306), Expect = 5.109e-27
Identity = 91/327 (27.83%), Postives = 142/327 (43.43%), Query Frame = 1
Query: 1771 ERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLN----QPIPIAEIDKRKLSNNRLFK----------------------CNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            E +D +    Q  E  +DQ    R +RC +C K ++KS  L +H+R HT +KP++C +C + F    VLK+H K+H  +K FSC +CN  F    +L  H   H   K  + C  C+  F T  H + H     H+++  P                + E   +   A+  + P+V      E       +P   A + ++ L  +   K                      C +C KS+K    L  H++ H +      C  C KSF    ++  H++T H  ++ FSC  C   F TK SL  H  +H+ +KP+ CP C  RF+
Sbjct:  944 EELDLQAQGSQFLEDNEDQ--SRRSYRCDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCSVCNASFTTNGSLTRHMATHMSMK-PYKCPFCEEGFRTTVHCKKHM--KRHQTV--PSAVSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQESATVSEKVLVQSAAEKDRISELRDKQAELQDEPKHANCCTYCPKSFKKPSDLVRHVRIH-TGEKPYKCDECGKSFTVKSTLDCHVKT-HTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCELRFR 1261          

HSP 4 Score: 98.9821 bits (245), Expect = 6.809e-20
Identity = 85/317 (26.81%), Postives = 136/317 (42.90%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKK------------IASLAETNQSPSDDAEITQYLWNENPTNENHFSY----------QPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH---EPDKLR 2100
            C +CG+ F +  +L+ HE THTG+K F C +C   FT   S+  HM  H ++K + C FC + F    +   H+K  H+     +S + E    +   +EEE+  D N  +K             A LA+    P + A +++ +  ++   ++  S           +P H +N  +Y P  ++F K              D+ R       +++H       TG + ++C  C K +     L  H++ HT QK F C++C  +F  K  LK H + H   K F C  C   F      K H Q H   +P K R
Sbjct:  997 CKLCGRGFVSSGVLKSHEKTHTGVKAFSCSVCNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTTVHCKKHMKR-HQTVPSAVSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIR--PQESATVSEKVLVQSAAEKDRISELRDKQAELQDEPKH-ANCCTYCP--KSFKK------------PSDLVR------HVRIH-------TGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCELRFRTSGRRKTHMQFHYKPDPKKAR 1282          

HSP 5 Score: 94.7449 bits (234), Expect = 1.434e-18
Identity = 42/109 (38.53%), Postives = 62/109 (56.88%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            R ++C +C++ Y+KSC L +HIR HT +KPF+C  C + F    VLK H ++H  LK F C ICN  F    +L+ H  +H  D   ++C  C + F T  + + H  T
Sbjct:  655 RPYKCFYCHRAYKKSCHLKQHIRSHTGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLICNGAFTTGGSLRRHMGIHN-DLRPYMCPYCQKTFKTSLNCKKHMKT 762          

HSP 6 Score: 91.2781 bits (225), Expect = 1.576e-17
Identity = 79/287 (27.53%), Postives = 122/287 (42.51%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIF----NLKQTLKVHR 2073
            C  C +AF     L  H  THTGIK F+C  C K F+   S+K+H+ +H  V+ F C  C K F    +  THI   H   TE+               +   Q+ P + +   +       P  +  +   L    P  +N F +Q        SY     NF+  + D+ ++         R  K++  ++ H  I+   TG + F+C  C + +  +  L  HIR HT  K F+C +C+ +F     L+ H   H  L+ + C  C K F    N K+ +K HR
Sbjct:  512 CPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCMKSFSTSGSLKVHIRLHTGVRPFACPHCDKKFRTSGHRKTHI-ASHFKHTEL--------------RKMRHQRKPAKVRVGKTNIPVPDIPLQEPILITDLGLIQPIPKNQF-FQ--------SYF--NNNFVN-EADRPYKCFY----CHRAYKKSCHLKQH--IRSH-TGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHR 764          

HSP 7 Score: 82.0333 bits (201), Expect = 9.058e-15
Identity = 36/110 (32.73%), Postives = 60/110 (54.55%), Query Frame = 1
Query: 2371 NNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            + R ++C++C K +K   +L +H++ H +      C+ C + FV+   ++ H +T H   + FSC  C A F T  SL RH   H + KPY CP C   F+  ++C +H+
Sbjct:  963 SRRSYRCDYCNKGFKKSSHLKQHVRSH-TGEKPYKCKLCGRGFVSSGVLKSHEKT-HTGVKAFSCSVCNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTTVHCKKHM 1070          

HSP 8 Score: 72.4034 bits (176), Expect = 8.328e-12
Identity = 45/151 (29.80%), Postives = 70/151 (46.36%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHE-NDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKH 957
            CEIC + FP +  + +HM  HE ND+  +C  C  ++N E NL +H    H+ E           +  C +C+  FSR  + +AH ++H+ +E L C  C   F  +  L  H+ +H+           T    CK C   FE    +K+H
Sbjct:   39 CEICLLSFPKESQFQRHMRDHERNDKPHRCDQCPQTFNVEFNLTLH-KCTHSGE-----------DPTCPVCNKKFSRVASLKAHIMLHEKEENLICSECGDEFTLQSQLAVHMEEHR------QELAGTRQHACKACKKEFETSSELKEH 171          

HSP 9 Score: 64.6994 bits (156), Expect = 1.762e-9
Identity = 34/111 (30.63%), Postives = 59/111 (53.15%), Query Frame = 1
Query: 3553 YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            +H C  C  +F+    LV H++  H   + F C  C +AF+ K +L AH KTH   ++F C  C+   + F +  SL  H+R+  +  +  + C HC+K ++T+    +H+
Sbjct:  481 WHVCPYCAKEFRKPSDLVRHIRI-HTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCM---KSFSTSGSLKVHIRL--HTGVRPFACPHCDKKFRTSGHRKTHI 585          

HSP 10 Score: 64.6994 bits (156), Expect = 1.999e-9
Identity = 39/109 (35.78%), Postives = 57/109 (52.29%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C   +K S  L +H++S H   + F C+ C + F +   L AH +TH   +SF C +   CN  F +  SL RH+ + HND L  Y C +C K +KT+     H+K
Sbjct:  659 CFYCHRAYKKSCHLKQHIRS-HTGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLI---CNGAFTTGGSLRRHMGI-HND-LRPYMCPYCQKTFKTSLNCKKHMK 761          

HSP 11 Score: 62.7734 bits (151), Expect = 6.453e-9
Identity = 36/110 (32.73%), Postives = 58/110 (52.73%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            C  C+  FK S  L +HV+S H   + + C +C + F +   L +H KTH   ++F C V   CN  F +  SL+RH  M  + ++  Y+C  C + ++TT     H+K+
Sbjct:  969 CDYCNKGFKKSSHLKQHVRS-HTGEKPYKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCSV---CNASFTTNGSLTRH--MATHMSMKPYKCPFCEEGFRTTVHCKKHMKR 1072          

HSP 12 Score: 58.5362 bits (140), Expect = 1.472e-7
Identity = 65/253 (25.69%), Postives = 96/253 (37.94%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSV----HCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKP---IKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQL---IQYNCAQCNIMFAQESSYVNHQKSVH 4965
            P+ C  C + FN   NL  H   H+   P  CP C K+F    SLK H          +         L+SQ+A+  H++ H +E +      CK C K F+   +L  H+   +    S           +G   S P     +  +  QKP    + +     ++  KC  C   FN K     H  +    EK H    C   F        HVQ VH+++     YNC +C+ +F    S   H   +H
Sbjct:   65 PHRCDQCPQTFNVEFNLTLHKCTHSGEDPT-CPVCNKKFSRVASLKAHIMLHEKEENLICSECGDEFTLQSQLAV--HMEEHRQELAGTRQHACKACKKEFETSSELKEHMKTHYKIRVSSTRSYNRNIDRSGFTYSCP-----HCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHM-IKHTGEKPHACAFCPAAFSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKMH 308          

HSP 13 Score: 57.7658 bits (138), Expect = 2.115e-7
Identity = 69/257 (26.85%), Postives = 109/257 (42.41%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIP---EIPKKLIK-------CLSCSFIFNTKAKYD-----NHFCVGLKAEKSHLNRC--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            Y C  C+KGF ++S+L+QH+  HT  +PY+C  C + F     LK+HE T H+ V K   C +C     +  +L  H+  H+      C  C +GF       +H+ ++H    S +     G    G++        H      +K   EVI    E   +L K        +S   +  + A+ D           L+ E  H N C  C K+F+  S  + HV+ +H     Y C +C   F  +S+   H K+
Sbjct:  967 YRCDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRGFVSSGVLKSHEKT-HTGV-KAFSCSVCNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTTVHCKKHM-KRHQTVPSAVSAT--GETEGGDI-CMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQESATVSEKVLVQSAAEKDRISELRDKQAELQDEPKHANCCTYCPKSFKKPSDLVRHVR-IHTGEKPYKCDECGKSFTVKSTLDCHVKT 1216          

HSP 14 Score: 57.3806 bits (137), Expect = 2.938e-7
Identity = 33/109 (30.28%), Postives = 54/109 (49.54%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C   FK    LV HV+  H   + + C+ C K+F+ K +L  H KTH   + F C V   C+  F +  SL  H+R+  +     ++C HC   ++T+    +H++
Sbjct: 1169 CTYCPKSFKKPSDLVRHVRI-HTGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHV---CSNAFSTKGSLKVHMRL--HTGAKPFKCPHCELRFRTSGRRKTHMQ 1271          

HSP 15 Score: 52.7582 bits (125), Expect = 8.699e-6
Identity = 40/158 (25.32%), Postives = 61/158 (38.61%), Query Frame = 1
Query: 3556 HGCANCDHQFKDSQSLVEHVKSQHKIR-------------------------------------------RDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHND--NLNLYRCTHCNKVYKTTRELDSHVKQL 3894
            H C  C  +F+ S  L EH+K+ +KIR                                           R F C+ C KAF+ K +L  H   H   +   C  C A    F    +L  HV+  H++  N   Y CT C+ V+K+   L++H+ ++
Sbjct:  153 HACKACKKEFETSSELKEHMKTHYKIRVSSTRSYNRNIDRSGFTYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPHACAFCPAA---FSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKM 307          
BLAST of Zinc finger, C2H2 type vs. Ensembl Human
Match: ZNF236 (zinc finger protein 236 [Source:HGNC Symbol;Acc:HGNC:13028])

HSP 1 Score: 211.075 bits (536), Expect = 4.667e-54
Identity = 204/764 (26.70%), Postives = 319/764 (41.75%), Query Frame = 1
Query:  703 YKCVICSCLFSRKKAHQAHCLIHQV-DEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDE-MKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNM--------------------------------NTHIKVIHKNGTEVLSQSQE--HLLNESNXXXXXXQKDPNR----------------FKKIASLAE-----TNQSPSDDAEIT-----------QYLWNEN---------PTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQ------LHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPT----ANSNNP-PDV---KPLIWNEL-LNQPIPIAEIDKRKLSNN------RLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            +KC IC   F ++   Q H   H+  D+   C+ CP  F  +  L  H   H  GE+            C +C+  F  V ++K H +  H K       E G       ++   +EE  +         AC+  K   +  S+L E MK      +S   R    +   +    +C  CGK F+ P  L RH   HTG + F+C  C K F QK +++ HM+ H   K   C FC  AF+ + N+                                NTHI  +H  G +  + S E  H+L  +       Q+   +                 +++  L+E     + QSP    +++           Q L N           P +  H      H  N D    S E     D ++  +     E  E++DK+  ++       L   I+++  G R   C +C K +RK  DL RHIRIHT +KPF+C  C ++F +KS L  H K+H  +K F C+ C K F+   +LKVH +LH   +  F C  CD++F T  H + H + SH +                  +  +    + KP       +N P PD+   +P++  +L L QPIP  +  +   +NN      R +KC +C ++YK   +L +H++ H +      C  C + FV+   ++ H+RT H   + F CL C   F T  SL RH  +H++ +PY CP C + FK  + C +H+
Sbjct:   39 HKCEICLLSFPKESQFQRHMRDHERNDKPHRCDQCPQTFNVEFNLTLHKCTHS-GED----------PTCPVCNKKFSRVASLKAH-IMLHEKEENLICSECGDEFTLQSQLAVHMEEHRQELAGTRQH-ACKACKKEFETSSELKEHMKTHYKIRVSST-RSYNRNIDRSGFTYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPHACAFCPAAFSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKMHMGGPQNSTSSTETAHVLTATLFQTLPLQQTEAQATSASSQPSSQAVSDVIQQLLELSEPAPVESGQSPQPGQQLSITVGINQDILQQALENSGLSSIPAAAHPNDSCHAKTSAPHAQNPDVSSVSNEQTDPTDAEQEKE----QESPEKLDKKEKKMIKKKSPFLPGSIREE-NGVRWHVCPYCAKEFRKPSDLVRHIRIHTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCMKSFSTSGSLKVHIRLHTGVR-PFACPHCDKKFRTSGHRKTHIA-SHFK-----------------HTELRKMRHQRKPAKVRVGKTNIPVPDIPLQEPILITDLGLIQPIPKNQFFQSYFNNNFVNEADRPYKCFYCHRAYKKSCHLKQHIRSH-TGEKPFKCSQCGRGFVSAGVLKAHIRT-HTGLKSFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHM 762          

HSP 2 Score: 128.257 bits (321), Expect = 9.308e-29
Identity = 95/333 (28.53%), Postives = 147/333 (44.14%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFR----CRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTG----FHLRYHYSTSHHRSIANPDP 2199
            C  C K FK    L++H  +HTG K ++C +C +GF     +K H   H  VK F C  C  +FT   ++  H+   H +    +   +     E        +K   R + + S      S + + E       E    E H     + +S  +    + E   +L   +  +   +SE V  +     + ++ E+   Q       +    C +C K ++K  DL RH+RIHT +KP++C  C KSF +KS L  H K+H   K FSC +C+  F+ K +LKVH +LH   K  F C  C+ RF T      H+++HY          PDP
Sbjct:  971 CDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCSVCNASFTTNGSLTRHM-ATHMS----MKPYKCPFCEEGFRTTVHCKKHMKRHQTVPSAV----SATGETEGGDICMEEE---EEHSDRNASRKSRPEVITFTEEETAQLAKIRPQESATVSEKV-LVQSAAEKDRISELRDKQAELQDEPKHANCCTYCPKSFKKPSDLVRHVRIHTGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAK-PFKCPHCELRFRTSGRRKTHMQFHY---------KPDP 1280          

HSP 3 Score: 122.479 bits (306), Expect = 5.537e-27
Identity = 91/327 (27.83%), Postives = 142/327 (43.43%), Query Frame = 1
Query: 1771 ERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLN----QPIPIAEIDKRKLSNNRLFK----------------------CNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            E +D +    Q  E  +DQ    R +RC +C K ++KS  L +H+R HT +KP++C +C + F    VLK+H K+H  +K FSC +CN  F    +L  H   H   K  + C  C+  F T  H + H     H+++  P                + E   +   A+  + P+V      E       +P   A + ++ L  +   K                      C +C KS+K    L  H++ H +      C  C KSF    ++  H++T H  ++ FSC  C   F TK SL  H  +H+ +KP+ CP C  RF+
Sbjct:  946 EELDLQAQGSQFLEDNEDQSR--RSYRCDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCSVCNASFTTNGSLTRHMATHMSMK-PYKCPFCEEGFRTTVHCKKHM--KRHQTV--PSAVSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQESATVSEKVLVQSAAEKDRISELRDKQAELQDEPKHANCCTYCPKSFKKPSDLVRHVRIH-TGEKPYKCDECGKSFTVKSTLDCHVKT-HTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCELRFR 1263          

HSP 4 Score: 98.9821 bits (245), Expect = 7.156e-20
Identity = 85/317 (26.81%), Postives = 136/317 (42.90%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKK------------IASLAETNQSPSDDAEITQYLWNENPTNENHFSY----------QPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH---EPDKLR 2100
            C +CG+ F +  +L+ HE THTG+K F C +C   FT   S+  HM  H ++K + C FC + F    +   H+K  H+     +S + E    +   +EEE+  D N  +K             A LA+    P + A +++ +  ++   ++  S           +P H +N  +Y P  ++F K              D+ R       +++H       TG + ++C  C K +     L  H++ HT QK F C++C  +F  K  LK H + H   K F C  C   F      K H Q H   +P K R
Sbjct:  999 CKLCGRGFVSSGVLKSHEKTHTGVKAFSCSVCNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTTVHCKKHMKR-HQTVPSAVSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIR--PQESATVSEKVLVQSAAEKDRISELRDKQAELQDEPKH-ANCCTYCP--KSFKK------------PSDLVR------HVRIH-------TGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCELRFRTSGRRKTHMQFHYKPDPKKAR 1284          

HSP 5 Score: 95.1301 bits (235), Expect = 1.137e-18
Identity = 42/109 (38.53%), Postives = 62/109 (56.88%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            R ++C +C++ Y+KSC L +HIR HT +KPF+C  C + F    VLK H ++H  LK F C ICN  F    +L+ H  +H  D   ++C  C + F T  + + H  T
Sbjct:  657 RPYKCFYCHRAYKKSCHLKQHIRSHTGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLICNGAFTTGGSLRRHMGIHN-DLRPYMCPYCQKTFKTSLNCKKHMKT 764          

HSP 6 Score: 82.4185 bits (202), Expect = 8.777e-15
Identity = 36/110 (32.73%), Postives = 60/110 (54.55%), Query Frame = 1
Query: 2371 NNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            + R ++C++C K +K   +L +H++ H +      C+ C + FV+   ++ H +T H   + FSC  C A F T  SL RH   H + KPY CP C   F+  ++C +H+
Sbjct:  965 SRRSYRCDYCNKGFKKSSHLKQHVRSH-TGEKPYKCKLCGRGFVSSGVLKSHEKT-HTGVKAFSCSVCNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTTVHCKKHM 1072          

HSP 7 Score: 72.7886 bits (177), Expect = 6.328e-12
Identity = 45/151 (29.80%), Postives = 71/151 (47.02%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHE-NDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKH 957
            CEIC + FP +  + +HM  HE ND+  +C  C  ++N E NL +H       +CT   +     +  C +C+  FSR  + +AH ++H+ +E L C  C   F  +  L  H+ +H+           T    CK C   FE    +K+H
Sbjct:   41 CEICLLSFPKESQFQRHMRDHERNDKPHRCDQCPQTFNVEFNLTLH-------KCTHSGE-----DPTCPVCNKKFSRVASLKAHIMLHEKEENLICSECGDEFTLQSQLAVHMEEHR------QELAGTRQHACKACKKEFETSSELKEH 173          

HSP 8 Score: 72.7886 bits (177), Expect = 6.328e-12
Identity = 32/78 (41.03%), Postives = 44/78 (56.41%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH 1458
            C  C KAF  P  L RH   HTG + F C +C+K F QKS++++HM  H   + + C +C   FT + NM  H+K  H
Sbjct: 1726 CDTCEKAFAKPSQLERHSRIHTGERPFHCTLCEKAFNQKSALQVHMKKHTGERPYKCAYCVMGFTQKSNMKLHMKRAH 1803          

HSP 9 Score: 69.707 bits (169), Expect = 5.112e-11
Identity = 31/77 (40.26%), Postives = 42/77 (54.55%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVH 2070
            R F+C  C K + K   L RH RIHT ++PF C +C K+F  KS L+ H K H   + + C  C   F  K  +K+H
Sbjct: 1722 RVFKCDTCEKAFAKPSQLERHSRIHTGERPFHCTLCEKAFNQKSALQVHMKKHTGERPYKCAYCVMGFTQKSNMKLH 1798          

HSP 10 Score: 69.3218 bits (168), Expect = 7.406e-11
Identity = 28/76 (36.84%), Postives = 46/76 (60.53%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            C+ CG+ F +  +L+ H  THTG+K F+C IC   FT   S++ HM +H++++ ++C +C K F    N   H+K 
Sbjct:  689 CSQCGRGFVSAGVLKAHIRTHTGLKSFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHMKT 764          

HSP 11 Score: 64.6994 bits (156), Expect = 1.686e-9
Identity = 34/111 (30.63%), Postives = 59/111 (53.15%), Query Frame = 1
Query: 3553 YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            +H C  C  +F+    LV H++  H   + F C  C +AF+ K +L AH KTH   ++F C  C+   + F +  SL  H+R+  +  +  + C HC+K ++T+    +H+
Sbjct:  483 WHVCPYCAKEFRKPSDLVRHIRI-HTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCM---KSFSTSGSLKVHIRL--HTGVRPFACPHCDKKFRTSGHRKTHI 587          

HSP 12 Score: 64.6994 bits (156), Expect = 1.881e-9
Identity = 39/109 (35.78%), Postives = 57/109 (52.29%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C   +K S  L +H++S H   + F C+ C + F +   L AH +TH   +SF C +   CN  F +  SL RH+ + HND L  Y C +C K +KT+     H+K
Sbjct:  661 CFYCHRAYKKSCHLKQHIRS-HTGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLI---CNGAFTTGGSLRRHMGI-HND-LRPYMCPYCQKTFKTSLNCKKHMK 763          

HSP 13 Score: 63.1586 bits (152), Expect = 5.863e-9
Identity = 36/110 (32.73%), Postives = 58/110 (52.73%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            C  C+  FK S  L +HV+S H   + + C +C + F +   L +H KTH   ++F C V   CN  F +  SL+RH  M  + ++  Y+C  C + ++TT     H+K+
Sbjct:  971 CDYCNKGFKKSSHLKQHVRS-HTGEKPYKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCSV---CNASFTTNGSLTRH--MATHMSMKPYKCPFCEEGFRTTVHCKKHMKR 1074          

HSP 14 Score: 61.6178 bits (148), Expect = 1.874e-8
Identity = 37/125 (29.60%), Postives = 60/125 (48.00%), Query Frame = 1
Query: 1825 QVTGFRRFR-CRFCYKLYRKSCDLTRHIRIH------TQQKP--FQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            +V G  R   C  C K ++++  L  H++ H      + QKP  F+C  C K+F   S L+ H + H   + F C +C K FN K  L+VH + H  ++  + C  C   F    +++ H   +H
Sbjct: 1680 EVHGRERIHGCPVCRKAFKRATHLKEHMQTHQAGPSLSSQKPRVFKCDTCEKAFAKPSQLERHSRIHTGERPFHCTLCEKAFNQKSALQVHMKKHTGER-PYKCAYCVMGFTQKSNMKLHMKRAH 1803          

HSP 15 Score: 58.151 bits (139), Expect = 1.660e-7
Identity = 29/85 (34.12%), Postives = 43/85 (50.59%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIF----NLKQTLKVHR 2073
            TG + F+C  C + +  +  L  HIR HT  K F+C +C+ +F     L+ H   H  L+ + C  C K F    N K+ +K HR
Sbjct:  682 TGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHR 766          

HSP 16 Score: 57.3806 bits (137), Expect = 2.798e-7
Identity = 33/109 (30.28%), Postives = 54/109 (49.54%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C   FK    LV HV+  H   + + C+ C K+F+ K +L  H KTH   + F C V   C+  F +  SL  H+R+  +     ++C HC   ++T+    +H++
Sbjct: 1171 CTYCPKSFKKPSDLVRHVRI-HTGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHV---CSNAFSTKGSLKVHMRL--HTGAKPFKCPHCELRFRTSGRRKTHMQ 1273          

HSP 17 Score: 57.3806 bits (137), Expect = 2.821e-7
Identity = 65/253 (25.69%), Postives = 96/253 (37.94%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSV----HCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKP---IKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQL---IQYNCAQCNIMFAQESSYVNHQKSVH 4965
            P+ C  C + FN   NL  H   H+   P  CP C K+F    SLK H          +         L+SQ+A+  H++ H +E +      CK C K F+   +L  H+   +    S           +G   S P     +  +  QKP    + +     ++  KC  C   FN K     H  +    EK H    C   F        HVQ VH+++     YNC +C+ +F    S   H   +H
Sbjct:   67 PHRCDQCPQTFNVEFNLTLHKCTHSGEDPT-CPVCNKKFSRVASLKAHIMLHEKEENLICSECGDEFTLQSQLAV--HMEEHRQELAGTRQHACKACKKEFETSSELKEHMKTHYKIRVSSTRSYNRNIDRSGFTYSCP-----HCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHM-IKHTGEKPHACAFCPAAFSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKMH 310          

HSP 18 Score: 57.3806 bits (137), Expect = 3.044e-7
Identity = 69/257 (26.85%), Postives = 109/257 (42.41%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIP---EIPKKLIK-------CLSCSFIFNTKAKYD-----NHFCVGLKAEKSHLNRC--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            Y C  C+KGF ++S+L+QH+  HT  +PY+C  C + F     LK+HE T H+ V K   C +C     +  +L  H+  H+      C  C +GF       +H+ ++H    S +     G    G++        H      +K   EVI    E   +L K        +S   +  + A+ D           L+ E  H N C  C K+F+  S  + HV+ +H     Y C +C   F  +S+   H K+
Sbjct:  969 YRCDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRGFVSSGVLKSHEKT-HTGV-KAFSCSVCNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTTVHCKKHM-KRHQTVPSAVSAT--GETEGGDI-CMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQESATVSEKVLVQSAAEKDRISELRDKQAELQDEPKHANCCTYCPKSFKKPSDLVRHVR-IHTGEKPYKCDECGKSFTVKSTLDCHVKT 1218          

HSP 19 Score: 57.3806 bits (137), Expect = 3.069e-7
Identity = 36/117 (30.77%), Postives = 48/117 (41.03%), Query Frame = 1
Query: 3556 HGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTH-----IDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            H C  CD  F  +  L+ H K  H   R   C VC KAF     L  H +TH     + S+    F C  C + F     L RH R+   +    + CT C K +     L  H+K+
Sbjct: 1659 HQCLECDRAFSSAAVLMHHSKEVHGRERIHGCPVCRKAFKRATHLKEHMQTHQAGPSLSSQKPRVFKCDTCEKAFAKPSQLERHSRIHTGE--RPFHCTLCEKAFNQKSALQVHMKK 1773          

HSP 20 Score: 52.7582 bits (125), Expect = 8.120e-6
Identity = 40/158 (25.32%), Postives = 61/158 (38.61%), Query Frame = 1
Query: 3556 HGCANCDHQFKDSQSLVEHVKSQHKIR-------------------------------------------RDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHND--NLNLYRCTHCNKVYKTTRELDSHVKQL 3894
            H C  C  +F+ S  L EH+K+ +KIR                                           R F C+ C KAF+ K +L  H   H   +   C  C A    F    +L  HV+  H++  N   Y CT C+ V+K+   L++H+ ++
Sbjct:  155 HACKACKKEFETSSELKEHMKTHYKIRVSSTRSYNRNIDRSGFTYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPHACAFCPAA---FSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKM 309          
BLAST of Zinc finger, C2H2 type vs. Ensembl Human
Match: ZNF236 (zinc finger protein 236 [Source:HGNC Symbol;Acc:HGNC:13028])

HSP 1 Score: 211.075 bits (536), Expect = 5.118e-54
Identity = 204/764 (26.70%), Postives = 319/764 (41.75%), Query Frame = 1
Query:  703 YKCVICSCLFSRKKAHQAHCLIHQV-DEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDE-MKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNM--------------------------------NTHIKVIHKNGTEVLSQSQE--HLLNESNXXXXXXQKDPNR----------------FKKIASLAE-----TNQSPSDDAEIT-----------QYLWNEN---------PTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQ------LHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPT----ANSNNP-PDV---KPLIWNEL-LNQPIPIAEIDKRKLSNN------RLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            +KC IC   F ++   Q H   H+  D+   C+ CP  F  +  L  H   H  GE+            C +C+  F  V ++K H +  H K       E G       ++   +EE  +         AC+  K   +  S+L E MK      +S   R    +   +    +C  CGK F+ P  L RH   HTG + F+C  C K F QK +++ HM+ H   K   C FC  AF+ + N+                                NTHI  +H  G +  + S E  H+L  +       Q+   +                 +++  L+E     + QSP    +++           Q L N           P +  H      H  N D    S E     D ++  +     E  E++DK+  ++       L   I+++  G R   C +C K +RK  DL RHIRIHT +KPF+C  C ++F +KS L  H K+H  +K F C+ C K F+   +LKVH +LH   +  F C  CD++F T  H + H + SH +                  +  +    + KP       +N P PD+   +P++  +L L QPIP  +  +   +NN      R +KC +C ++YK   +L +H++ H +      C  C + FV+   ++ H+RT H   + F CL C   F T  SL RH  +H++ +PY CP C + FK  + C +H+
Sbjct:   37 HKCEICLLSFPKESQFQRHMRDHERNDKPHRCDQCPQTFNVEFNLTLHKCTHS-GED----------PTCPVCNKKFSRVASLKAH-IMLHEKEENLICSECGDEFTLQSQLAVHMEEHRQELAGTRQH-ACKACKKEFETSSELKEHMKTHYKIRVSST-RSYNRNIDRSGFTYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPHACAFCPAAFSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKMHMGGPQNSTSSTETAHVLTATLFQTLPLQQTEAQATSASSQPSSQAVSDVIQQLLELSEPAPVESGQSPQPGQQLSITVGINQDILQQALENSGLSSIPAAAHPNDSCHAKTSAPHAQNPDVSSVSNEQTDPTDAEQEKE----QESPEKLDKKEKKMIKKKSPFLPGSIREE-NGVRWHVCPYCAKEFRKPSDLVRHIRIHTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCMKSFSTSGSLKVHIRLHTGVR-PFACPHCDKKFRTSGHRKTHIA-SHFK-----------------HTELRKMRHQRKPAKVRVGKTNIPVPDIPLQEPILITDLGLIQPIPKNQFFQSYFNNNFVNEADRPYKCFYCHRAYKKSCHLKQHIRSH-TGEKPFKCSQCGRGFVSAGVLKAHIRT-HTGLKSFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHM 760          

HSP 2 Score: 127.872 bits (320), Expect = 1.030e-28
Identity = 95/333 (28.53%), Postives = 147/333 (44.14%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFR----CRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTG----FHLRYHYSTSHHRSIANPDP 2199
            C  C K FK    L++H  +HTG K ++C +C +GF     +K H   H  VK F C  C  +FT   ++  H+   H +    +   +     E        +K   R + + S      S + + E       E    E H     + +S  +    + E   +L   +  +   +SE V  +     + ++ E+   Q       +    C +C K ++K  DL RH+RIHT +KP++C  C KSF +KS L  H K+H   K FSC +C+  F+ K +LKVH +LH   K  F C  C+ RF T      H+++HY          PDP
Sbjct:  969 CDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCSVCNASFTTNGSLTRHM-ATHMS----MKPYKCPFCEEGFRTTVHCKKHMKRHQTVPSAV----SATGETEGGDICMEEE---EEHSDRNASRKSRPEVITFTEEETAQLAKIRPQESATVSEKV-LVQSAAEKDRISELRDKQAELQDEPKHANCCTYCPKSFKKPSDLVRHVRIHTGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAK-PFKCPHCELRFRTSGRRKTHMQFHY---------KPDP 1278          

HSP 3 Score: 122.479 bits (306), Expect = 4.835e-27
Identity = 91/327 (27.83%), Postives = 142/327 (43.43%), Query Frame = 1
Query: 1771 ERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLN----QPIPIAEIDKRKLSNNRLFK----------------------CNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            E +D +    Q  E  +DQ    R +RC +C K ++KS  L +H+R HT +KP++C +C + F    VLK+H K+H  +K FSC +CN  F    +L  H   H   K  + C  C+  F T  H + H     H+++  P                + E   +   A+  + P+V      E       +P   A + ++ L  +   K                      C +C KS+K    L  H++ H +      C  C KSF    ++  H++T H  ++ FSC  C   F TK SL  H  +H+ +KP+ CP C  RF+
Sbjct:  944 EELDLQAQGSQFLEDNEDQSR--RSYRCDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCSVCNASFTTNGSLTRHMATHMSMK-PYKCPFCEEGFRTTVHCKKHM--KRHQTV--PSAVSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQESATVSEKVLVQSAAEKDRISELRDKQAELQDEPKHANCCTYCPKSFKKPSDLVRHVRIH-TGEKPYKCDECGKSFTVKSTLDCHVKT-HTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCELRFR 1261          

HSP 4 Score: 98.9821 bits (245), Expect = 6.687e-20
Identity = 85/317 (26.81%), Postives = 136/317 (42.90%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKK------------IASLAETNQSPSDDAEITQYLWNENPTNENHFSY----------QPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH---EPDKLR 2100
            C +CG+ F +  +L+ HE THTG+K F C +C   FT   S+  HM  H ++K + C FC + F    +   H+K  H+     +S + E    +   +EEE+  D N  +K             A LA+    P + A +++ +  ++   ++  S           +P H +N  +Y P  ++F K              D+ R       +++H       TG + ++C  C K +     L  H++ HT QK F C++C  +F  K  LK H + H   K F C  C   F      K H Q H   +P K R
Sbjct:  997 CKLCGRGFVSSGVLKSHEKTHTGVKAFSCSVCNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTTVHCKKHMKR-HQTVPSAVSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIR--PQESATVSEKVLVQSAAEKDRISELRDKQAELQDEPKH-ANCCTYCP--KSFKK------------PSDLVR------HVRIH-------TGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCELRFRTSGRRKTHMQFHYKPDPKKAR 1282          

HSP 5 Score: 94.7449 bits (234), Expect = 1.301e-18
Identity = 42/109 (38.53%), Postives = 62/109 (56.88%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            R ++C +C++ Y+KSC L +HIR HT +KPF+C  C + F    VLK H ++H  LK F C ICN  F    +L+ H  +H  D   ++C  C + F T  + + H  T
Sbjct:  655 RPYKCFYCHRAYKKSCHLKQHIRSHTGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLICNGAFTTGGSLRRHMGIHN-DLRPYMCPYCQKTFKTSLNCKKHMKT 762          

HSP 6 Score: 82.0333 bits (201), Expect = 9.230e-15
Identity = 36/110 (32.73%), Postives = 60/110 (54.55%), Query Frame = 1
Query: 2371 NNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            + R ++C++C K +K   +L +H++ H +      C+ C + FV+   ++ H +T H   + FSC  C A F T  SL RH   H + KPY CP C   F+  ++C +H+
Sbjct:  963 SRRSYRCDYCNKGFKKSSHLKQHVRSH-TGEKPYKCKLCGRGFVSSGVLKSHEKT-HTGVKAFSCSVCNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTTVHCKKHM 1070          

HSP 7 Score: 72.7886 bits (177), Expect = 7.059e-12
Identity = 32/78 (41.03%), Postives = 44/78 (56.41%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH 1458
            C  C KAF  P  L RH   HTG + F C +C+K F QKS++++HM  H   + + C +C   FT + NM  H+K  H
Sbjct: 1724 CDTCEKAFAKPSQLERHSRIHTGERPFHCTLCEKAFNQKSALQVHMKKHTGERPYKCAYCVMGFTQKSNMKLHMKRAH 1801          

HSP 8 Score: 72.4034 bits (176), Expect = 8.010e-12
Identity = 45/151 (29.80%), Postives = 70/151 (46.36%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHE-NDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKH 957
            CEIC + FP +  + +HM  HE ND+  +C  C  ++N E NL +H    H+ E           +  C +C+  FSR  + +AH ++H+ +E L C  C   F  +  L  H+ +H+           T    CK C   FE    +K+H
Sbjct:   39 CEICLLSFPKESQFQRHMRDHERNDKPHRCDQCPQTFNVEFNLTLH-KCTHSGE-----------DPTCPVCNKKFSRVASLKAHIMLHEKEENLICSECGDEFTLQSQLAVHMEEHR------QELAGTRQHACKACKKEFETSSELKEH 171          

HSP 9 Score: 69.707 bits (169), Expect = 5.800e-11
Identity = 31/77 (40.26%), Postives = 42/77 (54.55%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVH 2070
            R F+C  C K + K   L RH RIHT ++PF C +C K+F  KS L+ H K H   + + C  C   F  K  +K+H
Sbjct: 1720 RVFKCDTCEKAFAKPSQLERHSRIHTGERPFHCTLCEKAFNQKSALQVHMKKHTGERPYKCAYCVMGFTQKSNMKLH 1796          

HSP 10 Score: 69.3218 bits (168), Expect = 7.921e-11
Identity = 28/76 (36.84%), Postives = 46/76 (60.53%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            C+ CG+ F +  +L+ H  THTG+K F+C IC   FT   S++ HM +H++++ ++C +C K F    N   H+K 
Sbjct:  687 CSQCGRGFVSAGVLKAHIRTHTGLKSFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHMKT 762          

HSP 11 Score: 64.6994 bits (156), Expect = 1.864e-9
Identity = 34/111 (30.63%), Postives = 59/111 (53.15%), Query Frame = 1
Query: 3553 YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            +H C  C  +F+    LV H++  H   + F C  C +AF+ K +L AH KTH   ++F C  C+   + F +  SL  H+R+  +  +  + C HC+K ++T+    +H+
Sbjct:  481 WHVCPYCAKEFRKPSDLVRHIRI-HTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCM---KSFSTSGSLKVHIRL--HTGVRPFACPHCDKKFRTSGHRKTHI 585          

HSP 12 Score: 64.6994 bits (156), Expect = 2.028e-9
Identity = 39/109 (35.78%), Postives = 57/109 (52.29%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C   +K S  L +H++S H   + F C+ C + F +   L AH +TH   +SF C +   CN  F +  SL RH+ + HND L  Y C +C K +KT+     H+K
Sbjct:  659 CFYCHRAYKKSCHLKQHIRS-HTGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLI---CNGAFTTGGSLRRHMGI-HND-LRPYMCPYCQKTFKTSLNCKKHMK 761          

HSP 13 Score: 62.7734 bits (151), Expect = 6.431e-9
Identity = 36/110 (32.73%), Postives = 58/110 (52.73%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            C  C+  FK S  L +HV+S H   + + C +C + F +   L +H KTH   ++F C V   CN  F +  SL+RH  M  + ++  Y+C  C + ++TT     H+K+
Sbjct:  969 CDYCNKGFKKSSHLKQHVRS-HTGEKPYKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCSV---CNASFTTNGSLTRH--MATHMSMKPYKCPFCEEGFRTTVHCKKHMKR 1072          

HSP 14 Score: 61.2326 bits (147), Expect = 2.144e-8
Identity = 37/125 (29.60%), Postives = 60/125 (48.00%), Query Frame = 1
Query: 1825 QVTGFRRFR-CRFCYKLYRKSCDLTRHIRIH------TQQKP--FQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            +V G  R   C  C K ++++  L  H++ H      + QKP  F+C  C K+F   S L+ H + H   + F C +C K FN K  L+VH + H  ++  + C  C   F    +++ H   +H
Sbjct: 1678 EVHGRERIHGCPVCRKAFKRATHLKEHMQTHQAGPSLSSQKPRVFKCDTCEKAFAKPSQLERHSRIHTGERPFHCTLCEKAFNQKSALQVHMKKHTGER-PYKCAYCVMGFTQKSNMKLHMKRAH 1801          

HSP 15 Score: 58.151 bits (139), Expect = 1.760e-7
Identity = 29/85 (34.12%), Postives = 43/85 (50.59%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIF----NLKQTLKVHR 2073
            TG + F+C  C + +  +  L  HIR HT  K F+C +C+ +F     L+ H   H  L+ + C  C K F    N K+ +K HR
Sbjct:  680 TGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHR 764          

HSP 16 Score: 57.7658 bits (138), Expect = 2.424e-7
Identity = 65/253 (25.69%), Postives = 96/253 (37.94%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSV----HCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKP---IKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQL---IQYNCAQCNIMFAQESSYVNHQKSVH 4965
            P+ C  C + FN   NL  H   H+   P  CP C K+F    SLK H          +         L+SQ+A+  H++ H +E +      CK C K F+   +L  H+   +    S           +G   S P     +  +  QKP    + +     ++  KC  C   FN K     H  +    EK H    C   F        HVQ VH+++     YNC +C+ +F    S   H   +H
Sbjct:   65 PHRCDQCPQTFNVEFNLTLHKCTHSGEDPT-CPVCNKKFSRVASLKAHIMLHEKEENLICSECGDEFTLQSQLAV--HMEEHRQELAGTRQHACKACKKEFETSSELKEHMKTHYKIRVSSTRSYNRNIDRSGFTYSCP-----HCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHM-IKHTGEKPHACAFCPAAFSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKMH 308          

HSP 17 Score: 57.3806 bits (137), Expect = 3.069e-7
Identity = 33/109 (30.28%), Postives = 54/109 (49.54%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C   FK    LV HV+  H   + + C+ C K+F+ K +L  H KTH   + F C V   C+  F +  SL  H+R+  +     ++C HC   ++T+    +H++
Sbjct: 1169 CTYCPKSFKKPSDLVRHVRI-HTGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHV---CSNAFSTKGSLKVHMRL--HTGAKPFKCPHCELRFRTSGRRKTHMQ 1271          

HSP 18 Score: 57.3806 bits (137), Expect = 3.367e-7
Identity = 36/117 (30.77%), Postives = 48/117 (41.03%), Query Frame = 1
Query: 3556 HGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTH-----IDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            H C  CD  F  +  L+ H K  H   R   C VC KAF     L  H +TH     + S+    F C  C + F     L RH R+   +    + CT C K +     L  H+K+
Sbjct: 1657 HQCLECDRAFSSAAVLMHHSKEVHGRERIHGCPVCRKAFKRATHLKEHMQTHQAGPSLSSQKPRVFKCDTCEKAFAKPSQLERHSRIHTGE--RPFHCTLCEKAFNQKSALQVHMKK 1771          

HSP 19 Score: 57.3806 bits (137), Expect = 3.395e-7
Identity = 69/257 (26.85%), Postives = 109/257 (42.41%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIP---EIPKKLIK-------CLSCSFIFNTKAKYD-----NHFCVGLKAEKSHLNRC--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            Y C  C+KGF ++S+L+QH+  HT  +PY+C  C + F     LK+HE T H+ V K   C +C     +  +L  H+  H+      C  C +GF       +H+ ++H    S +     G    G++        H      +K   EVI    E   +L K        +S   +  + A+ D           L+ E  H N C  C K+F+  S  + HV+ +H     Y C +C   F  +S+   H K+
Sbjct:  967 YRCDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRGFVSSGVLKSHEKT-HTGV-KAFSCSVCNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTTVHCKKHM-KRHQTVPSAVSAT--GETEGGDI-CMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQESATVSEKVLVQSAAEKDRISELRDKQAELQDEPKHANCCTYCPKSFKKPSDLVRHVR-IHTGEKPYKCDECGKSFTVKSTLDCHVKT 1216          

HSP 20 Score: 52.7582 bits (125), Expect = 9.212e-6
Identity = 40/158 (25.32%), Postives = 61/158 (38.61%), Query Frame = 1
Query: 3556 HGCANCDHQFKDSQSLVEHVKSQHKIR-------------------------------------------RDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHND--NLNLYRCTHCNKVYKTTRELDSHVKQL 3894
            H C  C  +F+ S  L EH+K+ +KIR                                           R F C+ C KAF+ K +L  H   H   +   C  C A    F    +L  HV+  H++  N   Y CT C+ V+K+   L++H+ ++
Sbjct:  153 HACKACKKEFETSSELKEHMKTHYKIRVSSTRSYNRNIDRSGFTYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPHACAFCPAA---FSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKM 307          
BLAST of Zinc finger, C2H2 type vs. Ensembl Human
Match: ZNF91 (zinc finger protein 91 [Source:HGNC Symbol;Acc:HGNC:13166])

HSP 1 Score: 175.637 bits (444), Expect = 1.927e-43
Identity = 179/753 (23.77%), Postives = 281/753 (37.32%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNE----CTVVNDSNQEMN--------------YKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKN----GTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            CE C   F    T  KH  IH  ++ +KC  C  +++    L  H  I HT E    C   + + + ++              YKC  C   F+R      H  IH  ++   CE C   F     L KH   H                KCK C   F     + +H             I  G      E       +     K K      +  K    G++    +  + ++ I  R +P K           C  CGKAFK    L  H++ H G K ++C  C K F   SS+  H ++H   K + C+ CGKAF +   +  H K IH        E   ++  H    +        + P + K+    A +N S   + +IT            H   +P      D          K     + + +   E+  +    +  + +H+ I    TG + ++C  C K +  S  LT+H RIHT++KPF+C  C K+F   S L  H + H   K + CE C K F+   TL  H+ +H  +K  + CK C + F     L  H        +   +          + +  +    K KP   S +    K  IW+  L +        KR  +  + +KC  CGK++    +L  H + H +      C+ C K+F    ++  H +  H   + + C +C   F   ++L  H ++H+  KPY C  C + F       RH 
Sbjct:  324 CEECGKAFSRSSTLAKHKRIHTGEKPYKCKECGKAFSNSSTLANH-KITHTEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFH----------TREKPFKCKECGKAFIWSSTLTRHKR-----------IHTGEKPYKCEECGKAFRQSSTLTKHKIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHSREKPYK-----------CKECGKAFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTHKIIHTGEKSYKCEECGKAFLWSSTLRRH-KRIHTGEKPYKCEECGKAFSHSSALAKHKRIHTGEKPYKCKECGK-AFSNSSTLANHKIT------------HTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIH---TGEKPYKCEECGKAFNWSSSLTKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIHTGEKP-YKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKP---SKSEECDKAFIWSSTLTE-------HKRIHTREKTYKCEECGKAFSQPSHLTTHKRMH-TGEKPYKCEECGKAFSQSSTLTTH-KIIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHT 1013          

HSP 2 Score: 152.525 bits (384), Expect = 2.275e-36
Identity = 175/721 (24.27%), Postives = 273/721 (37.86%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            CE C   F    T  +H  IH  ++ +KC  C  ++++   L  H   IHT E            YKC  C   FSR      H  IH  ++   C+ C   F     L  H   H                KCK C   F+ +  + KH +           I  G  +   E               K      +  K    G++         ++    R +P             C  CGKAF     L RH+  HTG K ++C  C K F Q S++  H ++H   K +  + CGKAF     +N H K+IH       S+ + +   E              FK+ ++L  T++      ++  Y   E     NH S    H+      I + E   K   ++  +  L S  + R          H+ I    TG + ++C  C K +  S  L +H RIHT +KP++C  C K+F   S L NH  +H + K + C+ C+K F    TL  H+ +H  +KL + C+ C + FN   +L        H+ I   +                      KP          K   W+  L +        KR  +  + FKC  CGK++ +   L  H + H +      C+ C K+F    ++ +H +T H   + + C +C   F   ++L +H ++H+  K Y C  C + F
Sbjct:  268 CEECGKAFLWSSTLTRHKRIHTGEKPYKCEECGKAFSHSSTLAKH-KRIHTGE----------KPYKCEECGKAFSRSSTLAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITH----------TEEKPYKCKECDKAFKRLSTLTKHKI-----------IHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFHTREKP-----------FKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLTKHKIIHTGEKPYKFEECGKAFRQSLTLNKH-KIIH-------SREKPYKCKECGKA----------FKQFSTLT-THKIIHAGKKL--YKCEECGKAFNHSSSLSTHK-----IIHTGEKSYKC--EECGKAFLWSSTLRR----------HKRIH---TGEKPYKCEECGKAFSHSSALAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKL-YKCEECGKAFNRSSNLTI------HKFIHTGE----------------------KPYKCEECG---KAFNWSSSLTK-------HKRIHTREKPFKCKECGKAFIWSSTLTRHKRIH-TGEKPYKCEECGKAFSRSSTLTKH-KTIHTGEKPYKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAF 863          

HSP 3 Score: 139.813 bits (351), Expect = 2.013e-32
Identity = 168/756 (22.22%), Postives = 284/756 (37.57%), Query Frame = 1
Query:  469 TVYKTIN-GTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAV-----------------CGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQ-YLWNENPTNEN--HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            T++K I+ G     CE C   F    +  KH   H  ++ FKC  C  ++ +   L  H   IHT E            YKC  C   F +      H +IH  ++    E C   F+  + L+KH   H                KCK C   F+    +  H +           I  G  +   E            +  K      ++ K    G++ L       ++ I    +P K +      + + A+                 CGKAF     L  H++THT  K ++C  C K F + S++  H ++H   K + C+ CGKAF    N+  H K IH        +      N S+           + K+I     T + P    E  + ++W+   T     H   +P            +    K     + +     ++  +  K +  +  H++I     G + ++C  C K + +S +LT H  IHT++KP +   C K+F   S L  H + H + K + CE C K F+    L  H+++H  +K  + C+ C + F+    L  H        I +    P++         +     ++K       P   +     +  +Q   +     R  +  + +KC  CGK++     L  H   H +      C+ C K+F++  ++  H R  H   + + C +C   F   ++L RH  +H+  KPY C  C + FK
Sbjct:  422 TIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFHTREKPFKCKECGKAFIWSSTLTRH-KRIHTGE----------KPYKCEECGKAFRQSSTLTKHKIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHS----------REKPYKCKECGKAFKQFSTLTTHKI-----------IHAGKKLYKCEECGKAFNHSSSLSTHKIIHTGEKSYKCEECGKAFLWSSTLRRHKRIHTGEKPYKCEECGKAFSHSSALAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIH-KFIHTGEKPYKCEECGKAFNWSSSL--------TKHKRI----HTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALAKHKIIH---AGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKP-YKCEECGKAFSQSSTLTTH-------KIIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEEC--GKAFSQSSTLTR-HTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIH-TGEKPYKCEECGKAFISSSTLNGHKRI-HTREKPYKCEECGKAFSQSSTLTRHKRLHTGEKPYKCGECGKAFK 1116          

HSP 4 Score: 135.576 bits (340), Expect = 4.292e-31
Identity = 177/774 (22.87%), Postives = 281/774 (36.30%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNE----CTVVNDS--------------NQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGE------ECDD---RKLTTNY----------LKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQE--HLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYL-WNENPTNEN--HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            C+ C+  F    T  KH  IH  ++ +KC  C  ++N   NL +H   IHT E    C     +               +E  +KC  C   F        H  IH  ++   CE C   F+    L KH   H  GE      EC     + LT N            KCK C   F+    +  H +           I  G  +   E            +  K      ++ K    G++ L       ++ I    +P K           C  CGKAF     L +H+  HTG K ++C  C K F+  S++  H + H   K + C+ C K F     +  H K+IH    E L + +E     N S++              I     T + P    E  +   W+ + T     H   +P            +    +     + +     E+  +    +  +  H+ I    TG + ++C+ C K ++ S  L +H  IH  +K ++C  C K+F   S L  H   H K K    E C+K F    TL  H+++H  +K  + C+ C + F+   HL     T+H R      P   +             + K   T         KP    E        + + + K+  +  + +KC  CGK++     L  H + H +      C+ C K+F     +  H +  H   + + C +C   FI+ ++L  H  +H+  KPY C  C + F       RH
Sbjct:  380 CKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIH-KFIHTGEKPYKCEECGKAFNWSSSLTKHKRFHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLTKHKIIH-TGEKPYKFEECGKAFRQSLTLNKHKIIHSREKPYKCKECGKAFKQFSTLTTHKI-----------IHAGKKLYKCEECGKAFNHSSSLSTHKIIHTGEKSYKCEECGKAFLWSSTLRRHKRIHTGEKPYK-----------CEECGKAFSHSSALAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKH-KIIHAG--EKLYKCEECGKAFNRSSNLT------------IHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIH---TGEKPYKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHKRIHTREKT-YKCEECGKAFSQPSHL-----TTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGE-------KPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMH-TGEKPYKCEECGKAFNRSSKLTTH-KIIHTGEKPYKCEECGKAFISSSTLNGHKRIHTREKPYKCEECGKAFSQSSTLTRH 1096          

HSP 5 Score: 105.916 bits (263), Expect = 4.531e-22
Identity = 128/530 (24.15%), Postives = 205/530 (38.68%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYL---WNENP--TNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH 2082
            C+ C+  F    T  KH  IH  ++ +KC  C  ++N   NL +H   IHT E            YKC  C   F+   +   H  IH  ++   C+ C   F     L +H   H  GE+           KC+ C   F     + KH             I  G      +      +      K K      +  K    G++         ++ I  + +P K++            C KAF     L  H+  HT  K ++C  C K F+Q S +  H  +H   K + C+ CGKAF+    + TH K+IH        +       +S+   E   K  +  +K     E  ++ S  + +T++      E P    E   ++  + +  T   I + E   K +  +  +  + S  +       G  ++H       T  + ++C  C K + +S  LTRH R+HT +KP++C  C K+F+  S L  H   H   K + CE C K FN    L  H+++H
Sbjct:  688 CKECDKTFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIH-KFIHTGE----------KPYKCEECGKAFNWSSSLTKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIH-TGEK---------PYKCEECGKAFSRSSTLTKHKT-----------IHTGEKPYKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEE-----------CDKAFIWSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTH-KIIHTGEKPYKCEECGKAFRKSSTLTE--HKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIHTGEKPYKCE--ECGKAFISSSTL------NGHKRIH-------TREKPYKCEECGKAFSQSSTLTRHKRLHTGEKPYKCGECGKAFKESSALTKHKIIHTGEKPYKCEKCGKAFNQSSILTNHKKIH 1156          

HSP 6 Score: 104.76 bits (260), Expect = 1.030e-21
Identity = 82/308 (26.62%), Postives = 131/308 (42.53%), Query Frame = 1
Query: 1762 EDVERIDKETGQIQLHEMI--KDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            E+  +  K+   +  H++I  K+++     ++C  C K +  S  LTRH RIHT +KP++C  C K+F   S L  H + H   K + CE C K F+   TL  H+++H  +K  + CK C + F+    L  H  T                                          + KP    E       ++ + K K+  +  +L+KC  CGK++     L  H   H +      C+ C K+F    S+ +H R  H   + F C +C   FI  ++L RH  +H+  KPY C  C + F+
Sbjct:  241 EECGKAFKQLSTLTTHKIICAKEKI-----YKCEECGKAFLWSSTLTRHKRIHTGEKPYKCEECGKAFSHSSTLAKHKRIHTGEKPYKCEECGKAFSRSSTLAKHKRIHTGEKP-YKCKECGKAFSNSSTLANHKITH----------------------------------------TEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIH-TGEKPYKCEECGKAFNWSSSLTKHKRF-HTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFR 500          

HSP 7 Score: 99.3673 bits (246), Expect = 4.738e-20
Identity = 76/281 (27.05%), Postives = 123/281 (43.77%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            TG + ++C  C K + +S  L +H RIHT +KP++C  C K+F   S L NH  +H + K + C+ C+K F    TL  H+ +H  +KL + C+ C + FN   +L        H+ I   +                      KP          K   W+  L +        KR  +  + FKC  CGK++ +   L  H + H +      C+ C K+F    ++ +H +  H   + +   +C   F    +L +H ++HS  KPY C  C + FK
Sbjct:  317 TGEKPYKCEECGKAFSRSSTLAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKL-YKCEECGKAFNRSSNLTI------HKFIHTGE----------------------KPYKCEECG---KAFNWSSSLTK-------HKRFHTREKPFKCKECGKAFIWSSTLTRHKRIH-TGEKPYKCEECGKAFRQSSTLTKH-KIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHSREKPYKCKECGKAFK 556          

HSP 8 Score: 92.0485 bits (227), Expect = 6.995e-18
Identity = 76/321 (23.68%), Postives = 133/321 (41.43%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGT-------EVLSQSQE---HLLNESNXXXXXXQKDPNRFKKIASLA-----ETNQSPSDDAEITQYLWNENPTNEN---HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFN 2133
            C  CGKAFK    L +H++ H G K ++C  C K F Q S++  H ++H   K    + C KAF +   +  H ++  +  T       +  SQ      H    + +   + ++    F + ++L       T + P    E  +     +   E+   H   +P            +    +     + +     E+  +    + ++  H++I    TG + ++C  C K +  S  L  H RIHT++KP++C  C K+F   S L  H + H   K + C  C K F     L  H+ +H  +K  + C+ C + FN
Sbjct:  828 CKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIH---TGEKPYKCEECGKAFISSSTLNGHKRIHTREKPYKCEECGKAFSQSSTLTRHKRLHTGEKPYKCGECGKAFKESSALTKHKIIHTGEKP-YKCEKCGKAFN 1144          

HSP 9 Score: 70.8626 bits (172), Expect = 2.333e-11
Identity = 65/271 (23.99%), Postives = 114/271 (42.07%), Query Frame = 1
Query: 1858 FCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            FC +L++     T+H  ++  +K  +C  C K+F   S L NH + H + K + CE C K F    TL  H+ +   +K+ + C+ C + F     L     T H R      P  ++               K+K       P   +     +  ++   +A+  KR  +  + +KC  CGK++     L  H   H +      C+ C+K+F    ++ +H +  H   + + C +C   F   ++L  H  +H+  KPY C  C + F
Sbjct:  191 FCIRLHK-----TQHKCVYITEKSCKCKECEKTFHWSSTLTNHKEIHTEDKPYKCEECGKAFKQLSTLTTHKIICAKEKI-YKCEECGKAF-----LWSSTLTRHKRIHTGEKP--YKCEECGKAFSHSSTLAKHKRIHTGEKPYKCEEC--GKAFSRSSTLAK-HKRIHTGEKPYKCKECGKAFSNSSTLANHKITH-TEEKPYKCKECDKAFKRLSTLTKH-KIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAF 443          

HSP 10 Score: 68.9366 bits (167), Expect = 9.094e-11
Identity = 66/246 (26.83%), Postives = 95/246 (38.62%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQV---ALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            Y C  C K FNR+SNL  H  +HT  +PY+C +C K F    SL     TKH  +    +   C +  ++ +    L  H ++H  E    C+ C K F     L++    H  EK      C +        A                      K  I    +KL KC  C   FN  +    H  +  K EK   +  CDK F  +S    H + +H +   Y C +C   F+Q S    H++
Sbjct:  714 YKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSL-----TKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALA----------------------KHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTK-EKPSKSEECDKAFIWSSTLTEH-KRIHTREKTYKCEECGKAFSQPSHLTTHKR 930          

HSP 11 Score: 62.003 bits (149), Expect = 1.104e-8
Identity = 72/304 (23.68%), Postives = 110/304 (36.18%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEAT-----------------KHSSVTXXXXXXXXXXXXXSQ---------VALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPE------------GRKP------AGELSSTPTXXXXXXXXXXXKPIK----------------EVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY C  C K F+R+S L +H ++HT  +PY+C +C K F+H  +L  H+                   + S++T     H   K  +S+           L  H ++H RE +  C+ C K F     L+     H  EK      C +   +            G KP            + T   H      +KP K                       +K  KC  C   FN  +K   H  +    EK +    C K F S+S    H + +H +   Y C +C   F+Q S+   H++
Sbjct:  797 PYKCEECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIHT-GEKPYKCEECGKAFISSSTLNGH-KRIHTREKPYKCEECGKAFSQSSTLTRHKR 1098          

HSP 12 Score: 60.4622 bits (145), Expect = 3.120e-8
Identity = 68/264 (25.76%), Postives = 100/264 (37.88%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQV---ALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP------AGELSSTPTXXXXXXXXXXXKPIK----------------EVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            Y C  C K FNR+SNL  H  +HT  +PY+C +C K F    SL     TKH       +   C +  ++ +    L  H ++H  E    C+ C K F     L++H            + +  G KP            + T + H     ++KP K                  I    KKL KC  C   FN  +    H  +    EKS+    C K F  +S    H + +H     Y C +C   F+  S+   H++
Sbjct:  406 YKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSL-----TKHKRFHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLTKH------------KIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHSREKPYKCKECGKAFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTHKIIHT-GEKSYKCEECGKAFLWSSTLRRH-KRIHTGEKPYKCEECGKAFSHSSALAKHKR 650          

HSP 13 Score: 60.077 bits (144), Expect = 4.760e-8
Identity = 49/218 (22.48%), Postives = 82/218 (37.61%), Query Frame = 1
Query: 2020 CEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            C+ C K F+   TL  H+++H  DK  + C+ C + F     L  H        I   +                                  K  +W+  L +        KR  +  + +KC  CGK++     L +H + H +      C+ C K+F    ++ +H R  H   + + C +C   F   ++L  H + H+  KPY C  C + FK
Sbjct:  212 CKECEKTFHWSSTLTNHKEIHTEDKP-YKCEECGKAFKQLSTLTTHKIICAKEKIYKCEECG-------------------------------KAFLWSSTLTR-------HKRIHTGEKPYKCEECGKAFSHSSTLAKHKRIH-TGEKPYKCEECGKAFSRSSTLAKHKRI-HTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKAFK 388          

HSP 14 Score: 59.3066 bits (142), Expect = 7.968e-8
Identity = 65/262 (24.81%), Postives = 97/262 (37.02%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP------AGELSSTPTXXXXXXXXXXXKP----------------IKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY C  C K F + S L  H  +H   + Y+C +C K F H  SL TH+   H+              L S   LR H ++H  E    C+ C K F     L++H            + +  G KP          S++ T  +H     ++KP                 K  I    +KL KC  C   FN  +    H  +    EK +    C K F  +S    H + +H +   + C +C   F   S+   H++
Sbjct:  545 PYKCKECGKAFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTHKII-HTGEKSYKCEECGKAFLWSST-LRRHKRIHTGEKPYKCEECGKAFSHSSALAKH------------KRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHT-GEKPYKCEECGKAFNWSSSLTKH-KRIHTREKPFKCKECGKAFIWSSTLTRHKR 790          

HSP 15 Score: 58.5362 bits (140), Expect = 1.146e-7
Identity = 62/244 (25.41%), Postives = 93/244 (38.11%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY C  C K F+++S L  H  +HT  +PY+C +C K FR   +L  H+   H+               +S    R H ++H  E    C+ C K F+    L+     H  EK      C +             S+ T + H     ++KP             KC  C   F+  +    H  +    EK +    C K F+ +S    H + +H     Y C +C   F Q S   NH+K
Sbjct:  937 PYKCEECGKAFSQSSTLTTHKIIHTGEKPYKCEECGKAFRKSSTLTEHKII-HTGEKPYKCEECGKAFSQSSTLTR-HTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIHTGEKPYKCEECGKAFI----------SSSTLNGHKRIHTREKP------------YKCEECGKAFSQSSTLTRHKRLHT-GEKPYKCGECGKAFKESSALTKH-KIIHTGEKPYKCEKCGKAFNQSSILTNHKK 1154          

HSP 16 Score: 57.3806 bits (137), Expect = 3.052e-7
Identity = 62/254 (24.41%), Postives = 89/254 (35.04%), Query Frame = 1
Query: 4207 TPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLS----RHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            T  I C     Y C  C K F  +S L +H  +HT  +PY+C +C K F H  +L  H+                     S +A   H ++H  E    CK C K F     L+     H +EK      C +           LS+                 K  I    +KL KC  C   FN  +    H  +    EK +    C K F  +S    H +  H +   + C +C   F   S+   H++
Sbjct:  255 THKIICAKEKIYKCEECGKAFLWSSTLTRHKRIHTGEKPYKCEECGKAFSHSSTLAKHKRIHTGEKPYKCEECGKAFSRSSTLA--KHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKAFK-------RLSTL---------------TKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHT-GEKPYKCEECGKAFNWSSSLTKH-KRFHTREKPFKCKECGKAFIWSSTLTRHKR 482          

HSP 17 Score: 54.299 bits (129), Expect = 2.541e-6
Identity = 62/243 (25.51%), Postives = 87/243 (35.80%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQ 4953
            PY C  C K F+ +S L +H  +HT  +PY+C +C K F    +L  H+           +         S +A  NH   H  E    CK C K F     L++    H  EK      C +            SS  T             I + I    +K  KC  C   FN  +    H     + EK    + C K F  +S    H + +H     Y C +C   F Q S+   H+
Sbjct:  293 PYKCEECGKAFSHSSTLAKHKRIHTGEKPYKCEECGKAFSRSSTLAKHKRIHTGEKPYKCKECGKAFSNSSTLA--NHKITHTEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAF--------NRSSNLT-------------IHKFI-HTGEKPYKCEECGKAFNWSSSLTKHKRFHTR-EKPFKCKECGKAFIWSSTLTRH-KRIHTGEKPYKCEECGKAFRQSSTLTKHK 509          

HSP 18 Score: 53.9138 bits (128), Expect = 3.192e-6
Identity = 64/258 (24.81%), Postives = 97/258 (37.60%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPK--------------KLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            P+ C  C K F  +S L +H  +HT  +PY+C +C K F    +L  H+ T H+                S  AL  H  +H  E    C+ C K F+   +L+     H  EK + S  C +            SST T H   H +++    +E      +              K  KC  C   F+  +    H  +    EK +    C K F  +S    H + +H     Y C +C   F+Q S+   H +
Sbjct:  769 PFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHK-TIHTGEKPYKCKECGKAFKHSS-ALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFI--------WSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHT-GEKPYKCEECGKAFRKSSTLTEH-KIIHTGEKPYKCEECGKAFSQSSTLTRHTR 1014          

HSP 19 Score: 53.1434 bits (126), Expect = 6.272e-6
Identity = 60/245 (24.49%), Postives = 92/245 (37.55%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP------AGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQ 4953
            PY    C K F ++  L +H  +H++ +PY+C +C K F+   +L TH+   H+                S  +L  H  +H  E S  C+ C K F     L RH            + +  G KP          S +     H      +KP             KC  C   F+  +   NH  +    EK +  + CDKTF+  S    H + +H     Y C +C   F + S+   H+
Sbjct:  517 PYKFEECGKAFRQSLTLNKHKIIHSREKPYKCKECGKAFKQFSTLTTHKII-HAGKKLYKCEECGKAFNHSS-SLSTHKIIHTGEKSYKCEECGKAFLWSSTLRRH------------KRIHTGEKPYKCEECGKAFSHSSALAKHKRIHTGEKP------------YKCKECGKAFSNSSTLANHK-ITHTEEKPYKCKECDKTFKRLSTLTKH-KIIHAGEKLYKCEECGKAFNRSSNLTIHK 733          
BLAST of Zinc finger, C2H2 type vs. Ensembl Human
Match: ZNF91 (zinc finger protein 91 [Source:HGNC Symbol;Acc:HGNC:13166])

HSP 1 Score: 174.096 bits (440), Expect = 4.631e-43
Identity = 179/753 (23.77%), Postives = 281/753 (37.32%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNE----CTVVNDSNQEMN--------------YKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKN----GTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            CE C   F    T  KH  IH  ++ +KC  C  +++    L  H  I HT E    C   + + + ++              YKC  C   F+R      H  IH  ++   CE C   F     L KH   H                KCK C   F     + +H             I  G      E       +     K K      +  K    G++    +  + ++ I  R +P K           C  CGKAFK    L  H++ H G K ++C  C K F   SS+  H ++H   K + C+ CGKAF +   +  H K IH        E   ++  H    +        + P + K+    A +N S   + +IT            H   +P      D          K     + + +   E+  +    +  + +H+ I    TG + ++C  C K +  S  LT+H RIHT++KPF+C  C K+F   S L  H + H   K + CE C K F+   TL  H+ +H  +K  + CK C + F     L  H        +   +          + +  +    K KP   S +    K  IW+  L +        KR  +  + +KC  CGK++    +L  H + H +      C+ C K+F    ++  H +  H   + + C +C   F   ++L  H ++H+  KPY C  C + F       RH 
Sbjct:  292 CEECGKAFSRSSTLAKHKRIHTGEKPYKCKECGKAFSNSSTLANH-KITHTEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFH----------TREKPFKCKECGKAFIWSSTLTRHKR-----------IHTGEKPYKCEECGKAFRQSSTLTKHKIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHSREKPYK-----------CKECGKAFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTHKIIHTGEKSYKCEECGKAFLWSSTLRRH-KRIHTGEKPYKCEECGKAFSHSSALAKHKRIHTGEKPYKCKECGK-AFSNSSTLANHKIT------------HTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIH---TGEKPYKCEECGKAFNWSSSLTKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIHTGEKP-YKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKP---SKSEECDKAFIWSSTLTE-------HKRIHTREKTYKCEECGKAFSQPSHLTTHKRMH-TGEKPYKCEECGKAFSQSSTLTTH-KIIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHT 981          

HSP 2 Score: 151.369 bits (381), Expect = 5.687e-36
Identity = 175/721 (24.27%), Postives = 273/721 (37.86%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            CE C   F    T  +H  IH  ++ +KC  C  ++++   L  H   IHT E            YKC  C   FSR      H  IH  ++   C+ C   F     L  H   H                KCK C   F+ +  + KH +           I  G  +   E               K      +  K    G++         ++    R +P             C  CGKAF     L RH+  HTG K ++C  C K F Q S++  H ++H   K +  + CGKAF     +N H K+IH       S+ + +   E              FK+ ++L  T++      ++  Y   E     NH S    H+      I + E   K   ++  +  L S  + R          H+ I    TG + ++C  C K +  S  L +H RIHT +KP++C  C K+F   S L NH  +H + K + C+ C+K F    TL  H+ +H  +KL + C+ C + FN   +L        H+ I   +                      KP          K   W+  L +        KR  +  + FKC  CGK++ +   L  H + H +      C+ C K+F    ++ +H +T H   + + C +C   F   ++L +H ++H+  K Y C  C + F
Sbjct:  236 CEECGKAFLWSSTLTRHKRIHTGEKPYKCEECGKAFSHSSTLAKH-KRIHTGE----------KPYKCEECGKAFSRSSTLAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITH----------TEEKPYKCKECDKAFKRLSTLTKHKI-----------IHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFHTREKP-----------FKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLTKHKIIHTGEKPYKFEECGKAFRQSLTLNKH-KIIH-------SREKPYKCKECGKA----------FKQFSTLT-THKIIHAGKKL--YKCEECGKAFNHSSSLSTHK-----IIHTGEKSYKC--EECGKAFLWSSTLRR----------HKRIH---TGEKPYKCEECGKAFSHSSALAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKL-YKCEECGKAFNRSSNLTI------HKFIHTGE----------------------KPYKCEECG---KAFNWSSSLTK-------HKRIHTREKPFKCKECGKAFIWSSTLTRHKRIH-TGEKPYKCEECGKAFSRSSTLTKH-KTIHTGEKPYKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAF 831          

HSP 3 Score: 138.272 bits (347), Expect = 4.849e-32
Identity = 168/756 (22.22%), Postives = 284/756 (37.57%), Query Frame = 1
Query:  469 TVYKTIN-GTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAV-----------------CGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQ-YLWNENPTNEN--HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            T++K I+ G     CE C   F    +  KH   H  ++ FKC  C  ++ +   L  H   IHT E            YKC  C   F +      H +IH  ++    E C   F+  + L+KH   H                KCK C   F+    +  H +           I  G  +   E            +  K      ++ K    G++ L       ++ I    +P K +      + + A+                 CGKAF     L  H++THT  K ++C  C K F + S++  H ++H   K + C+ CGKAF    N+  H K IH        +      N S+           + K+I     T + P    E  + ++W+   T     H   +P            +    K     + +     ++  +  K +  +  H++I     G + ++C  C K + +S +LT H  IHT++KP +   C K+F   S L  H + H + K + CE C K F+    L  H+++H  +K  + C+ C + F+    L  H        I +    P++         +     ++K       P   +     +  +Q   +     R  +  + +KC  CGK++     L  H   H +      C+ C K+F++  ++  H R  H   + + C +C   F   ++L RH  +H+  KPY C  C + FK
Sbjct:  390 TIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFHTREKPFKCKECGKAFIWSSTLTRH-KRIHTGE----------KPYKCEECGKAFRQSSTLTKHKIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHS----------REKPYKCKECGKAFKQFSTLTTHKI-----------IHAGKKLYKCEECGKAFNHSSSLSTHKIIHTGEKSYKCEECGKAFLWSSTLRRHKRIHTGEKPYKCEECGKAFSHSSALAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIH-KFIHTGEKPYKCEECGKAFNWSSSL--------TKHKRI----HTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALAKHKIIH---AGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKP-YKCEECGKAFSQSSTLTTH-------KIIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEEC--GKAFSQSSTLTR-HTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIH-TGEKPYKCEECGKAFISSSTLNGHKRI-HTREKPYKCEECGKAFSQSSTLTRHKRLHTGEKPYKCGECGKAFK 1084          

HSP 4 Score: 134.42 bits (337), Expect = 9.512e-31
Identity = 177/774 (22.87%), Postives = 281/774 (36.30%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNE----CTVVNDS--------------NQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGE------ECDD---RKLTTNY----------LKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQE--HLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYL-WNENPTNEN--HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            C+ C+  F    T  KH  IH  ++ +KC  C  ++N   NL +H   IHT E    C     +               +E  +KC  C   F        H  IH  ++   CE C   F+    L KH   H  GE      EC     + LT N            KCK C   F+    +  H +           I  G  +   E            +  K      ++ K    G++ L       ++ I    +P K           C  CGKAF     L +H+  HTG K ++C  C K F+  S++  H + H   K + C+ C K F     +  H K+IH    E L + +E     N S++              I     T + P    E  +   W+ + T     H   +P            +    +     + +     E+  +    +  +  H+ I    TG + ++C+ C K ++ S  L +H  IH  +K ++C  C K+F   S L  H   H K K    E C+K F    TL  H+++H  +K  + C+ C + F+   HL     T+H R      P   +             + K   T         KP    E        + + + K+  +  + +KC  CGK++     L  H + H +      C+ C K+F     +  H +  H   + + C +C   FI+ ++L  H  +H+  KPY C  C + F       RH
Sbjct:  348 CKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIH-KFIHTGEKPYKCEECGKAFNWSSSLTKHKRFHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLTKHKIIH-TGEKPYKFEECGKAFRQSLTLNKHKIIHSREKPYKCKECGKAFKQFSTLTTHKI-----------IHAGKKLYKCEECGKAFNHSSSLSTHKIIHTGEKSYKCEECGKAFLWSSTLRRHKRIHTGEKPYK-----------CEECGKAFSHSSALAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKH-KIIHAG--EKLYKCEECGKAFNRSSNLT------------IHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIH---TGEKPYKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHKRIHTREKT-YKCEECGKAFSQPSHL-----TTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGE-------KPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMH-TGEKPYKCEECGKAFNRSSKLTTH-KIIHTGEKPYKCEECGKAFISSSTLNGHKRIHTREKPYKCEECGKAFSQSSTLTRH 1064          

HSP 5 Score: 105.145 bits (261), Expect = 8.263e-22
Identity = 128/530 (24.15%), Postives = 204/530 (38.49%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYL---WNENP--TNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH 2082
            C+ C+  F    T  KH  IH  ++ +KC  C  ++N   NL +H   IHT E            YKC  C   F+   +   H  IH  ++   C+ C   F     L +H   H  GE+           KC+ C   F     + KH             I  G      +      +      K K      +  K    G++         ++ I  + +P K++            C KAF     L  H+  HT  K ++C  C K F+Q S +  H  +H   K + C+ CGKAF+    + TH K+IH        +       +S+   E   K  +  +K     E  ++ S  + +T++      E P    E   ++  + +  T   I + E   K +  +  +  + S  +       G  ++H   K        ++C  C K + +S  LTRH R+HT +KP++C  C K+F+  S L  H   H   K + CE C K FN    L  H+++H
Sbjct:  656 CKECDKTFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIH-KFIHTGE----------KPYKCEECGKAFNWSSSLTKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIH-TGEK---------PYKCEECGKAFSRSSTLTKHKT-----------IHTGEKPYKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEE-----------CDKAFIWSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTH-KIIHTGEKPYKCEECGKAFRKSSTLTE--HKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIHTGEKPYKCE--ECGKAFISSSTL------NGHKRIHTREKP-------YKCEECGKAFSQSSTLTRHKRLHTGEKPYKCGECGKAFKESSALTKHKIIHTGEKPYKCEKCGKAFNQSSILTNHKKIH 1124          

HSP 6 Score: 103.99 bits (258), Expect = 1.600e-21
Identity = 82/308 (26.62%), Postives = 131/308 (42.53%), Query Frame = 1
Query: 1762 EDVERIDKETGQIQLHEMI--KDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            E+  +  K+   +  H++I  K+++     ++C  C K +  S  LTRH RIHT +KP++C  C K+F   S L  H + H   K + CE C K F+   TL  H+++H  +K  + CK C + F+    L  H  T                                          + KP    E       ++ + K K+  +  +L+KC  CGK++     L  H   H +      C+ C K+F    S+ +H R  H   + F C +C   FI  ++L RH  +H+  KPY C  C + F+
Sbjct:  209 EECGKAFKQLSTLTTHKIICAKEKI-----YKCEECGKAFLWSSTLTRHKRIHTGEKPYKCEECGKAFSHSSTLAKHKRIHTGEKPYKCEECGKAFSRSSTLAKHKRIHTGEKP-YKCKECGKAFSNSSTLANHKITH----------------------------------------TEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIH-TGEKPYKCEECGKAFNWSSSLTKHKRF-HTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFR 468          

HSP 7 Score: 98.2117 bits (243), Expect = 9.262e-20
Identity = 76/281 (27.05%), Postives = 123/281 (43.77%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            TG + ++C  C K + +S  L +H RIHT +KP++C  C K+F   S L NH  +H + K + C+ C+K F    TL  H+ +H  +KL + C+ C + FN   +L        H+ I   +                      KP          K   W+  L +        KR  +  + FKC  CGK++ +   L  H + H +      C+ C K+F    ++ +H +  H   + +   +C   F    +L +H ++HS  KPY C  C + FK
Sbjct:  285 TGEKPYKCEECGKAFSRSSTLAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKL-YKCEECGKAFNRSSNLTI------HKFIHTGE----------------------KPYKCEECG---KAFNWSSSLTK-------HKRFHTREKPFKCKECGKAFIWSSTLTRHKRIH-TGEKPYKCEECGKAFRQSSTLTKH-KIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHSREKPYKCKECGKAFK 524          

HSP 8 Score: 91.6633 bits (226), Expect = 1.010e-17
Identity = 76/321 (23.68%), Postives = 133/321 (41.43%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGT-------EVLSQSQE---HLLNESNXXXXXXQKDPNRFKKIASLA-----ETNQSPSDDAEITQYLWNENPTNEN---HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFN 2133
            C  CGKAFK    L +H++ H G K ++C  C K F Q S++  H ++H   K    + C KAF +   +  H ++  +  T       +  SQ      H    + +   + ++    F + ++L       T + P    E  +     +   E+   H   +P            +    +     + +     E+  +    + ++  H++I    TG + ++C  C K +  S  L  H RIHT++KP++C  C K+F   S L  H + H   K + C  C K F     L  H+ +H  +K  + C+ C + FN
Sbjct:  796 CKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIH---TGEKPYKCEECGKAFISSSTLNGHKRIHTREKPYKCEECGKAFSQSSTLTRHKRLHTGEKPYKCGECGKAFKESSALTKHKIIHTGEKP-YKCEKCGKAFN 1112          

HSP 9 Score: 70.0922 bits (170), Expect = 3.711e-11
Identity = 65/271 (23.99%), Postives = 114/271 (42.07%), Query Frame = 1
Query: 1858 FCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            FC +L++     T+H  ++  +K  +C  C K+F   S L NH + H + K + CE C K F    TL  H+ +   +K+ + C+ C + F     L     T H R      P  ++               K+K       P   +     +  ++   +A+  KR  +  + +KC  CGK++     L  H   H +      C+ C+K+F    ++ +H +  H   + + C +C   F   ++L  H  +H+  KPY C  C + F
Sbjct:  159 FCIRLHK-----TQHKCVYITEKSCKCKECEKTFHWSSTLTNHKEIHTEDKPYKCEECGKAFKQLSTLTTHKIICAKEKI-YKCEECGKAF-----LWSSTLTRHKRIHTGEKP--YKCEECGKAFSHSSTLAKHKRIHTGEKPYKCEEC--GKAFSRSSTLAK-HKRIHTGEKPYKCKECGKAFSNSSTLANHKITH-TEEKPYKCKECDKAFKRLSTLTKH-KIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAF 411          

HSP 10 Score: 68.1662 bits (165), Expect = 1.353e-10
Identity = 66/246 (26.83%), Postives = 95/246 (38.62%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQV---ALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            Y C  C K FNR+SNL  H  +HT  +PY+C +C K F    SL     TKH  +    +   C +  ++ +    L  H ++H  E    C+ C K F     L++    H  EK      C +        A                      K  I    +KL KC  C   FN  +    H  +  K EK   +  CDK F  +S    H + +H +   Y C +C   F+Q S    H++
Sbjct:  682 YKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSL-----TKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALA----------------------KHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTK-EKPSKSEECDKAFIWSSTLTEH-KRIHTREKTYKCEECGKAFSQPSHLTTHKR 898          

HSP 11 Score: 61.6178 bits (148), Expect = 1.686e-8
Identity = 72/304 (23.68%), Postives = 110/304 (36.18%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEAT-----------------KHSSVTXXXXXXXXXXXXXSQ---------VALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPE------------GRKP------AGELSSTPTXXXXXXXXXXXKPIK----------------EVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY C  C K F+R+S L +H ++HT  +PY+C +C K F+H  +L  H+                   + S++T     H   K  +S+           L  H ++H RE +  C+ C K F     L+     H  EK      C +   +            G KP            + T   H      +KP K                       +K  KC  C   FN  +K   H  +    EK +    C K F S+S    H + +H +   Y C +C   F+Q S+   H++
Sbjct:  765 PYKCEECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIHT-GEKPYKCEECGKAFISSSTLNGH-KRIHTREKPYKCEECGKAFSQSSTLTRHKR 1066          

HSP 12 Score: 60.077 bits (144), Expect = 4.531e-8
Identity = 68/264 (25.76%), Postives = 100/264 (37.88%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQV---ALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP------AGELSSTPTXXXXXXXXXXXKPIK----------------EVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            Y C  C K FNR+SNL  H  +HT  +PY+C +C K F    SL     TKH       +   C +  ++ +    L  H ++H  E    C+ C K F     L++H            + +  G KP            + T + H     ++KP K                  I    KKL KC  C   FN  +    H  +    EKS+    C K F  +S    H + +H     Y C +C   F+  S+   H++
Sbjct:  374 YKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSL-----TKHKRFHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLTKH------------KIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHSREKPYKCKECGKAFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTHKIIHT-GEKSYKCEECGKAFLWSSTLRRH-KRIHTGEKPYKCEECGKAFSHSSALAKHKR 618          

HSP 13 Score: 59.3066 bits (142), Expect = 7.272e-8
Identity = 49/218 (22.48%), Postives = 82/218 (37.61%), Query Frame = 1
Query: 2020 CEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            C+ C K F+   TL  H+++H  DK  + C+ C + F     L  H        I   +                                  K  +W+  L +        KR  +  + +KC  CGK++     L +H + H +      C+ C K+F    ++ +H R  H   + + C +C   F   ++L  H + H+  KPY C  C + FK
Sbjct:  180 CKECEKTFHWSSTLTNHKEIHTEDKP-YKCEECGKAFKQLSTLTTHKIICAKEKIYKCEECG-------------------------------KAFLWSSTLTR-------HKRIHTGEKPYKCEECGKAFSHSSTLAKHKRIH-TGEKPYKCEECGKAFSRSSTLAKHKRI-HTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKAFK 356          

HSP 14 Score: 58.5362 bits (140), Expect = 1.138e-7
Identity = 65/262 (24.81%), Postives = 96/262 (36.64%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP------AGELSSTPTXXXXXXXXXXXKP----------------IKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY C  C K F + S L  H  +H   + Y+C +C K F H  SL TH+   H+              L S   LR H ++H  E    C+ C K F     L++H              +  G KP          S++ T  +H     ++KP                 K  I    +KL KC  C   FN  +    H  +    EK +    C K F  +S    H + +H +   + C +C   F   S+   H++
Sbjct:  513 PYKCKECGKAFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTHKII-HTGEKSYKCEECGKAFLWSST-LRRHKRIHTGEKPYKCEECGKAFSHSSALAKHKR------------IHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHT-GEKPYKCEECGKAFNWSSSLTKH-KRIHTREKPFKCKECGKAFIWSSTLTRHKR 758          

HSP 15 Score: 58.151 bits (139), Expect = 1.721e-7
Identity = 62/244 (25.41%), Postives = 93/244 (38.11%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY C  C K F+++S L  H  +HT  +PY+C +C K FR   +L  H+   H+               +S    R H ++H  E    C+ C K F+    L+     H  EK      C +             S+ T + H     ++KP             KC  C   F+  +    H  +    EK +    C K F+ +S    H + +H     Y C +C   F Q S   NH+K
Sbjct:  905 PYKCEECGKAFSQSSTLTTHKIIHTGEKPYKCEECGKAFRKSSTLTEHKII-HTGEKPYKCEECGKAFSQSSTLTR-HTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIHTGEKPYKCEECGKAFI----------SSSTLNGHKRIHTREKP------------YKCEECGKAFSQSSTLTRHKRLHT-GEKPYKCGECGKAFKESSALTKH-KIIHTGEKPYKCEKCGKAFNQSSILTNHKK 1122          

HSP 16 Score: 56.9954 bits (136), Expect = 4.323e-7
Identity = 62/254 (24.41%), Postives = 89/254 (35.04%), Query Frame = 1
Query: 4207 TPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLS----RHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            T  I C     Y C  C K F  +S L +H  +HT  +PY+C +C K F H  +L  H+                     S +A   H ++H  E    CK C K F     L+     H +EK      C +           LS+                 K  I    +KL KC  C   FN  +    H  +    EK +    C K F  +S    H +  H +   + C +C   F   S+   H++
Sbjct:  223 THKIICAKEKIYKCEECGKAFLWSSTLTRHKRIHTGEKPYKCEECGKAFSHSSTLAKHKRIHTGEKPYKCEECGKAFSRSSTLA--KHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKAFK-------RLSTL---------------TKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHT-GEKPYKCEECGKAFNWSSSLTKH-KRFHTREKPFKCKECGKAFIWSSTLTRHKR 450          

HSP 17 Score: 53.5286 bits (127), Expect = 3.821e-6
Identity = 62/243 (25.51%), Postives = 87/243 (35.80%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQ 4953
            PY C  C K F+ +S L +H  +HT  +PY+C +C K F    +L  H+           +         S +A  NH   H  E    CK C K F     L++    H  EK      C +            SS  T             I + I    +K  KC  C   FN  +    H     + EK    + C K F  +S    H + +H     Y C +C   F Q S+   H+
Sbjct:  261 PYKCEECGKAFSHSSTLAKHKRIHTGEKPYKCEECGKAFSRSSTLAKHKRIHTGEKPYKCKECGKAFSNSSTLA--NHKITHTEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAF--------NRSSNLT-------------IHKFI-HTGEKPYKCEECGKAFNWSSSLTKHKRFHTR-EKPFKCKECGKAFIWSSTLTRH-KRIHTGEKPYKCEECGKAFRQSSTLTKHK 477          

HSP 18 Score: 53.5286 bits (127), Expect = 4.601e-6
Identity = 64/258 (24.81%), Postives = 97/258 (37.60%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPK--------------KLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            P+ C  C K F  +S L +H  +HT  +PY+C +C K F    +L  H+ T H+                S  AL  H  +H  E    C+ C K F+   +L+     H  EK + S  C +            SST T H   H +++    +E      +              K  KC  C   F+  +    H  +    EK +    C K F  +S    H + +H     Y C +C   F+Q S+   H +
Sbjct:  737 PFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHK-TIHTGEKPYKCKECGKAFKHSS-ALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFI--------WSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHT-GEKPYKCEECGKAFRKSSTLTEH-KIIHTGEKPYKCEECGKAFSQSSTLTRHTR 982          

HSP 19 Score: 52.373 bits (124), Expect = 8.890e-6
Identity = 60/245 (24.49%), Postives = 91/245 (37.14%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP------AGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQ 4953
            PY    C K F ++  L +H  +H++ +PY+C +C K F+   +L TH+   H+                S  +L  H  +H  E S  C+ C K F     L RH              +  G KP          S +     H      +KP             KC  C   F+  +   NH  +    EK +  + CDKTF+  S    H + +H     Y C +C   F + S+   H+
Sbjct:  485 PYKFEECGKAFRQSLTLNKHKIIHSREKPYKCKECGKAFKQFSTLTTHKII-HAGKKLYKCEECGKAFNHSS-SLSTHKIIHTGEKSYKCEECGKAFLWSSTLRRHKR------------IHTGEKPYKCEECGKAFSHSSALAKHKRIHTGEKP------------YKCKECGKAFSNSSTLANHK-ITHTEEKPYKCKECDKTFKRLSTLTKH-KIIHAGEKLYKCEECGKAFNRSSNLTIHK 701          
BLAST of Zinc finger, C2H2 type vs. Ensembl Celegans
Match: Y55F3AM.14 (pep chromosome:WBcel235:IV:1058845:1063187:-1 gene:WBGene00021931.1 transcript:Y55F3AM.14.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AM.14)

HSP 1 Score: 102.834 bits (255), Expect = 7.665e-22
Identity = 72/257 (28.02%), Postives = 113/257 (43.97%), Query Frame = 1
Query: 1936 CYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKE-HLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHIS 2703
            C +C K F   S+L++H +SH   K ++C  C K F  K TL+VH + H  ++  + C+ C++ F   +  +  +  S H  I N                                    K    ++LL+ P   A    +K   ++ F+C+ C K++  K YL  H+K+ H      +VC +CNK F    S+Q H+RT H   R + C  CP  F ++ +L  H   H+  +PY+C  C R F  K     H S
Sbjct:  106 CTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGER-PYKCRYCEKTF-AQYGTKTVHEKSAHLGIRN-----------------------------------YKCPKCDKLLSSPS--ALYTHKKTHGDKTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRT-HTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHES 322          

HSP 2 Score: 65.4698 bits (158), Expect = 2.803e-10
Identity = 82/300 (27.33%), Postives = 122/300 (40.67%), Query Frame = 1
Query: 1771 ERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKE--FSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNK--PTANSNNP----PDVKPLIWN------------ELLNQPIPIAE---IDKRKLSNNRLFKCNHCGKSYKFKKYLNEH------LKEHLSANNTNV---CQFCNKSFVTYRSMQQHLRT----QHLNRRKFS 2562
            E+   + G   +HE  K    G R ++C  C KL      L  H + H   K F+C  C K+F LK+ LK H K   +  E    C  CNK F    +L+VH + H  ++  +VCK C + F +  +L+     SH R+     P   Q          Q  + ++      +S NP     D+ P+  +               N+  P A    I  RK +    + C+ CGK Y  K  LN H       K  L   ++     C  C KSFV   ++Q H+ +    ++L R K S
Sbjct:  166 EKTFAQYGTKTVHE--KSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGD-KTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRTHTGER-PYVCKFCPKAFASQGNLQ-----SHERTHTGERPYSCQFCQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPVAGSVTDHQMVGNYECTFCNKKYPYASSLYIHMRKHTEKSAYSCDGCGKPYSQKISLNIHQDQCEAFKNRLKTTDSQFSHNCDGCGKSFVQRIALQIHVDSCEPHKNLARLKLS 456          

HSP 3 Score: 65.4698 bits (158), Expect = 3.213e-10
Identity = 42/142 (29.58%), Postives = 62/142 (43.66%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRL-----------------------------KSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVH-RQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            TG + + C FC K + +   L  H R HT ++P++C  C K+F                                S L  H K+H   K F C+ C K F LK  LK+H +Q+HE ++ + VC  C++ F     L+ H  T
Sbjct:  127 TGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGD-KTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRT 267          

HSP 4 Score: 61.6178 bits (148), Expect = 4.296e-9
Identity = 75/313 (23.96%), Postives = 118/313 (37.70%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVT-HTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKN------------GTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNH------FKSHWKL--KEFS--CEICNKIFNLKQTLKVHRQLHEPDK 2094
            C  C K F        HE + H GI+ ++CP C K  +  S++  H   H + K F C FC K F  ++ +  H+K +H+             G       Q H+   + +     +  P  F    +L           E T        T E  +S Q   ++       +A     L    S      + D+  +    G +  H+M+ +       + C FC K Y  +  L  H+R HT++  + C  C K +  K  L  H      FK+  K    +FS  C+ C K F  +  L++H    EP K
Sbjct:  162 CRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGD-KTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNL--------QSHERTH-------TGERPYSCQFCQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPV---AGSVTDHQMVGN-------YECTFCNKKYPYASSLYIHMRKHTEKSAYSCDGCGKPYSQKISLNIHQDQCEAFKNRLKTTDSQFSHNCDGCGKSFVQRIALQIHVDSCEPHK 448          

HSP 5 Score: 60.8474 bits (146), Expect = 8.354e-9
Identity = 27/78 (34.62%), Postives = 41/78 (52.56%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH 1458
            C VCGK F    +L  H+ +HTG K + C  C+K F QK+++++H   H   + + C++C K F        H K  H
Sbjct:  106 CTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAH 183          

HSP 6 Score: 57.7658 bits (138), Expect = 7.155e-8
Identity = 32/109 (29.36%), Postives = 49/109 (44.95%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            +R  C  C K +     L  H R HT +KP+ C+ C K+F  K+ L+ H ++H   + + C  C K F    T  VH +        + C  CD+  ++   L  H  T
Sbjct:  102 KRHICTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKT 210          

HSP 7 Score: 54.299 bits (129), Expect = 8.038e-7
Identity = 34/109 (31.19%), Postives = 47/109 (43.12%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C+  F    +   H KS H   R++ C  C K  S+  +L+ H KTH D      F C  C + F     L  HV+  H  N   + C +CNK +     L  HV+
Sbjct:  162 CRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGDKT----FRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVR 266          

HSP 8 Score: 52.373 bits (124), Expect = 3.192e-6
Identity = 41/111 (36.94%), Postives = 54/111 (48.65%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKH 4569
            PY+C  C K F + + LQ H   HT  RPY+C  C K F    +   HE + H  + +  +C  C KLL S  AL  H K H  + +  C  C K F L+  L  HV + H
Sbjct:  131 PYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGI-RNYKCPKCDKLLSSPSALYTHKKTH-GDKTFRCDFCPKTFALKNYLKLHVKQVH 239          

HSP 9 Score: 51.6026 bits (122), Expect = 4.928e-6
Identity = 38/136 (27.94%), Postives = 58/136 (42.65%), Query Frame = 1
Query: 3556 HGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSL----SRHVRMQHNDN--------------------LNLYRCTHCNKVYKTTRELDSHVKQ 3891
            H C  C+  F  + SL  HV++ H   R + C  C KAF+++ +L +H +TH   R + C     C + FI    L    S H+  +H+ N                    +  Y CT CNK Y     L  H+++
Sbjct:  246 HVCVYCNKGFAYAGSLQVHVRT-HTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQF---CQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPVAGSVTDHQMVGNYECTFCNKKYPYASSLYIHMRK 377          
BLAST of Zinc finger, C2H2 type vs. Ensembl Celegans
Match: Y55F3AM.14 (pep chromosome:WBcel235:IV:1058695:1067525:-1 gene:WBGene00021931.1 transcript:Y55F3AM.14.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AM.14)

HSP 1 Score: 102.834 bits (255), Expect = 7.665e-22
Identity = 72/257 (28.02%), Postives = 113/257 (43.97%), Query Frame = 1
Query: 1936 CYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKE-HLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHIS 2703
            C +C K F   S+L++H +SH   K ++C  C K F  K TL+VH + H  ++  + C+ C++ F   +  +  +  S H  I N                                    K    ++LL+ P   A    +K   ++ F+C+ C K++  K YL  H+K+ H      +VC +CNK F    S+Q H+RT H   R + C  CP  F ++ +L  H   H+  +PY+C  C R F  K     H S
Sbjct:  106 CTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGER-PYKCRYCEKTF-AQYGTKTVHEKSAHLGIRN-----------------------------------YKCPKCDKLLSSPS--ALYTHKKTHGDKTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRT-HTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHES 322          

HSP 2 Score: 65.4698 bits (158), Expect = 2.803e-10
Identity = 82/300 (27.33%), Postives = 122/300 (40.67%), Query Frame = 1
Query: 1771 ERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKE--FSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNK--PTANSNNP----PDVKPLIWN------------ELLNQPIPIAE---IDKRKLSNNRLFKCNHCGKSYKFKKYLNEH------LKEHLSANNTNV---CQFCNKSFVTYRSMQQHLRT----QHLNRRKFS 2562
            E+   + G   +HE  K    G R ++C  C KL      L  H + H   K F+C  C K+F LK+ LK H K   +  E    C  CNK F    +L+VH + H  ++  +VCK C + F +  +L+     SH R+     P   Q          Q  + ++      +S NP     D+ P+  +               N+  P A    I  RK +    + C+ CGK Y  K  LN H       K  L   ++     C  C KSFV   ++Q H+ +    ++L R K S
Sbjct:  166 EKTFAQYGTKTVHE--KSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGD-KTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRTHTGER-PYVCKFCPKAFASQGNLQ-----SHERTHTGERPYSCQFCQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPVAGSVTDHQMVGNYECTFCNKKYPYASSLYIHMRKHTEKSAYSCDGCGKPYSQKISLNIHQDQCEAFKNRLKTTDSQFSHNCDGCGKSFVQRIALQIHVDSCEPHKNLARLKLS 456          

HSP 3 Score: 65.4698 bits (158), Expect = 3.213e-10
Identity = 42/142 (29.58%), Postives = 62/142 (43.66%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRL-----------------------------KSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVH-RQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            TG + + C FC K + +   L  H R HT ++P++C  C K+F                                S L  H K+H   K F C+ C K F LK  LK+H +Q+HE ++ + VC  C++ F     L+ H  T
Sbjct:  127 TGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGD-KTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRT 267          

HSP 4 Score: 61.6178 bits (148), Expect = 4.296e-9
Identity = 75/313 (23.96%), Postives = 118/313 (37.70%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVT-HTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKN------------GTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNH------FKSHWKL--KEFS--CEICNKIFNLKQTLKVHRQLHEPDK 2094
            C  C K F        HE + H GI+ ++CP C K  +  S++  H   H + K F C FC K F  ++ +  H+K +H+             G       Q H+   + +     +  P  F    +L           E T        T E  +S Q   ++       +A     L    S      + D+  +    G +  H+M+ +       + C FC K Y  +  L  H+R HT++  + C  C K +  K  L  H      FK+  K    +FS  C+ C K F  +  L++H    EP K
Sbjct:  162 CRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGD-KTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNL--------QSHERTH-------TGERPYSCQFCQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPV---AGSVTDHQMVGN-------YECTFCNKKYPYASSLYIHMRKHTEKSAYSCDGCGKPYSQKISLNIHQDQCEAFKNRLKTTDSQFSHNCDGCGKSFVQRIALQIHVDSCEPHK 448          

HSP 5 Score: 60.8474 bits (146), Expect = 8.354e-9
Identity = 27/78 (34.62%), Postives = 41/78 (52.56%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH 1458
            C VCGK F    +L  H+ +HTG K + C  C+K F QK+++++H   H   + + C++C K F        H K  H
Sbjct:  106 CTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAH 183          

HSP 6 Score: 57.7658 bits (138), Expect = 7.155e-8
Identity = 32/109 (29.36%), Postives = 49/109 (44.95%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            +R  C  C K +     L  H R HT +KP+ C+ C K+F  K+ L+ H ++H   + + C  C K F    T  VH +        + C  CD+  ++   L  H  T
Sbjct:  102 KRHICTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKT 210          

HSP 7 Score: 54.299 bits (129), Expect = 8.038e-7
Identity = 34/109 (31.19%), Postives = 47/109 (43.12%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C+  F    +   H KS H   R++ C  C K  S+  +L+ H KTH D      F C  C + F     L  HV+  H  N   + C +CNK +     L  HV+
Sbjct:  162 CRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGDKT----FRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVR 266          

HSP 8 Score: 52.373 bits (124), Expect = 3.192e-6
Identity = 41/111 (36.94%), Postives = 54/111 (48.65%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKH 4569
            PY+C  C K F + + LQ H   HT  RPY+C  C K F    +   HE + H  + +  +C  C KLL S  AL  H K H  + +  C  C K F L+  L  HV + H
Sbjct:  131 PYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGI-RNYKCPKCDKLLSSPSALYTHKKTH-GDKTFRCDFCPKTFALKNYLKLHVKQVH 239          

HSP 9 Score: 51.6026 bits (122), Expect = 4.928e-6
Identity = 38/136 (27.94%), Postives = 58/136 (42.65%), Query Frame = 1
Query: 3556 HGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSL----SRHVRMQHNDN--------------------LNLYRCTHCNKVYKTTRELDSHVKQ 3891
            H C  C+  F  + SL  HV++ H   R + C  C KAF+++ +L +H +TH   R + C     C + FI    L    S H+  +H+ N                    +  Y CT CNK Y     L  H+++
Sbjct:  246 HVCVYCNKGFAYAGSLQVHVRT-HTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQF---CQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPVAGSVTDHQMVGNYECTFCNKKYPYASSLYIHMRK 377          
BLAST of Zinc finger, C2H2 type vs. Ensembl Celegans
Match: fezf-1 (FEZ Family zinc finger protein [Source:UniProtKB/TrEMBL;Acc:O62425])

HSP 1 Score: 83.9593 bits (206), Expect = 1.125e-17
Identity = 47/112 (41.96%), Postives = 59/112 (52.68%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            TG R F C+ C K +R++  L RH  IHT  KP +C  C K F   S L  H + H   K F CEIC K F+     K HR  HE D  +F C IC R F+  ++L +H  T
Sbjct:   75 TGERPFVCKVCGKAFRQASTLCRHKIIHTDSKPHKCKTCGKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNHRLTHE-DTKKFSCSICSRAFHQSYNLAFHMFT 185          

HSP 2 Score: 70.8626 bits (172), Expect = 3.312e-13
Identity = 38/98 (38.78%), Postives = 55/98 (56.12%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFN 2133
            ++F C  C K +    +LTRH+ +HT ++PF C +C K+FR  S L  H   H   K   C+ C K FN   TL  H ++H+  K  FVC+IC + F+
Sbjct:   50 KKFPCEICGKQFNAHYNLTRHMPVHTGERPFVCKVCGKAFRQASTLCRHKIIHTDSKPHKCKTCGKCFNRSSTLNTHVRIHQGFK-PFVCEICGKGFH 146          

HSP 3 Score: 70.8626 bits (172), Expect = 3.745e-13
Identity = 40/108 (37.04%), Postives = 54/108 (50.00%), Query Frame = 1
Query: 1849 RCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            +C+ C K + +S  L  H+RIH   KPF C +C K F      KNH  +H   K+FSC IC++ F+    L  H   HE  K  F C +C + F   F L+ H    H
Sbjct:  109 KCKTCGKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNHRLTHEDTKKFSCSICSRAFHQSYNLAFHMFTHEEHK-PFTCHVCSKGFCRNFDLKKHLRKMH 215          

HSP 4 Score: 63.929 bits (154), Expect = 8.052e-11
Identity = 29/76 (38.16%), Postives = 42/76 (55.26%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            C +CGK F     L RH   HTG + F C +C K F Q S++  H ++H + K   C+ CGK F     +NTH+++
Sbjct:   54 CEICGKQFNAHYNLTRHMPVHTGERPFVCKVCGKAFRQASTLCRHKIIHTDSKPHKCKTCGKCFNRSSTLNTHVRI 129          

HSP 5 Score: 62.3882 bits (150), Expect = 3.208e-10
Identity = 29/73 (39.73%), Postives = 40/73 (54.79%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTH 1443
            C VCGKAF+    L RH++ HT  K  +C  C K F + S++  H+ +H   K F+C+ CGK F    N   H
Sbjct:   82 CKVCGKAFRQASTLCRHKIIHTDSKPHKCKTCGKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNH 154          

HSP 6 Score: 60.077 bits (144), Expect = 1.999e-9
Identity = 29/74 (39.19%), Postives = 37/74 (50.00%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHI 1446
            C  CGK F     L  H   H G K F C IC KGF Q  + K H + H++ K F C  C +AF   +N+  H+
Sbjct:  110 CKTCGKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNHRLTHEDTKKFSCSICSRAFHQSYNLAFHM 183          

HSP 7 Score: 59.6918 bits (143), Expect = 2.673e-9
Identity = 26/78 (33.33%), Postives = 39/78 (50.00%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH 1458
            C +CGK F      + H +TH   K+F C IC + F Q  ++  HM  H+  K F C  C K F    ++  H++ +H
Sbjct:  138 CEICGKGFHQNGNYKNHRLTHEDTKKFSCSICSRAFHQSYNLAFHMFTHEEHKPFTCHVCSKGFCRNFDLKKHLRKMH 215          

HSP 8 Score: 51.6026 bits (122), Expect = 1.166e-6
Identity = 32/111 (28.83%), Postives = 45/111 (40.54%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKH 4569
            P+ C  C K FNR+S L  H+ +H   +P+ C  C K F    + K H  T   +                 +A   H+  H       C VC KGF    DL +H+ + H
Sbjct:  107 PHKCKTCGKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNHRLTHEDTKKFSCSICSRAFHQSYNLAF--HMFTHEEHKPFTCHVCSKGFCRNFDLKKHLRKMH 215          

HSP 9 Score: 49.2914 bits (116), Expect = 7.419e-6
Identity = 43/157 (27.39%), Postives = 62/157 (39.49%), Query Frame = 1
Query:  487 NGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKH 957
            N   K  CEIC  +F +     +HM +H  +R F C  C  ++     L  H  IIHT+             +KC  C   F+R      H  IHQ  +   CE C   F      + +  +H++  E D +K +     C IC   F    N+  H
Sbjct:   47 NSRKKFPCEICGKQFNAHYNLTRHMPVHTGERPFVCKVCGKAFRQASTLCRH-KIIHTD----------SKPHKCKTCGKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFH----QNGNYKNHRLTHE-DTKKFS-----CSICSRAFHQSYNLAFH 182          
BLAST of Zinc finger, C2H2 type vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 81.2629 bits (199), Expect = 4.586e-15
Identity = 39/114 (34.21%), Postives = 61/114 (53.51%), Query Frame = 1
Query: 1816 IKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYH 2157
            ++ Q  G  R+ C+ C K + +  +L  H+R HT ++PF+C +C K F   + L+ H   H   +   C+IC+K F+    LK H +LH   K  + C +CD +F    HLR H
Sbjct:  498 VQQQENGKTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQK-PYTCDVCDAKFTQYVHLRLH 610          

HSP 2 Score: 76.2554 bits (186), Expect = 1.478e-13
Identity = 35/113 (30.97%), Postives = 63/113 (55.75%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTS 2169
            TG R F+C  C K + +   L +H  +HT ++P +C +C K F   S LK H + H   K ++C++C+  F     L++H++LH  ++  + C  C +++ +   LR H+ T+
Sbjct:  531 TGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANER-PYSCGTCGKKYISPSGLRTHWKTT 642          

HSP 3 Score: 60.4622 bits (145), Expect = 1.092e-8
Identity = 35/133 (26.32%), Postives = 62/133 (46.62%), Query Frame = 1
Query: 2359 RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLM 2757
            R  +  R FKC  C K +    +L +H   H +    + C  C+K F +  +++ HLR  H  ++ ++C  C A F     L  H  +H+N +PY+C  C +++ +      H     C ++      ++DLM
Sbjct:  528 RTHTGERPFKCEICTKEFTQLAHLQKHHLVH-TGERPHRCDICDKRFSSTSNLKTHLRL-HNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTHWKTTTCKEEDMKDSMRDDLM 658          

HSP 4 Score: 55.8398 bits (133), Expect = 2.633e-7
Identity = 28/76 (36.84%), Postives = 41/76 (53.95%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            C  C K F     L+ H  THTG + F+C IC K FTQ + ++ H +VH   +   C  C K F+   N+ TH+++
Sbjct:  510 CKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRL 585          

HSP 5 Score: 53.5286 bits (127), Expect = 1.632e-6
Identity = 27/80 (33.75%), Postives = 42/80 (52.50%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKN 1464
            C +C K F     L++H + HTG +   C IC K F+  S++K H+ +H+  K + C  C   FT   ++  H K +H N
Sbjct:  538 CEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLH-KRLHAN 616          

HSP 6 Score: 52.7582 bits (125), Expect = 2.431e-6
Identity = 38/106 (35.85%), Postives = 51/106 (48.11%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH 4554
            P+ C IC K F + ++LQ+H  VHT  RP++C  C KRF    +LKTH   +  +  K   C +C       V LR H +LH  E    C  C K +     L  H
Sbjct:  535 PFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTH--LRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTH 638          

HSP 7 Score: 52.373 bits (124), Expect = 3.216e-6
Identity = 26/76 (34.21%), Postives = 40/76 (52.63%), Query Frame = 1
Query: 2473 VCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
             C+ CNK+F    +++ H+RT H   R F C  C   F   A L +H LVH+  +P+ C +C +RF +      H+
Sbjct:  509 ACKDCNKTFGQLSNLKVHVRT-HTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHL 583          

HSP 8 Score: 51.6026 bits (122), Expect = 6.180e-6
Identity = 24/76 (31.58%), Postives = 37/76 (48.68%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            C +C K F +   L+ H   H G K + C +C   FTQ   +++H  +H N + + C  CGK +     + TH K 
Sbjct:  566 CDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTHWKT 641          
BLAST of Zinc finger, C2H2 type vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 81.2629 bits (199), Expect = 4.654e-15
Identity = 39/114 (34.21%), Postives = 61/114 (53.51%), Query Frame = 1
Query: 1816 IKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYH 2157
            ++ Q  G  R+ C+ C K + +  +L  H+R HT ++PF+C +C K F   + L+ H   H   +   C+IC+K F+    LK H +LH   K  + C +CD +F    HLR H
Sbjct:  498 VQQQENGKTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQK-PYTCDVCDAKFTQYVHLRLH 610          

HSP 2 Score: 76.2554 bits (186), Expect = 1.472e-13
Identity = 35/113 (30.97%), Postives = 63/113 (55.75%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTS 2169
            TG R F+C  C K + +   L +H  +HT ++P +C +C K F   S LK H + H   K ++C++C+  F     L++H++LH  ++  + C  C +++ +   LR H+ T+
Sbjct:  531 TGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHA-NERPYSCGTCGKKYISPSGLRTHWKTT 642          

HSP 3 Score: 60.4622 bits (145), Expect = 1.074e-8
Identity = 35/133 (26.32%), Postives = 62/133 (46.62%), Query Frame = 1
Query: 2359 RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLM 2757
            R  +  R FKC  C K +    +L +H   H +    + C  C+K F +  +++ HLR  H  ++ ++C  C A F     L  H  +H+N +PY+C  C +++ +      H     C ++      ++DLM
Sbjct:  528 RTHTGERPFKCEICTKEFTQLAHLQKHHLVH-TGERPHRCDICDKRFSSTSNLKTHLRL-HNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTHWKTTTCKEEDMKDSMRDDLM 658          

HSP 4 Score: 55.8398 bits (133), Expect = 2.631e-7
Identity = 28/76 (36.84%), Postives = 41/76 (53.95%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            C  C K F     L+ H  THTG + F+C IC K FTQ + ++ H +VH   +   C  C K F+   N+ TH+++
Sbjct:  510 CKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRL 585          

HSP 5 Score: 53.5286 bits (127), Expect = 1.535e-6
Identity = 27/80 (33.75%), Postives = 42/80 (52.50%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKN 1464
            C +C K F     L++H + HTG +   C IC K F+  S++K H+ +H+  K + C  C   FT   ++  H K +H N
Sbjct:  538 CEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLH-KRLHAN 616          

HSP 6 Score: 52.7582 bits (125), Expect = 2.249e-6
Identity = 38/106 (35.85%), Postives = 51/106 (48.11%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH 4554
            P+ C IC K F + ++LQ+H  VHT  RP++C  C KRF    +LKTH   +  +  K   C +C       V LR H +LH  E    C  C K +     L  H
Sbjct:  535 PFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTH--LRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTH 638          

HSP 7 Score: 52.373 bits (124), Expect = 3.238e-6
Identity = 26/76 (34.21%), Postives = 40/76 (52.63%), Query Frame = 1
Query: 2473 VCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
             C+ CNK+F    +++ H+RT H   R F C  C   F   A L +H LVH+  +P+ C +C +RF +      H+
Sbjct:  509 ACKDCNKTFGQLSNLKVHVRT-HTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHL 583          

HSP 8 Score: 51.6026 bits (122), Expect = 6.116e-6
Identity = 24/76 (31.58%), Postives = 37/76 (48.68%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            C +C K F +   L+ H   H G K + C +C   FTQ   +++H  +H N + + C  CGK +     + TH K 
Sbjct:  566 CDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTHWKT 641          
BLAST of Zinc finger, C2H2 type vs. Ensembl Fly
Match: crol (gene:FBgn0020309 transcript:FBtr0335476)

HSP 1 Score: 124.405 bits (311), Expect = 3.401e-28
Identity = 130/512 (25.39%), Postives = 200/512 (39.06%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQ-------SQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLW--NENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH---EPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDV-----KPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNR---RKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C VCG+ F T   L RH   H G   F C +C   F   +S++ HM  H   K F C  C K F  + +++ H +  H   T    Q        +EH++N       E     +  KK  +  E          +  Y+W   + P   +    +   + +  +++ S  N      +      +  +   R +  T  I  H       TG    RC FC K + +   L  H+R HT + P +C  C K+F  K  L NH + H     F C  C K F  K  +  H + H    P K  +  K   R+ +   H+R H   S HR                 ++  + E L N    ++ + P       K     E LN  +       R+ S++    CN C K +  K++L  H+    + +    C+ C KSF    ++  H R+    +   R F+C +CP  FI K  L+ H   HS  KP+AC LC + F  +    RH+
Sbjct:  251 CQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRS-HTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKE--------HYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCE------ICGKSFSRKEHFTNHILWH-------TGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRC------------SYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHM-------RQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHM 721          

HSP 2 Score: 82.0333 bits (201), Expect = 3.876e-15
Identity = 76/294 (25.85%), Postives = 119/294 (40.48%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHE---PDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHIS 2703
            TG    RC  C K + +      H   HT Q P QC +C K +  K  L NH +SH     F CEIC K F+ K+    H   H    P +  F  K   R+ +   H+R H   S HR                 ++  + E L N    ++   P            +   +  +  R+ +     KC +C K++  K++L  H+++H + ++ + C +C K+F     +  H+R  H       C  C   F  K  L  H   HS+  P+ C +C + F  K +   H+S
Sbjct:  356 TGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRC------------SYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHV--RQHTGESPHKCTYCTKTFTRKEHLTNHVRQH-TGDSPHRCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMS 633          

HSP 3 Score: 62.3882 bits (150), Expect = 3.711e-9
Identity = 35/106 (33.02%), Postives = 54/106 (50.94%), Query Frame = 1
Query: 2389 CNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA 2706
            C+ CGK ++F+  L  H + H S     +CQ C + F T + + +H +  H+    F+C+ C   F    SL RH   HS  KP+AC +C + F  K + D H  +
Sbjct:  223 CDICGKMFQFRYQLIVHRRYH-SERKPFMCQVCGQGFTTSQDLTRHGKI-HIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRS 326          

HSP 4 Score: 56.6102 bits (135), Expect = 2.515e-7
Identity = 33/93 (35.48%), Postives = 49/93 (52.69%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQ----QKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKL 2097
            TG R F C  C K +    +L  H R HT+    ++PF C  C K+F  K  L +H +SH   K  +C +C+K F  +  LK H +++ PD +
Sbjct:  637 TGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM 729          

HSP 5 Score: 55.8398 bits (133), Expect = 3.649e-7
Identity = 38/126 (30.16%), Postives = 54/126 (42.86%), Query Frame = 1
Query: 3529 PEISPIKF-YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSD 3903
            P+ +PI    H C  C   F+    L+ H +  H  R+ F C VC + F+    L  H K HI    F C VC      F +  SL RH++    D    + CT C K +     LD+H +    +
Sbjct:  211 PDGTPIATGTHVCDICGKMFQFRYQLIVH-RRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNV---FANNTSLERHMKRHSTD--KPFACTICQKTFARKEHLDNHFRSHTGE 330          

HSP 6 Score: 54.6842 bits (130), Expect = 7.882e-7
Identity = 75/339 (22.12%), Postives = 113/339 (33.33%), Query Frame = 1
Query:  490 GTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTN----ECTV-----VNDSNQEMNYK---------CVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTI-KLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIK 1449
             TG   C+IC   F  +   + H   H   + F C  C   +    +L  H   IH       C V      N+++ E + K         C IC   F+RK+    H   H  +    C++C   F  K  +  H+  H  GE            +C IC   F      K+HYV  +   +G  P +                              C    K Y +     + M+   N +  +                 C +CGK+F        H + HTG     C  C K FT+K  +  H+  H       C +C K FT + ++  HI+
Sbjct:  217 ATGTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH-TGE---------TPHRCDICKKSFTR----KEHYVNHYMWHTGQTPHQ------------------------------CDVCGKKYTRKEHLANHMRSHTNETPFR-----------------CEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIR 493          

HSP 7 Score: 54.299 bits (129), Expect = 1.163e-6
Identity = 40/112 (35.71%), Postives = 54/112 (48.21%), Query Frame = 1
Query: 1852 CRFCYKLYRKSCDLTRHI-RIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKE----FSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            C  C K + +   L  H+ R HT  +PF C  C KSF LK  L  H +SH K +E    F+CE C K F  K  L  H + H  +K    C +C + F    +L+ H   +H
Sbjct:  615 CNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPH-ACTLCSKAFVERGNLKRHMKMNH 725          
BLAST of Zinc finger, C2H2 type vs. Ensembl Fly
Match: crol (gene:FBgn0020309 transcript:FBtr0305262)

HSP 1 Score: 124.405 bits (311), Expect = 3.401e-28
Identity = 130/512 (25.39%), Postives = 200/512 (39.06%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQ-------SQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLW--NENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH---EPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDV-----KPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNR---RKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C VCG+ F T   L RH   H G   F C +C   F   +S++ HM  H   K F C  C K F  + +++ H +  H   T    Q        +EH++N       E     +  KK  +  E          +  Y+W   + P   +    +   + +  +++ S  N      +      +  +   R +  T  I  H       TG    RC FC K + +   L  H+R HT + P +C  C K+F  K  L NH + H     F C  C K F  K  +  H + H    P K  +  K   R+ +   H+R H   S HR                 ++  + E L N    ++ + P       K     E LN  +       R+ S++    CN C K +  K++L  H+    + +    C+ C KSF    ++  H R+    +   R F+C +CP  FI K  L+ H   HS  KP+AC LC + F  +    RH+
Sbjct:  251 CQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRS-HTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKE--------HYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCE------ICGKSFSRKEHFTNHILWH-------TGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRC------------SYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHM-------RQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHM 721          

HSP 2 Score: 82.0333 bits (201), Expect = 3.876e-15
Identity = 76/294 (25.85%), Postives = 119/294 (40.48%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHE---PDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHIS 2703
            TG    RC  C K + +      H   HT Q P QC +C K +  K  L NH +SH     F CEIC K F+ K+    H   H    P +  F  K   R+ +   H+R H   S HR                 ++  + E L N    ++   P            +   +  +  R+ +     KC +C K++  K++L  H+++H + ++ + C +C K+F     +  H+R  H       C  C   F  K  L  H   HS+  P+ C +C + F  K +   H+S
Sbjct:  356 TGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRC------------SYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHV--RQHTGESPHKCTYCTKTFTRKEHLTNHVRQH-TGDSPHRCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMS 633          

HSP 3 Score: 62.3882 bits (150), Expect = 3.711e-9
Identity = 35/106 (33.02%), Postives = 54/106 (50.94%), Query Frame = 1
Query: 2389 CNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA 2706
            C+ CGK ++F+  L  H + H S     +CQ C + F T + + +H +  H+    F+C+ C   F    SL RH   HS  KP+AC +C + F  K + D H  +
Sbjct:  223 CDICGKMFQFRYQLIVHRRYH-SERKPFMCQVCGQGFTTSQDLTRHGKI-HIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRS 326          

HSP 4 Score: 56.6102 bits (135), Expect = 2.515e-7
Identity = 33/93 (35.48%), Postives = 49/93 (52.69%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQ----QKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKL 2097
            TG R F C  C K +    +L  H R HT+    ++PF C  C K+F  K  L +H +SH   K  +C +C+K F  +  LK H +++ PD +
Sbjct:  637 TGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM 729          

HSP 5 Score: 55.8398 bits (133), Expect = 3.649e-7
Identity = 38/126 (30.16%), Postives = 54/126 (42.86%), Query Frame = 1
Query: 3529 PEISPIKF-YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSD 3903
            P+ +PI    H C  C   F+    L+ H +  H  R+ F C VC + F+    L  H K HI    F C VC      F +  SL RH++    D    + CT C K +     LD+H +    +
Sbjct:  211 PDGTPIATGTHVCDICGKMFQFRYQLIVH-RRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNV---FANNTSLERHMKRHSTD--KPFACTICQKTFARKEHLDNHFRSHTGE 330          

HSP 6 Score: 54.6842 bits (130), Expect = 7.882e-7
Identity = 75/339 (22.12%), Postives = 113/339 (33.33%), Query Frame = 1
Query:  490 GTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTN----ECTV-----VNDSNQEMNYK---------CVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTI-KLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIK 1449
             TG   C+IC   F  +   + H   H   + F C  C   +    +L  H   IH       C V      N+++ E + K         C IC   F+RK+    H   H  +    C++C   F  K  +  H+  H  GE            +C IC   F      K+HYV  +   +G  P +                              C    K Y +     + M+   N +  +                 C +CGK+F        H + HTG     C  C K FT+K  +  H+  H       C +C K FT + ++  HI+
Sbjct:  217 ATGTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH-TGE---------TPHRCDICKKSFTR----KEHYVNHYMWHTGQTPHQ------------------------------CDVCGKKYTRKEHLANHMRSHTNETPFR-----------------CEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIR 493          

HSP 7 Score: 54.299 bits (129), Expect = 1.163e-6
Identity = 40/112 (35.71%), Postives = 54/112 (48.21%), Query Frame = 1
Query: 1852 CRFCYKLYRKSCDLTRHI-RIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKE----FSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            C  C K + +   L  H+ R HT  +PF C  C KSF LK  L  H +SH K +E    F+CE C K F  K  L  H + H  +K    C +C + F    +L+ H   +H
Sbjct:  615 CNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPH-ACTLCSKAFVERGNLKRHMKMNH 725          
BLAST of Zinc finger, C2H2 type vs. Ensembl Fly
Match: crol (gene:FBgn0020309 transcript:FBtr0080261)

HSP 1 Score: 124.405 bits (311), Expect = 3.401e-28
Identity = 130/512 (25.39%), Postives = 200/512 (39.06%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQ-------SQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLW--NENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH---EPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDV-----KPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNR---RKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C VCG+ F T   L RH   H G   F C +C   F   +S++ HM  H   K F C  C K F  + +++ H +  H   T    Q        +EH++N       E     +  KK  +  E          +  Y+W   + P   +    +   + +  +++ S  N      +      +  +   R +  T  I  H       TG    RC FC K + +   L  H+R HT + P +C  C K+F  K  L NH + H     F C  C K F  K  +  H + H    P K  +  K   R+ +   H+R H   S HR                 ++  + E L N    ++ + P       K     E LN  +       R+ S++    CN C K +  K++L  H+    + +    C+ C KSF    ++  H R+    +   R F+C +CP  FI K  L+ H   HS  KP+AC LC + F  +    RH+
Sbjct:  251 CQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRS-HTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKE--------HYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCE------ICGKSFSRKEHFTNHILWH-------TGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRC------------SYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHM-------RQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHM 721          

HSP 2 Score: 82.0333 bits (201), Expect = 3.876e-15
Identity = 76/294 (25.85%), Postives = 119/294 (40.48%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHE---PDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHIS 2703
            TG    RC  C K + +      H   HT Q P QC +C K +  K  L NH +SH     F CEIC K F+ K+    H   H    P +  F  K   R+ +   H+R H   S HR                 ++  + E L N    ++   P            +   +  +  R+ +     KC +C K++  K++L  H+++H + ++ + C +C K+F     +  H+R  H       C  C   F  K  L  H   HS+  P+ C +C + F  K +   H+S
Sbjct:  356 TGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRC------------SYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHV--RQHTGESPHKCTYCTKTFTRKEHLTNHVRQH-TGDSPHRCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMS 633          

HSP 3 Score: 62.3882 bits (150), Expect = 3.711e-9
Identity = 35/106 (33.02%), Postives = 54/106 (50.94%), Query Frame = 1
Query: 2389 CNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA 2706
            C+ CGK ++F+  L  H + H S     +CQ C + F T + + +H +  H+    F+C+ C   F    SL RH   HS  KP+AC +C + F  K + D H  +
Sbjct:  223 CDICGKMFQFRYQLIVHRRYH-SERKPFMCQVCGQGFTTSQDLTRHGKI-HIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRS 326          

HSP 4 Score: 56.6102 bits (135), Expect = 2.515e-7
Identity = 33/93 (35.48%), Postives = 49/93 (52.69%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQ----QKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKL 2097
            TG R F C  C K +    +L  H R HT+    ++PF C  C K+F  K  L +H +SH   K  +C +C+K F  +  LK H +++ PD +
Sbjct:  637 TGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM 729          

HSP 5 Score: 55.8398 bits (133), Expect = 3.649e-7
Identity = 38/126 (30.16%), Postives = 54/126 (42.86%), Query Frame = 1
Query: 3529 PEISPIKF-YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSD 3903
            P+ +PI    H C  C   F+    L+ H +  H  R+ F C VC + F+    L  H K HI    F C VC      F +  SL RH++    D    + CT C K +     LD+H +    +
Sbjct:  211 PDGTPIATGTHVCDICGKMFQFRYQLIVH-RRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNV---FANNTSLERHMKRHSTD--KPFACTICQKTFARKEHLDNHFRSHTGE 330          

HSP 6 Score: 54.6842 bits (130), Expect = 7.882e-7
Identity = 75/339 (22.12%), Postives = 113/339 (33.33%), Query Frame = 1
Query:  490 GTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTN----ECTV-----VNDSNQEMNYK---------CVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTI-KLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIK 1449
             TG   C+IC   F  +   + H   H   + F C  C   +    +L  H   IH       C V      N+++ E + K         C IC   F+RK+    H   H  +    C++C   F  K  +  H+  H  GE            +C IC   F      K+HYV  +   +G  P +                              C    K Y +     + M+   N +  +                 C +CGK+F        H + HTG     C  C K FT+K  +  H+  H       C +C K FT + ++  HI+
Sbjct:  217 ATGTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH-TGE---------TPHRCDICKKSFTR----KEHYVNHYMWHTGQTPHQ------------------------------CDVCGKKYTRKEHLANHMRSHTNETPFR-----------------CEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIR 493          

HSP 7 Score: 54.299 bits (129), Expect = 1.163e-6
Identity = 40/112 (35.71%), Postives = 54/112 (48.21%), Query Frame = 1
Query: 1852 CRFCYKLYRKSCDLTRHI-RIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKE----FSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            C  C K + +   L  H+ R HT  +PF C  C KSF LK  L  H +SH K +E    F+CE C K F  K  L  H + H  +K    C +C + F    +L+ H   +H
Sbjct:  615 CNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPH-ACTLCSKAFVERGNLKRHMKMNH 725          
BLAST of Zinc finger, C2H2 type vs. Ensembl Fly
Match: crol (gene:FBgn0020309 transcript:FBtr0080262)

HSP 1 Score: 118.242 bits (295), Expect = 2.449e-26
Identity = 121/499 (24.25%), Postives = 186/499 (37.27%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQ-------SQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLW--NENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNS----KPYACPLCLRRFKAKI 2682
            C VCG+ F T   L RH   H G   F C +C   F   +S++ HM  H   K F C  C K F  + +++ H +  H   T    Q        +EH++N       E     +  KK  +  E          +  Y+W   + P   +    +   + +  +++ S  N      +      +  +   R +  T  I  H       TG    RC FC K + +   L  H+R HT + P +C  C K+F  K  L NH + H     F C  C K F  K  +  H + H  +     C  C + F    HL     T+H R      P                                 K     E L   +       R  + +   KC +C K++  K++LN H+++H S++N + C  CNK F     +  H+   H   R F+C  C   F  K +L+ H   H+      +P+AC  C + F  K+
Sbjct:  251 CQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRS-HTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKE--------HYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCE------ICGKSFSRKEHFTNHILWH-------TGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPH-KCTYCTKTFTRKEHL-----TNHVRQHTGDSPHRCSYCK--------------------------KTFTRKEHLTNHV-------RLHTGDSPHKCEYCQKTFTRKEHLNNHMRQH-SSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKV 687          

HSP 2 Score: 97.8265 bits (242), Expect = 4.761e-20
Identity = 83/321 (25.86%), Postives = 124/321 (38.63%), Query Frame = 1
Query: 1744 QGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDV--KPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            QG   S+D+ R     G+I +         G   F C  C+ ++  +  L RH++ H+  KPF C +C K+F  K  L NHF+SH     F C+ C K F  K+ +  H + H   +    C IC + F    H   HY                                    T  + +  DV  K     E L   +       R  +N   F+C  CGKS+  K++   H+  H +    + C FC+K+F     +  H+R QH       C  C   F  K  L+ H   H+   P+ C  C + F  K +   H+
Sbjct:  256 QGFTTSQDLTR----HGKIHI---------GGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHT-GETPHRCDICKKSFTRKEHYVNHYMWH---------------------------------TGQTPHQCDVCGKKYTRKEHLANHM-------RSHTNETPFRCEICGKSFSRKEHFTNHILWH-TGETPHRCDFCSKTFTRKEHLLNHVR-QHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHV 520          

HSP 3 Score: 92.0485 bits (227), Expect = 2.980e-18
Identity = 76/294 (25.85%), Postives = 125/294 (42.52%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFH----LRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            TG   FRC++C K + +   +  H+R HT + P +C +C KSF  K    NH+  H       C++C K +  K+ L  H + H  ++  F C+IC + F+   H    + +H   + HR     D         EH      +     P   S     +K     E L   I       R+ +    FKC +C K++  K ++  H+++H +  + + C +C K+F     +  H+R QH       C  C   F  K  L  H  +H+   P+ C  C + F  K + + H+
Sbjct:  328 TGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHT-NETPFRCEICGKSFSRKEHFTNHILWHTGETPHRC----DFCSKTFTRKEHLLNHVRQHTGESPHRCSYC---MKTFTRKEHLVNHI-------RQHTGETPFKCTYCTKAFTRKDHMVNHVRQH-TGESPHKCTYCTKTFTRKEHLTNHVR-QHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHM 604          

HSP 4 Score: 81.6481 bits (200), Expect = 4.654e-15
Identity = 76/294 (25.85%), Postives = 119/294 (40.48%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHE---PDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHIS 2703
            TG    RC  C K + +      H   HT Q P QC +C K +  K  L NH +SH     F CEIC K F+ K+    H   H    P +  F  K   R+ +   H+R H   S HR                 ++  + E L N    ++   P            +   +  +  R+ +     KC +C K++  K++L  H+++H + ++ + C +C K+F     +  H+R  H       C  C   F  K  L  H   HS+  P+ C +C + F  K +   H+S
Sbjct:  356 TGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRC------------SYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHV--RQHTGESPHKCTYCTKTFTRKEHLTNHVRQH-TGDSPHRCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMS 633          

HSP 5 Score: 80.1073 bits (196), Expect = 1.268e-14
Identity = 127/572 (22.20%), Postives = 197/572 (34.44%), Query Frame = 1
Query:  490 GTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTN----ECTV-----VNDSNQEMNYK---------CVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTI-KLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKD--PNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHF-KSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDK---LRFVCKICDRRF 2130
             TG   C+IC   F  +   + H   H   + F C  C   +    +L  H   IH       C V      N+++ E + K         C IC   F+RK+    H   H  +    C++C   F  K  +  H+  H  GE            +C IC   F      K+HYV  +   +G  P +                              C    K Y +     + M+   N +  +                 C +CGK+F        H + HTG     C  C K FT+K  +  H+  H       C +C K FT + ++  HI+            + E     +   +   +KD   N  ++      T +SP      T+       T + H +   NH        P   ++ K  +              R +  T  ++LH       TG    +C +C K + +   L  H+R H+   P  C +C+K F  K  L NH  + H   + F+CE C K F LK  L  H++ H   +     F C+ C + F
Sbjct:  217 ATGTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH-TGE---------TPHRCDICKKSFTR----KEHYVNHYMWHTGQTPHQ------------------------------CDVCGKKYTRKEHLANHMRSHTNETPFR-----------------CEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIR----------QHTGETPFKCTYCTKAFTRKDHMVNHVRQ-----HTGESPHKCTYCTKTF-----TRKEHLT---NHVRQHTGDSPHRCSYCKKTFT-------------RKEHLTNHVRLH-------TGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNF 683          

HSP 6 Score: 62.003 bits (149), Expect = 4.532e-9
Identity = 35/106 (33.02%), Postives = 54/106 (50.94%), Query Frame = 1
Query: 2389 CNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA 2706
            C+ CGK ++F+  L  H + H S     +CQ C + F T + + +H +  H+    F+C+ C   F    SL RH   HS  KP+AC +C + F  K + D H  +
Sbjct:  223 CDICGKMFQFRYQLIVHRRYH-SERKPFMCQVCGQGFTTSQDLTRHGKI-HIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRS 326          

HSP 7 Score: 55.4546 bits (132), Expect = 4.515e-7
Identity = 38/126 (30.16%), Postives = 54/126 (42.86%), Query Frame = 1
Query: 3529 PEISPIKF-YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSD 3903
            P+ +PI    H C  C   F+    L+ H +  H  R+ F C VC + F+    L  H K HI    F C VC      F +  SL RH++    D    + CT C K +     LD+H +    +
Sbjct:  211 PDGTPIATGTHVCDICGKMFQFRYQLIVH-RRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCF---NVFANNTSLERHMKRHSTD--KPFACTICQKTFARKEHLDNHFRSHTGE 330          
BLAST of Zinc finger, C2H2 type vs. Ensembl Fly
Match: jim (gene:FBgn0027339 transcript:FBtr0333213)

HSP 1 Score: 114.39 bits (285), Expect = 3.130e-25
Identity = 97/341 (28.45%), Postives = 140/341 (41.06%), Query Frame = 1
Query: 1156 NRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNEN----PTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERI-----DKETGQ---IQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKI--CDRRFNT 2136
             R+ +  GRP K    S      C  CGK FK    L +H+  HT  + F C  C K F Q+S +  H+ +H N K F C +C ++F     +N HI+ IH       S    HL+ ++         D      +    E N +  D A       +E+    P       Y         SY    +    L     H G+  +     +     DKE  Q   +  H  I  +    R + C  C K +R+   LT+H+RIHT +KPF C  C + FR +++L  H + H   K + C  C K F  K  L  H + H+ D+  F C +  C RRF T
Sbjct:  308 GRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECGKRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIR-IH-------SDVSPHLIFKNGPHPTLWPSD------VPFPGEDNDTKGDIAGTGGGYHDEDSQGTPDGSGGMHY--------PSYFKDGKGQKILPEVLQHIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIES---RPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRP-FCCPMPNCRRRFAT 622          

HSP 2 Score: 98.9821 bits (245), Expect = 1.823e-20
Identity = 81/305 (26.56%), Postives = 121/305 (39.67%), Query Frame = 1
Query: 1837 FRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFN----LKQTLKVHRQLHE-------------PDKLRFVCKICDRRFN-TGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
             R F+C  C K +++   L +H RIHT  +PF C  C K FR +S L  H + H   K F+C  C++ F     L Q +++H  +               P  + F  +  D + +  G    YH   S       PD                        +   + P   K     ++L  P  +  I  R  +     +C  C K +K K  L +H   H+ +     C  C K F     + QHLR  H N + F C+ CP FF  +  L +H  +H+  KPY C  C + F+ K   D+H
Sbjct:  326 LRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECGKRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSDVSPHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQ----GTPDG-----------------------SGGMHYPSYFKDGKGQKIL--PEVLQHIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESR-PYPCPECGKRFRQQSHLTQHLRI-HTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQH 599          

HSP 3 Score: 65.4698 bits (158), Expect = 3.924e-10
Identity = 35/110 (31.82%), Postives = 54/110 (49.09%), Query Frame = 1
Query: 2377 RLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPL--CLRRFKAKIYCDRHI 2700
            R + C  CGK ++ + +L +HL+ H +      C +C + F     + QHLR  H   + + C QC   F  KA L +H   H   +P+ CP+  C RRF  +    +HI
Sbjct:  523 RPYPCPECGKRFRQQSHLTQHLRIHTNEKPFG-CMYCPRFFRQRTILNQHLRI-HTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRPFCCPMPNCRRRFATENEVTKHI 630          

HSP 4 Score: 62.003 bits (149), Expect = 4.976e-9
Identity = 35/117 (29.91%), Postives = 52/117 (44.44%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHK 858
            C IC+ EF  K T L+H  IH   R + C  C   +  + +L  H+  IHTN          E  + C+ C   F ++     H  IH  ++   C  C   F+ K +LD+H   H+
Sbjct:  499 CPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLR-IHTN----------EKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQ 604          

HSP 5 Score: 55.8398 bits (133), Expect = 3.909e-7
Identity = 26/75 (34.67%), Postives = 40/75 (53.33%), Query Frame = 1
Query: 2476 CQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C  C K F    ++ QH R  H + R F C +C   F  ++ L +H  +H+N KP+ CP C R F+ +   ++HI
Sbjct:  331 CLTCGKDFKQKSTLLQHDRI-HTDARPFPCSECGKRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHI 404          

HSP 6 Score: 54.299 bits (129), Expect = 1.198e-6
Identity = 35/121 (28.93%), Postives = 54/121 (44.63%), Query Frame = 1
Query: 3544 IKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIA-CNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSD 3903
            +  Y  C  CD +FK   +L++H    H   R + C  C K F  +  L  H + H + + FGC  C     QR I    L++H+R+   +    Y+C  C K ++    LD H +    D
Sbjct:  493 MPLYVRCPICDKEFKQKTTLLQH-GCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTI----LNQHLRIHTGE--KPYKCGQCGKDFRQKAILDQHTRTHQGD 606          

HSP 7 Score: 52.7582 bits (125), Expect = 3.206e-6
Identity = 36/104 (34.62%), Postives = 50/104 (48.08%), Query Frame = 1
Query: 4246 CSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            C IC K F + + L QH  +H + RPY CP+C KRFR +  L  H   +  +  K   C  C +  R +  L  HL++H  E    C  C K F  +  L +H 
Sbjct:  499 CPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQH--LRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHT 600          

HSP 8 Score: 51.6026 bits (122), Expect = 8.291e-6
Identity = 31/107 (28.97%), Postives = 51/107 (47.66%), Query Frame = 1
Query: 3610 HVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSDYDALIINSN 3930
            H    H   R F C  C K F  K +L  H + H D+R    F C  C +RF     L++H+R+  N+    + C +C++ ++    L+ H++ + SD    +I  N
Sbjct:  318 HKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARP---FPCSECGKRFRQQSHLTQHLRIHANE--KPFTCPYCSRSFRQRAILNQHIR-IHSDVSPHLIFKN 418          
BLAST of Zinc finger, C2H2 type vs. Ensembl Zebrafish
Match: znf236 (zinc finger protein 236 [Source:ZFIN;Acc:ZDB-GENE-041111-195])

HSP 1 Score: 214.927 bits (546), Expect = 1.805e-55
Identity = 201/724 (27.76%), Postives = 312/724 (43.09%), Query Frame = 1
Query:  679 NDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQV-DEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDE-------MKPDVNRS-----ISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASL--------AETNQSP----SDDAEITQYLWNENPTNEN--HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQ-LHEMIKD--QVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLR-FVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKP----TANSNNP-PDV---KPLIWNEL-----------LNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            ++S +    KC +CS  F  +   Q H   H+V D+   C+ CPA F  +  LD H + H           TT+ LKC +C   F  V ++K H V  H K       E G       ++   +EE  +      S   C+T       ++QL E       ++P +  S     I +RG             + C  CGK FK P  L RH   HTG + ++C  C K F QK  ++ HM     V  F C  C   +    ++N HI  +H +  EV   + + +  + +      +        I  L        A++ Q+P    +  A I Q +  +   N        QP  QS+++       + +    D      +L  D   I ++   I+   +M+ +  Q  G R   C +C K ++K  DL RHIRIHT +KP++C  C ++F +KS L  H K H  +K F C+ C K F+   ++KVH++LH    LR F C  C++ F T  H + H + SH +SI +                 +      KP     + SN P PD+   +P++  ++           L Q + I E       N R +KC +C K+YK   +L +H++ H +      C  C+K F +   ++ H+RT H   + F CL C   F T  SL RH   HS+ +PY CP C + FK+   C +H+
Sbjct:   25 SESQKHAENKCNVCSQNFPSESQLQRHLRDHEVNDKPYRCDQCPASFNVEYNLDLHKSTH-----------TTSELKCPVCQKKFSRVASLKAH-VMIHEKEENFLCSECGDEFILQSQLSVHLEEHRQELSGAKS-YTCKTCSKEFVTQNQLREHLKSHAKIRPIITSSRNYKNIDRRG-----------FKNICHHCGKTFKKPSQLVRHIRIHTGERPYKCSHCGKSFNQKVVLQTHMAA--GVPLFPCMDCSCVYKKLGSLNAHISKMHISVMEVEEPATQKVHAQVDQGAVGSEGPEGVTDVIQQLLELSDHVTADSAQAPPPGQTIGAAINQDILQQALENSGLTEIPVQPETQSSSEKLQSDTVSPMASSTDGPVPSKILMTDTIVIKEKRNIIKKPTQMLGNIRQENGVRWHGCPYCSKEFKKPSDLVRHIRIHTHEKPYKCKQCFRAFAVKSTLTAHMKIHTGIKAFECQHCKKCFSTSGSMKVHQRLH--TGLRPFPCPHCEKYFRTSGHRKTHVA-SHFKSIHH-----------------KKHKYPRKPHKTRVSRSNLPLPDIPLQEPILITDMGLLQNQSSRATLQQYLDIVE-------NERPYKCGYCSKAYKKSSHLKQHVRSH-TGERPYKCLQCSKGFASSGVLKAHIRT-HSGLKAFKCLICDTTFTTSGSLRRHTTTHSDMRPYMCPYCQKTFKSSPNCRKHM 693          

HSP 2 Score: 156.377 bits (394), Expect = 1.655e-37
Identity = 145/555 (26.13%), Postives = 236/555 (42.52%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHK----------------------NGTE------VLSQSQEHLLNE----SNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQ-YLWNENPTNENHFSYQPNHQSN--------TDSYIPSAENFIKLDWDKSHQGIL--LSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNK---------PTAN-SNNPPDVKPLIWNELLNQPIP----IAEIDKR--KLSNNRLF--KCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA 2706
            C  C K F +  +L+ H  TH+G+K F+C IC   FT   S++ H   H +++ ++C +C K F    N   H+K  H+                      +GTE      V++  Q+  L E      +     Q    +F+  A    T + P+    +TQ +  +E  T + HFS     Q +        T SY P   N + +   ++  G+L   S+   ++  +T   Q  + +  +V     ++C  C K ++KS  L +H+R HT +KP++C +C +SF    VLK+H  +H  +K + C +C   F    +L  H  +H   K  F C +CD  F T    R H    H      P          E     +    +N+          TA  +   P  +  +  ++L Q       I+E+  +  +L+    F  +C +C KS+K    L  H++ H +      C  C KSF    ++  H++T H  ++ FSC  C   F TK SL  H  +H+ SKP+ CP C  RF+   +   HI  
Sbjct:  620 CLQCSKGFASSGVLKAHIRTHSGLKAFKCLICDTTFTTSGSLRRHTTTHSDMRPYMCPYCQKTFKSSPNCRKHMKT-HRYELAQQLQQQQGSTDMQSTAAVDGTETQSILEVVTDVQQVTLGEDPLQETESFVSAQHALPQFEAPALPQSTFEQPT----MTQGFTISEGFTQQAHFSTVQQLQDSSTLESQDLTASYHPP--NLLHVTHTET-SGLLQEASQGELQLSIQTQSFQDEDELSKRV-----YQCSLCDKGFKKSSHLKQHVRSHTGEKPYRCNICGRSFVSSGVLKSHLNTHTGVKAYKCNVCETCFTTNGSLNRHMIIHLNTK-PFKCIVCDESFRTVMLRRKHMKLLH---AVGPKVLETDEAGEEDDGSDRSGLKRNRNGIITLTEEQTAELAKRDPGDEASLSEKVLAQTAAERDRISEVKDKCVELNTEPKFANRCQYCPKSFKKPSDLVRHIRIH-TGEKPYKCDECGKSFTVKSTLDCHVKT-HSGQKLFSCHMCNTSFSTKGSLKVHMRLHTGSKPFKCPFCDLRFRTSGHRKTHIQG 1155          

HSP 3 Score: 88.9669 bits (219), Expect = 4.864e-17
Identity = 45/141 (31.91%), Postives = 73/141 (51.77%), Query Frame = 1
Query: 1744 QGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            Q  +L  D+  +  ++ +  L + + D V   R ++C +C K Y+KS  L +H+R HT ++P++C  C K F    VLK H ++H  LK F C IC+  F    +L+ H   H  D   ++C  C + F +  + R H  T
Sbjct:  557 QEPILITDMGLLQNQSSRATLQQYL-DIVENERPYKCGYCSKAYKKSSHLKQHVRSHTGERPYKCLQCSKGFASSGVLKAHIRTHSGLKAFKCLICDTTFTTSGSLRRHTTTHS-DMRPYMCPYCQKTFKSSPNCRKHMKT 695          

HSP 4 Score: 84.3445 bits (207), Expect = 1.303e-15
Identity = 76/295 (25.76%), Postives = 116/295 (39.32%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHI----KVIHKNGTEVLSQSQEHLLNESNXXXXXXQ-KDPNRFKKIASLAETNQSPSDDAEITQYL---WNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIF----NLKQTLKVHR 2073
            C  C +AF     L  H   HTGIK FEC  CKK F+   S+K+H  +H  ++ F C  C K F    +  TH+    K IH    +   +  +  ++ SN    +   ++P     +  L    Q+ S  A + QYL    NE P    + S      S+   ++            +SH G                              R ++C  C K +  S  L  HIR H+  K F+C +C  +F     L+ H  +H  ++ + C  C K F    N ++ +K HR
Sbjct:  448 CKQCFRAFAVKSTLTAHMKIHTGIKAFECQHCKKCFSTSGSMKVHQRLHTGLRPFPCPHCEKYFRTSGHRKTHVASHFKSIHHKKHKYPRKPHKTRVSRSNLPLPDIPLQEPILITDMGLL----QNQSSRATLQQYLDIVENERPYKCGYCSKAYKKSSHLKQHV------------RSHTG-----------------------------ERPYKCLQCSKGFASSGVLKAHIRTHSGLKAFKCLICDTTFTTSGSLRRHTTTHSDMRPYMCPYCQKTFKSSPNCRKHMKTHR 697          

HSP 5 Score: 77.0258 bits (188), Expect = 1.948e-13
Identity = 35/78 (44.87%), Postives = 47/78 (60.26%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH 1458
            C  C KAF  P  L RH  THTG + F+CP+C K F QKS++++H V H   K + C+ C  +FT + NM  H+K  H
Sbjct: 1607 CPNCDKAFAKPSQLERHNRTHTGERPFKCPLCDKAFNQKSALQVHRVKHTGEKPYRCEVCTISFTQKSNMKLHMKRSH 1684          

HSP 6 Score: 68.9366 bits (167), Expect = 5.565e-11
Identity = 68/247 (27.53%), Postives = 109/247 (44.13%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYD-----NHFCVGLKAEKSHLNRC--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            Y CS+C KGF ++S+L+QH+  HT  +PY+C  C + F     LK+H  T H+ V K  +C++C     +  +L  H+ +H+      C VC + F       +H+   HA     +E    G +  G   S    + +      ++   E+    P      LS   +  T A+ D        CV L  E    NRC  C K+F+  S  + H++ +H     Y C +C   F  +S+   H K+
Sbjct:  857 YQCSLCDKGFKKSSHLKQHVRSHTGEKPYRCNICGRSFVSSGVLKSHLNT-HTGV-KAYKCNVCETCFTTNGSLNRHMIIHLNTKPFKCIVCDESFRTVMLRRKHMKLLHAVGPKVLETDEAGEEDDGSDRSGLKRNRNGIITLTEEQTAELAKRDPGDEAS-LSEKVLAQTAAERDRISEVKDKCVELNTEPKFANRCQYCPKSFKKPSDLVRHIR-IHTGEKPYKCDECGKSFTVKSTLDCHVKT 1099          

HSP 7 Score: 68.9366 bits (167), Expect = 6.314e-11
Identity = 48/158 (30.38%), Postives = 74/158 (46.84%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHE-NDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPK 978
            C +C   FPS+    +H+  HE ND+ ++C  C  S+N E NL +H +   T+E             KC +C   FSR  + +AH +IH+ +E   C  C   F  +  L  HL +H+  +E    K  T    CK C   F     +++H ++ H K
Sbjct:   35 CNVCSQNFPSESQLQRHLRDHEVNDKPYRCDQCPASFNVEYNLDLHKSTHTTSE------------LKCPVCQKKFSRVASLKAHVMIHEKEENFLCSECGDEFILQSQLSVHLEEHR--QELSGAKSYT----CKTCSKEFVTQNQLREH-LKSHAK 173          

HSP 8 Score: 68.1662 bits (165), Expect = 1.083e-10
Identity = 37/127 (29.13%), Postives = 63/127 (49.61%), Query Frame = 1
Query: 2383 FKCNHCGKSYKFKKYLNEHLKEH---LSANNTNVCQFCNKSFVTYRSMQQHLRT--------------QHLNRRKFS--CLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA 2706
            F C+ CG  +  +  L+ HL+EH   LS   +  C+ C+K FVT   +++HL++              ++++RR F   C  C   F   + L+RH  +H+  +PY C  C + F  K+    H++A
Sbjct:  117 FLCSECGDEFILQSQLSVHLEEHRQELSGAKSYTCKTCSKEFVTQNQLREHLKSHAKIRPIITSSRNYKNIDRRGFKNICHHCGKTFKKPSQLVRHIRIHTGERPYKCSHCGKSFNQKVVLQTHMAA 243          

HSP 9 Score: 67.0106 bits (162), Expect = 2.235e-10
Identity = 31/77 (40.26%), Postives = 43/77 (55.84%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVH 2070
            R F+C  C K + K   L RH R HT ++PF+C +C K+F  KS L+ H   H   K + CE+C   F  K  +K+H
Sbjct: 1603 RMFKCPNCDKAFAKPSQLERHNRTHTGERPFKCPLCDKAFNQKSALQVHRVKHTGEKPYRCEVCTISFTQKSNMKLH 1679          

HSP 10 Score: 65.4698 bits (158), Expect = 7.148e-10
Identity = 36/111 (32.43%), Postives = 56/111 (50.45%), Query Frame = 1
Query: 3553 YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            +HGC  C  +FK    LV H++  H   + + C  C +AF+ K +L AH K H   ++F C  C  C   F +  S+  H R+  +  L  + C HC K ++T+    +HV
Sbjct:  417 WHGCPYCSKEFKKPSDLVRHIRI-HTHEKPYKCKQCFRAFAVKSTLTAHMKIHTGIKAFECQHCKKC---FSTSGSMKVHQRL--HTGLRPFPCPHCEKYFRTSGHRKTHV 521          

HSP 11 Score: 63.1586 bits (152), Expect = 3.149e-9
Identity = 36/114 (31.58%), Postives = 58/114 (50.88%), Query Frame = 1
Query: 1852 CRFCYKLYRKSCDLTRHIRIHTQ-----QKP--FQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            C  C K ++++  L  H  +H +      KP  F+C  C K+F   S L+ H ++H   + F C +C+K FN K  L+VHR  H  +K  + C++C   F    +++ H   SH
Sbjct: 1572 CHVCNKAFKRATHLKEHEYVHKKGPKVNSKPRMFKCPNCDKAFAKPSQLERHNRTHTGERPFKCPLCDKAFNQKSALQVHRVKHTGEK-PYRCEVCTISFTQKSNMKLHMKRSH 1684          

HSP 12 Score: 60.4622 bits (145), Expect = 2.319e-8
Identity = 36/109 (33.03%), Postives = 55/109 (50.46%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C   +K S  L +HV+S H   R + C  C K F++   L AH +TH   ++F C +   C+  F +  SL RH    H+D +  Y C +C K +K++     H+K
Sbjct:  592 CGYCSKAYKKSSHLKQHVRS-HTGERPYKCLQCSKGFASSGVLKAHIRTHSGLKAFKCLI---CDTTFTTSGSLRRHT-TTHSD-MRPYMCPYCQKTFKSSPNCRKHMK 694          

HSP 13 Score: 59.3066 bits (142), Expect = 5.383e-8
Identity = 36/116 (31.03%), Postives = 62/116 (53.45%), Query Frame = 1
Query: 3547 KFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQL 3894
            K  + C+ CD  FK S  L +HV+S H   + + CN+C ++F +   L +H  TH   +++ C VC  C   F +  SL+RH+ +  + N   ++C  C++ ++T      H+K L
Sbjct:  854 KRVYQCSLCDKGFKKSSHLKQHVRS-HTGEKPYRCNICGRSFVSSGVLKSHLNTHTGVKAYKCNVCETC---FTTNGSLNRHMII--HLNTKPFKCIVCDESFRTVMLRRKHMKLL 963          

HSP 14 Score: 55.8398 bits (133), Expect = 5.412e-7
Identity = 33/114 (28.95%), Postives = 57/114 (50.00%), Query Frame = 1
Query: 3547 KFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            KF + C  C   FK    LV H++  H   + + C+ C K+F+ K +L  H KTH   + F C +   CN  F +  SL  H+R+  +     ++C  C+  ++T+    +H++
Sbjct: 1047 KFANRCQYCPKSFKKPSDLVRHIRI-HTGEKPYKCDECGKSFTVKSTLDCHVKTHSGQKLFSCHM---CNTSFSTKGSLKVHMRL--HTGSKPFKCPFCDLRFRTSGHRKTHIQ 1154          

HSP 15 Score: 54.6842 bits (130), Expect = 1.165e-6
Identity = 32/125 (25.60%), Postives = 57/125 (45.60%), Query Frame = 1
Query: 2323 LNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQH----LRTQHLNR--RKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAK 2679
            LN  +  ++++++     R  +C +CG+       L  H ++    +  +VC  CNK+F     +++H     +   +N   R F C  C   F   + L RH   H+  +P+ CPLC + F  K
Sbjct: 1521 LNTQMMDSQLEEKDAEARRKHQCYYCGELMLTANSLRRHCRQTHGKDRCHVCHVCNKAFKRATHLKEHEYVHKKGPKVNSKPRMFKCPNCDKAFAKPSQLERHNRTHTGERPFKCPLCDKAFNQK 1645          

HSP 16 Score: 53.9138 bits (128), Expect = 2.247e-6
Identity = 35/117 (29.91%), Postives = 51/117 (43.59%), Query Frame = 1
Query: 2368 SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNV------CQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
              +R   C+ C K++K   +L EH   H      N       C  C+K+F     +++H RT H   R F C  C   F  K++L  H + H+  KPY C +C   F  K     H+
Sbjct: 1565 GKDRCHVCHVCNKAFKRATHLKEHEYVHKKGPKVNSKPRMFKCPNCDKAFAKPSQLERHNRT-HTGERPFKCPLCDKAFNQKSALQVHRVKHTGEKPYRCEVCTISFTQKSNMKLHM 1680          

HSP 17 Score: 52.7582 bits (125), Expect = 4.482e-6
Identity = 34/114 (29.82%), Postives = 56/114 (49.12%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIR-IHTQQKPFQCYMCHKSFRLKSVLKNHFKSH-------WKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYH 2157
            R+ +C +C +L   +  L RH R  H + +   C++C+K+F+  + LK H   H        K + F C  C+K F     L+ H + H  ++  F C +CD+ FN    L+ H
Sbjct: 1539 RKHQCYYCGELMLTANSLRRHCRQTHGKDRCHVCHVCNKAFKRATHLKEHEYVHKKGPKVNSKPRMFKCPNCDKAFAKPSQLERHNRTHTGER-PFKCPLCDKAFNQKSALQVH 1651          

HSP 18 Score: 52.373 bits (124), Expect = 5.918e-6
Identity = 34/107 (31.78%), Postives = 47/107 (43.93%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            PY C  C K + ++S+L+QH+  HT  RPY+C +C K F     LK H  T HS +              S  +LR H   H       C  C K F    +  +H+
Sbjct:  589 PYKCGYCSKAYKKSSHLKQHVRSHTGERPYKCLQCSKGFASSGVLKAHIRT-HSGLKAFKCLICDTTFTTSG-SLRRHTTTHSDMRPYMCPYCQKTFKSSPNCRKHM 693          
BLAST of Zinc finger, C2H2 type vs. Ensembl Zebrafish
Match: znf236 (zinc finger protein 236 [Source:ZFIN;Acc:ZDB-GENE-041111-195])

HSP 1 Score: 214.157 bits (544), Expect = 2.827e-55
Identity = 205/756 (27.12%), Postives = 318/756 (42.06%), Query Frame = 1
Query:  679 NDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQV-DEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDE-------MKPDVNRS-----ISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNM--------------------------------NTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASL--------AETNQSP----SDDAEITQYLWNENPTNEN--HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQ-LHEMIKD--QVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLR-FVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKP----TANSNNP-PDV---KPLIWNEL-----------LNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            ++S +    KC +CS  F  +   Q H   H+V D+   C+ CPA F  +  LD H + H           TT+ LKC +C   F  V ++K H V  H K       E G       ++   +EE  +      S   C+T       ++QL E       ++P +  S     I +RG             + C  CGK FK P  L RH   HTG + ++C  C K F QK  ++ HMV H   K  +CQ C  +F+ + N+                                N HI  +H +  EV   + + +  + +      +        I  L        A++ Q+P    +  A I Q +  +   N        QP  QS+++       + +    D      +L  D   I ++   I+   +M+ +  Q  G R   C +C K ++K  DL RHIRIHT +KP++C  C ++F +KS L  H K H  +K F C+ C K F+   ++KVH++LH    LR F C  C++ F T  H + H + SH +SI +                 +      KP     + SN P PD+   +P++  ++           L Q + I E       N R +KC +C K+YK   +L +H++ H +      C  C+K F +   ++ H+RT H   + F CL C   F T  SL RH   HS+ +PY CP C + FK+   C +H+
Sbjct:   25 SESQKHAENKCNVCSQNFPSESQLQRHLRDHEVNDKPYRCDQCPASFNVEYNLDLHKSTH-----------TTSELKCPVCQKKFSRVASLKAH-VMIHEKEENFLCSECGDEFILQSQLSVHLEEHRQELSGAKS-YTCKTCSKEFVTQNQLREHLKSHAKIRPIITSSRNYKNIDRRG-----------FKNICHHCGKTFKKPSQLVRHIRIHTGERPYKCSHCGKSFNQKVVLQTHMVRHTGEKPHMCQHCPASFSQKGNLHSHVQRVHSQAAGVPLFPCMDCSCVYKKLGSLNAHISKMHISVMEVEEPATQKVHAQVDQGAVGSEGPEGVTDVIQQLLELSDHVTADSAQAPPPGQTIGAAINQDILQQALENSGLTEIPVQPETQSSSEKLQSDTVSPMASSTDGPVPSKILMTDTIVIKEKRNIIKKPTQMLGNIRQENGVRWHGCPYCSKEFKKPSDLVRHIRIHTHEKPYKCKQCFRAFAVKSTLTAHMKIHTGIKAFECQHCKKCFSTSGSMKVHQRLH--TGLRPFPCPHCEKYFRTSGHRKTHVA-SHFKSIHH-----------------KKHKYPRKPHKTRVSRSNLPLPDIPLQEPILITDMGLLQNQSSRATLQQYLDIVE-------NERPYKCGYCSKAYKKSSHLKQHVRSH-TGERPYKCLQCSKGFASSGVLKAHIRT-HSGLKAFKCLICDTTFTTSGSLRRHTTTHSDMRPYMCPYCQKTFKSSPNCRKHM 727          

HSP 2 Score: 155.992 bits (393), Expect = 2.002e-37
Identity = 145/555 (26.13%), Postives = 236/555 (42.52%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHK----------------------NGTE------VLSQSQEHLLNE----SNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQ-YLWNENPTNENHFSYQPNHQSN--------TDSYIPSAENFIKLDWDKSHQGIL--LSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNK---------PTAN-SNNPPDVKPLIWNELLNQPIP----IAEIDKR--KLSNNRLF--KCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA 2706
            C  C K F +  +L+ H  TH+G+K F+C IC   FT   S++ H   H +++ ++C +C K F    N   H+K  H+                      +GTE      V++  Q+  L E      +     Q    +F+  A    T + P+    +TQ +  +E  T + HFS     Q +        T SY P   N + +   ++  G+L   S+   ++  +T   Q  + +  +V     ++C  C K ++KS  L +H+R HT +KP++C +C +SF    VLK+H  +H  +K + C +C   F    +L  H  +H   K  F C +CD  F T    R H    H      P          E     +    +N+          TA  +   P  +  +  ++L Q       I+E+  +  +L+    F  +C +C KS+K    L  H++ H +      C  C KSF    ++  H++T H  ++ FSC  C   F TK SL  H  +H+ SKP+ CP C  RF+   +   HI  
Sbjct:  654 CLQCSKGFASSGVLKAHIRTHSGLKAFKCLICDTTFTTSGSLRRHTTTHSDMRPYMCPYCQKTFKSSPNCRKHMKT-HRYELAQQLQQQQGSTDMQSTAAVDGTETQSILEVVTDVQQVTLGEDPLQETESFVSAQHALPQFEAPALPQSTFEQPT----MTQGFTISEGFTQQAHFSTVQQLQDSSTLESQDLTASYHPP--NLLHVTHTET-SGLLQEASQGELQLSIQTQSFQDEDELSKRV-----YQCSLCDKGFKKSSHLKQHVRSHTGEKPYRCNICGRSFVSSGVLKSHLNTHTGVKAYKCNVCETCFTTNGSLNRHMIIHLNTK-PFKCIVCDESFRTVMLRRKHMKLLH---AVGPKVLETDEAGEEDDGSDRSGLKRNRNGIITLTEEQTAELAKRDPGDEASLSEKVLAQTAAERDRISEVKDKCVELNTEPKFANRCQYCPKSFKKPSDLVRHIRIH-TGEKPYKCDECGKSFTVKSTLDCHVKT-HSGQKLFSCHMCNTSFSTKGSLKVHMRLHTGSKPFKCPFCDLRFRTSGHRKTHIQG 1189          

HSP 3 Score: 88.9669 bits (219), Expect = 4.932e-17
Identity = 45/141 (31.91%), Postives = 73/141 (51.77%), Query Frame = 1
Query: 1744 QGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            Q  +L  D+  +  ++ +  L + + D V   R ++C +C K Y+KS  L +H+R HT ++P++C  C K F    VLK H ++H  LK F C IC+  F    +L+ H   H  D   ++C  C + F +  + R H  T
Sbjct:  591 QEPILITDMGLLQNQSSRATLQQYL-DIVENERPYKCGYCSKAYKKSSHLKQHVRSHTGERPYKCLQCSKGFASSGVLKAHIRTHSGLKAFKCLICDTTFTTSGSLRRHTTTHS-DMRPYMCPYCQKTFKSSPNCRKHMKT 729          

HSP 4 Score: 84.3445 bits (207), Expect = 1.378e-15
Identity = 76/295 (25.76%), Postives = 116/295 (39.32%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHI----KVIHKNGTEVLSQSQEHLLNESNXXXXXXQ-KDPNRFKKIASLAETNQSPSDDAEITQYL---WNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIF----NLKQTLKVHR 2073
            C  C +AF     L  H   HTGIK FEC  CKK F+   S+K+H  +H  ++ F C  C K F    +  TH+    K IH    +   +  +  ++ SN    +   ++P     +  L    Q+ S  A + QYL    NE P    + S      S+   ++            +SH G                              R ++C  C K +  S  L  HIR H+  K F+C +C  +F     L+ H  +H  ++ + C  C K F    N ++ +K HR
Sbjct:  482 CKQCFRAFAVKSTLTAHMKIHTGIKAFECQHCKKCFSTSGSMKVHQRLHTGLRPFPCPHCEKYFRTSGHRKTHVASHFKSIHHKKHKYPRKPHKTRVSRSNLPLPDIPLQEPILITDMGLL----QNQSSRATLQQYLDIVENERPYKCGYCSKAYKKSSHLKQHV------------RSHTG-----------------------------ERPYKCLQCSKGFASSGVLKAHIRTHSGLKAFKCLICDTTFTTSGSLRRHTTTHSDMRPYMCPYCQKTFKSSPNCRKHMKTHR 731          

HSP 5 Score: 77.0258 bits (188), Expect = 2.058e-13
Identity = 35/78 (44.87%), Postives = 47/78 (60.26%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH 1458
            C  C KAF  P  L RH  THTG + F+CP+C K F QKS++++H V H   K + C+ C  +FT + NM  H+K  H
Sbjct: 1641 CPNCDKAFAKPSQLERHNRTHTGERPFKCPLCDKAFNQKSALQVHRVKHTGEKPYRCEVCTISFTQKSNMKLHMKRSH 1718          

HSP 6 Score: 68.9366 bits (167), Expect = 6.391e-11
Identity = 68/247 (27.53%), Postives = 109/247 (44.13%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYD-----NHFCVGLKAEKSHLNRC--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            Y CS+C KGF ++S+L+QH+  HT  +PY+C  C + F     LK+H  T H+ V K  +C++C     +  +L  H+ +H+      C VC + F       +H+   HA     +E    G +  G   S    + +      ++   E+    P      LS   +  T A+ D        CV L  E    NRC  C K+F+  S  + H++ +H     Y C +C   F  +S+   H K+
Sbjct:  891 YQCSLCDKGFKKSSHLKQHVRSHTGEKPYRCNICGRSFVSSGVLKSHLNT-HTGV-KAYKCNVCETCFTTNGSLNRHMIIHLNTKPFKCIVCDESFRTVMLRRKHMKLLHAVGPKVLETDEAGEEDDGSDRSGLKRNRNGIITLTEEQTAELAKRDPGDEAS-LSEKVLAQTAAERDRISEVKDKCVELNTEPKFANRCQYCPKSFKKPSDLVRHIR-IHTGEKPYKCDECGKSFTVKSTLDCHVKT 1133          

HSP 7 Score: 68.9366 bits (167), Expect = 6.780e-11
Identity = 48/158 (30.38%), Postives = 74/158 (46.84%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHE-NDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPK 978
            C +C   FPS+    +H+  HE ND+ ++C  C  S+N E NL +H +   T+E             KC +C   FSR  + +AH +IH+ +E   C  C   F  +  L  HL +H+  +E    K  T    CK C   F     +++H ++ H K
Sbjct:   35 CNVCSQNFPSESQLQRHLRDHEVNDKPYRCDQCPASFNVEYNLDLHKSTHTTSE------------LKCPVCQKKFSRVASLKAHVMIHEKEENFLCSECGDEFILQSQLSVHLEEHR--QELSGAKSYT----CKTCSKEFVTQNQLREH-LKSHAK 173          

HSP 8 Score: 67.0106 bits (162), Expect = 2.300e-10
Identity = 31/77 (40.26%), Postives = 43/77 (55.84%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVH 2070
            R F+C  C K + K   L RH R HT ++PF+C +C K+F  KS L+ H   H   K + CE+C   F  K  +K+H
Sbjct: 1637 RMFKCPNCDKAFAKPSQLERHNRTHTGERPFKCPLCDKAFNQKSALQVHRVKHTGEKPYRCEVCTISFTQKSNMKLH 1713          

HSP 9 Score: 65.4698 bits (158), Expect = 7.544e-10
Identity = 36/111 (32.43%), Postives = 56/111 (50.45%), Query Frame = 1
Query: 3553 YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            +HGC  C  +FK    LV H++  H   + + C  C +AF+ K +L AH K H   ++F C  C  C   F +  S+  H R+  +  L  + C HC K ++T+    +HV
Sbjct:  451 WHGCPYCSKEFKKPSDLVRHIRI-HTHEKPYKCKQCFRAFAVKSTLTAHMKIHTGIKAFECQHCKKC---FSTSGSMKVHQRL--HTGLRPFPCPHCEKYFRTSGHRKTHV 555          

HSP 10 Score: 63.1586 bits (152), Expect = 3.379e-9
Identity = 36/114 (31.58%), Postives = 58/114 (50.88%), Query Frame = 1
Query: 1852 CRFCYKLYRKSCDLTRHIRIHTQ-----QKP--FQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            C  C K ++++  L  H  +H +      KP  F+C  C K+F   S L+ H ++H   + F C +C+K FN K  L+VHR  H  +K  + C++C   F    +++ H   SH
Sbjct: 1606 CHVCNKAFKRATHLKEHEYVHKKGPKVNSKPRMFKCPNCDKAFAKPSQLERHNRTHTGERPFKCPLCDKAFNQKSALQVHRVKHTGEK-PYRCEVCTISFTQKSNMKLHMKRSH 1718          

HSP 11 Score: 60.8474 bits (146), Expect = 1.592e-8
Identity = 70/337 (20.77%), Postives = 133/337 (39.47%), Query Frame = 1
Query:  475 YKTINGTG-KQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEE------LPCEHCPALFKCKVLLDKHLNDHKIG----EECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            YK I+  G K  C  C   F      ++H+ IH  +R +KCS C  S+N +V L  H+ + HT           E  + C  C   FS+K    +H  + +V  +       PC  C  ++K    L+ H++   I     EE   +K+     +  +  +  E V +V +  +    + S H   +      P + +   I ++      ++S +    I +  + +S  ++++ D    ++                          K P  +  +     G++   CP C K F + S +  H+ +H + K + C+ C +AF  +  +  H+K+
Sbjct:  184 YKNIDRRGFKNICHHCGKTFKKPSQLVRHIRIHTGERPYKCSHCGKSFNQKVVLQTHM-VRHTG----------EKPHMCQHCPASFSQKGNLHSH--VQRVHSQAAGVPLFPCMDCSCVYKKLGSLNAHISKMHISVMEVEEPATQKVHAQVDQGAVGSEGPEGVTDVIQQLL----ELSDHVTADSAQAPPPGQTIGAAINQDILQQALENSGLT--EIPVQPETQSSSEKLQSDTVSPMASSTDGPVPSKILMTDTIVIKEKRNIIKKPTQMLGNIRQENGVRWHGCPYCSKEFKKPSDLVRHIRIHTHEKPYKCKQCFRAFAVKSTLTAHMKI 501          

HSP 12 Score: 60.4622 bits (145), Expect = 2.488e-8
Identity = 36/109 (33.03%), Postives = 55/109 (50.46%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C   +K S  L +HV+S H   R + C  C K F++   L AH +TH   ++F C +   C+  F +  SL RH    H+D +  Y C +C K +K++     H+K
Sbjct:  626 CGYCSKAYKKSSHLKQHVRS-HTGERPYKCLQCSKGFASSGVLKAHIRTHSGLKAFKCLI---CDTTFTTSGSLRRHT-TTHSD-MRPYMCPYCQKTFKSSPNCRKHMK 728          

HSP 13 Score: 59.3066 bits (142), Expect = 5.776e-8
Identity = 36/116 (31.03%), Postives = 62/116 (53.45%), Query Frame = 1
Query: 3547 KFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQL 3894
            K  + C+ CD  FK S  L +HV+S H   + + CN+C ++F +   L +H  TH   +++ C VC  C   F +  SL+RH+ +  + N   ++C  C++ ++T      H+K L
Sbjct:  888 KRVYQCSLCDKGFKKSSHLKQHVRS-HTGEKPYRCNICGRSFVSSGVLKSHLNTHTGVKAYKCNVCETC---FTTNGSLNRHMII--HLNTKPFKCIVCDESFRTVMLRRKHMKLL 997          

HSP 14 Score: 55.8398 bits (133), Expect = 5.904e-7
Identity = 33/114 (28.95%), Postives = 57/114 (50.00%), Query Frame = 1
Query: 3547 KFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            KF + C  C   FK    LV H++  H   + + C+ C K+F+ K +L  H KTH   + F C +   CN  F +  SL  H+R+  +     ++C  C+  ++T+    +H++
Sbjct: 1081 KFANRCQYCPKSFKKPSDLVRHIRI-HTGEKPYKCDECGKSFTVKSTLDCHVKTHSGQKLFSCHM---CNTSFSTKGSLKVHMRL--HTGSKPFKCPFCDLRFRTSGHRKTHIQ 1188          

HSP 15 Score: 55.0694 bits (131), Expect = 1.101e-6
Identity = 32/125 (25.60%), Postives = 57/125 (45.60%), Query Frame = 1
Query: 2323 LNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQH----LRTQHLNR--RKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAK 2679
            LN  +  ++++++     R  +C +CG+       L  H ++    +  +VC  CNK+F     +++H     +   +N   R F C  C   F   + L RH   H+  +P+ CPLC + F  K
Sbjct: 1555 LNTQMMDSQLEEKDAEARRKHQCYYCGELMLTANSLRRHCRQTHGKDRCHVCHVCNKAFKRATHLKEHEYVHKKGPKVNSKPRMFKCPNCDKAFAKPSQLERHNRTHTGERPFKCPLCDKAFNQK 1679          

HSP 16 Score: 53.9138 bits (128), Expect = 2.234e-6
Identity = 35/117 (29.91%), Postives = 51/117 (43.59%), Query Frame = 1
Query: 2368 SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNV------CQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
              +R   C+ C K++K   +L EH   H      N       C  C+K+F     +++H RT H   R F C  C   F  K++L  H + H+  KPY C +C   F  K     H+
Sbjct: 1599 GKDRCHVCHVCNKAFKRATHLKEHEYVHKKGPKVNSKPRMFKCPNCDKAFAKPSQLERHNRT-HTGERPFKCPLCDKAFNQKSALQVHRVKHTGEKPYRCEVCTISFTQKSNMKLHM 1714          

HSP 17 Score: 52.7582 bits (125), Expect = 4.647e-6
Identity = 34/114 (29.82%), Postives = 56/114 (49.12%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIR-IHTQQKPFQCYMCHKSFRLKSVLKNHFKSH-------WKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYH 2157
            R+ +C +C +L   +  L RH R  H + +   C++C+K+F+  + LK H   H        K + F C  C+K F     L+ H + H  ++  F C +CD+ FN    L+ H
Sbjct: 1573 RKHQCYYCGELMLTANSLRRHCRQTHGKDRCHVCHVCNKAFKRATHLKEHEYVHKKGPKVNSKPRMFKCPNCDKAFAKPSQLERHNRTHTGER-PFKCPLCDKAFNQKSALQVH 1685          

HSP 18 Score: 52.373 bits (124), Expect = 6.400e-6
Identity = 34/107 (31.78%), Postives = 47/107 (43.93%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            PY C  C K + ++S+L+QH+  HT  RPY+C +C K F     LK H  T HS +              S  +LR H   H       C  C K F    +  +H+
Sbjct:  623 PYKCGYCSKAYKKSSHLKQHVRSHTGERPYKCLQCSKGFASSGVLKAHIRT-HSGLKAFKCLICDTTFTTSG-SLRRHTTTHSDMRPYMCPYCQKTFKSSPNCRKHM 727          

HSP 19 Score: 51.9878 bits (123), Expect = 8.034e-6
Identity = 68/261 (26.05%), Postives = 96/261 (36.78%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYS----VHCKVCYKGFDLQEDLSRHVDEKHAASSSCI-----------EGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQ---YNCAQCNIMFAQESSYVNHQKSVH 4965
            PY C  C   FN   NL  H S HT     +CP C K+F    SLK H          L        +L+SQ+++  HL+ H +E S      CK C K F  Q  L  H+ + HA     I            G        G+    P+             ++ +     ++  KC  C   FN K     H  V    EK H+ + C  +F        HVQ VH+Q      + C  C+ ++ +  S   H   +H
Sbjct:   61 PYRCDQCPASFNVEYNLDLHKSTHTTSE-LKCPVCQKKFSRVASLKAHVMIHEKEENFLCSECGDEFILQSQLSV--HLEEHRQELSGAKSYTCKTCSKEFVTQNQLREHL-KSHAKIRPIITSSRNYKNIDRRGFKNICHHCGKTFKKPSQL-----------VRHIRIHTGERPYKCSHCGKSFNQKVVLQTHM-VRHTGEKPHMCQHCPASFSQKGNLHSHVQRVHSQAAGVPLFPCMDCSCVYKKLGSLNAHISKMH 305          
BLAST of Zinc finger, C2H2 type vs. Ensembl Zebrafish
Match: znf1026 (zinc finger protein 1026 [Source:ZFIN;Acc:ZDB-GENE-110913-157])

HSP 1 Score: 152.525 bits (384), Expect = 2.071e-37
Identity = 175/722 (24.24%), Postives = 268/722 (37.12%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAE-----TNQSPSDDAEITQYLWNENPTNEN---HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYAC 2649
            C  C   F    +  KHM IH  ++ F C+ C +S+N    L  H+ I HT E            + C  C   F+R      H  IH  ++   C  C   F     LD+H+  H  GE+          + C +C   F    ++ KH +R H   +G  P       K   +  +      + +  +      Q  K + Q  S    M+           +P             C  CGK+F     L +H   HTG K   C  C K F Q SS+  HM +H   K F C  CGK+F+   N N H+++    G + ++ +Q                    F + +SL +     T + P    +  +     +  N++   H   +P   +        + +  K     + +         +  ++T  +  H  I    TG + F C  C   +  S  L +H+RIHT +KPF C  C +SF   S L +H + H   K F+C  C K FN    L  H ++H  +K    C +C + F     L     + H R+     P                     K    S+N            L+Q I I   +K        F C  CGKS++    LN+H++ H +      C  C KSF     + QH+R  H   +   C QC   F   +SL +H  +H+  KP+ C
Sbjct:   34 CTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRI-HTGE----------KPFTCTQCGRSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIH-TGEK---------PITCTLCGKSFRQSSSLSKH-MRTH---TGEKPFTCTQCGKSFSQ-SSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRTHTGE------KPFT-----------CTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRI--HTGEKPITCTQ----------------CGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFRQTSSLNKHMRIH---TGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKP-ITCTLCGKSFRQSSSL-----SKHMRTHTGEKPFTCTQC--------------GKSFNRSSN------------LDQHIRIHTGEK-------PFTCTQCGKSFRQASSLNKHMRTH-TGEKPFTCTQCGKSFNRSSHLNQHIRI-HTGEKPIMCTQCGKSFRQSSSLYKHMRIHTGEKPFTC 650          

HSP 2 Score: 131.339 bits (329), Expect = 1.274e-30
Identity = 148/579 (25.56%), Postives = 219/579 (37.82%), Query Frame = 1
Query:  505 TCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNE----CTVVNDS-------NQEMN-------YKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHL-LNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYL---WNENPTNENHFSYQPNHQSNTDSYIP--SAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGF----HLRYH 2157
            TC +C   F    +  KHM  H  ++ F C+ C  S++   N  +H+ I HT E    CT    S       N+ M        + C  C   F+R      H  IH  ++ + C  C   F+    L KH+  H  GE+            C  C   F    N   H +R H   +G  PI      K                         Q+  LY   R    E KP                         C  CGK+F+    L +H   HTG K   C  C K F Q SS+  HM +H   K F C  CGK+F    ++N H+++    G +  + +Q  +  N S+  ++  +      +K  +  +  +S +  + +  ++     E P          N  SN D +I   + E  I           L  +   +    +  ++ H       TG + F C  C K + +S +L +HIRIHT +KPF C  C KSFR  S L  H ++H   K F+C  C K FN    L  H ++H  +K   +C  C + F        H+R H
Sbjct:  145 TCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRI-HTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMRIH-TGEK---------PFTCTQCGKSFSQSSNFNLH-MRIH---TGEKPITCTQCGKSFH----------------------QSSSLYKHMRIHTGE-KPFT-----------------------CTQCGKSFRQASSLNKHMRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFRQTSSLNKHMRI--HTGEKPFTCTQCGISFNCSSYLKQHMRIHTG--EKPFTCTQCGRSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITC--------TLCGKSFRQSSSLSKHMRTH-------TGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKP-IMCTQCGKSFRQSSSLYKHMRIH 642          

HSP 3 Score: 114.005 bits (284), Expect = 4.301e-25
Identity = 84/292 (28.77%), Postives = 123/292 (42.12%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDK--RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            TG +   C  C K +R+S  L +H+RIHT +KPF C  C KSFR  S L  H + H   K F+C  C   FN    LK H ++H  +K  F C  C R FN   +L       HH  I   +                                  KP    +        + +D+  R  +  +   C  CGKS++    L++H++ H +      C  C KSF    ++ QH+R  H   + F+C QC   F   +SL +H   H+  KP+ C  C + F    + ++HI
Sbjct:  363 TGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFRQTSSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKP-FTCTQCGRSFNRSSNL------DHHMRIHTGE----------------------------------KPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTH-TGEKPFTCTQCGKSFNRSSNLDQHIRI-HTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHI 611          

HSP 4 Score: 111.694 bits (278), Expect = 2.220e-24
Identity = 79/292 (27.05%), Postives = 121/292 (41.44%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEID--KRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            TG + F C  C K +R++  L +H+RIHT +KP  C  C KSFR  S L  H + H   K F+C  C K F    +L  H ++H  +K  F C  C   FN   +L+ H                                               KP    +        + +D   R  +  + F C  CGKS+     L++H++ H +      C  C KSF    S+ +H+RT H   + F+C QC   F   ++L +H  +H+  KP+ C  C + F+     ++H+
Sbjct:  335 TGEKPFTCTQCGKSFRQASSLNKHMRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFRQTSSLNKHMRIHTGEKP-FTCTQCGISFNCSSYLKQHMRIH----------------------------------------TGEKPFTCTQCGRSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIH-TGEKPITCTLCGKSFRQSSSLSKHMRT-HTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPFTCTQCGKSFRQASSLNKHM 583          

HSP 5 Score: 110.538 bits (275), Expect = 5.356e-24
Identity = 87/306 (28.43%), Postives = 130/306 (42.48%), Query Frame = 1
Query: 1759 SEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEID--KRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            SEDV+   KET  ++  E +++Q    + F C  C K +R++  L +H+RIHT +KPF C  C  SF   S LK H + H   K F+C  C + FN    L  H ++H  +K  F C  C + FN   +L  H      R      P          +            T         KP    +        +  +   R  +  + F C  CGKS++    LN+H++ H +      C  C KSF     + QH+R  H   +  +C QC   F   +SL +H  +H+  KP+ C  C + F
Sbjct:    8 SEDVK--IKETFTVK-QEDLQEQTE--KPFMCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRSSNLDHHMRIHTGEKP-FTCTQCGKSFNRSSNLDQHI-----RIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGE-------KPFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRTH-TGEKPFTCTQCGKSFNRSSHLNQHIRI-HTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSF 293          

HSP 6 Score: 109.383 bits (272), Expect = 1.163e-23
Identity = 82/302 (27.15%), Postives = 123/302 (40.73%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDK------------RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            TG + F C  C K + +S +L +HIRIHT +KP  C +C KSFR  S L  H ++H   K F+C  C K F+      +H ++H  +K  F C  C + F     L  H      R+     P                     +   + N    +   I      +PI   +  K            R  +  + F C  CGKS+      N H++ H +      C  C KSF    S+ +H+R  H   + F+C QC   F   +SL +H  +H+  KP  C  C + F+      +H+
Sbjct:  111 TGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKP-FTCTQCGKSFRQASSLNKHM-----RTHTGEKPFTC-----------------TQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIH-TGEKPITCTQCGKSFHQSSSLYKHMRI-HTGEKPFTCTQCGKSFRQASSLNKHMRIHTGEKPITCTQCGKSFRQSSSLYKHM 387          

HSP 7 Score: 80.1073 bits (196), Expect = 1.555e-14
Identity = 85/335 (25.37%), Postives = 125/335 (37.31%), Query Frame = 1
Query:  505 TCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGE------ECDDR-KLTTNY------------LKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            TC  C + F       +HM IH  ++ F C+ C  S+N   NL  H+  IHT           E  + C  C   F+R      H  IH  ++ + C  C   F+    L KH+  H  GE      +C      ++N+              C  C   F    ++ KH +R H   +G  P       K   R  + + +  + +  +      Q  K + Q  S    M+      I    +P             C  CGK+F        H   HTG K   C  C K F Q SS+  HM +H   K F C  CGK+F    ++N H+++
Sbjct:   61 TCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRSSNLDHHMR-IHTG----------EKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTH-TGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKH-MRTH---TGEKPFTCTQCGKSFNR-SSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMR------IHTGEKP-----------FTCTQCGKSFSQSSNFNLHMRIHTGEKPITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRI 361          

HSP 8 Score: 69.3218 bits (168), Expect = 3.220e-11
Identity = 118/547 (21.57%), Postives = 190/547 (34.73%), Query Frame = 1
Query: 2368 SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI---------SAKKCSKKKRNRFQQNDLMTGIINRNPIGSLTNQIGQSDLEANDQSETFTAFRLEDLDMNSAQSSNILVTNYVNEFSSFPSTEKYM-IVSLDNPNSKDQSGSSQQNYYASNIXXXXXXXXXXARNQIESQTDQSENIMSLLDSGQMGVTPVDIGSLFAVQGFNGNIATQLVDHGNIQSNDIDYSQPQENIYYYQA--LNE---IPTVECPIECPSKSSLADKFPILKASLFSDDELTSNPKESNPFTNSSMVTNSNGSQFXXXXXXXXXXXXXXXXXXLQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGC-------------------------FVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            +  + F C  CG+S+     L+ H++ H +      C  C KSF    ++ QH+R  H   +  +C  C   F   +SL +H   H+  KP+ C  C + F      + H+         +  +C K  R     N  M       P      Q G+S    N  S      R+   +        I  T     F    S  K+M I + + P +  Q G S     +SN                        N+   + +G+  +T    G  F       + ++ L  H  I + +  ++  Q    + QA  LN+   I T E PI C    +   K     +SL+    + +  K   PFT +       G  F               ++ L  H  I   +    C  C   F  S  L +H++  H   + FTC  C ++F+   +L  H + H   + F C                           C  C + F    SLS+H+R    +    + CT C K +  +  LD H++
Sbjct:   83 TGEKPFTCTQCGRSFNRSSNLDHHMRIH-TGEKPFTCTQCGKSFNRSSNLDQHIRI-HTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPF--TCTQCGKS---FNRSSHLNQHIRIHTGE------KPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFSQ--SSNF-----------------------NLHMRIHTGEKPITCTQCGKSF-------HQSSSLYKHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRIHTGEKPITC----TQCGKSFRQSSSLYKHMRIHTGEK---PFTCTQC-----GKSF-------------RQTSSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRI-HTGEKPFTCTQCGRSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGE--KPFTCTQCGKSFNRSSNLDQHIR 556          

HSP 9 Score: 68.9366 bits (167), Expect = 3.692e-11
Identity = 64/240 (26.67%), Postives = 88/240 (36.67%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            P++C+ C K FNR+SNL QH+ +HT  +P  C  C K FR   SL  H  T                   S   L  H+++H  E    C  C K F     L++H+                G KP    + T             + I+    E P   I C  C   F   +    H  +    EK      C K+F  +S F  H++ +H       C QC   F Q SS   H +
Sbjct:  115 PFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNL--HMRIHTGEKPFTCTQCGKSFRQASSLNKHMRTH------------TGEKP---FTCTQCGKSFNRSSHLNQHIRIHTGEKP---ITCTQCGKSFRQSSSLYKHMRIHT-GEKPFTCTQCGKSFSQSSNFNLHMR-IHTGEKPITCTQCGKSFHQSSSLYKHMR 332          

HSP 10 Score: 64.6994 bits (156), Expect = 9.320e-10
Identity = 58/256 (22.66%), Postives = 94/256 (36.72%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPE------------GRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            P++C+ C + FNR+SNL  H+ +HT  +P+ C +C K F                                   L  H+++H  E  + C +C K F     LS+H+     EK    + C +   +            G KP    + T             K ++    E P     C  C   FN  +  + H  +    EK      C K+F  +S    H++ +H     + C QC   F+Q S++  H +
Sbjct:   87 PFTCTQCGRSFNRSSNLDHHMRIHTGEKPFTCTQCGKSF------------------------------NRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKP---FTCTQCGKSFRQASSLNKHMRTHTGEKP---FTCTQCGKSFNRSSHLNQHIRIHT-GEKPITCTQCGKSFRQSSSLYKHMR-IHTGEKPFTCTQCGKSFSQSSNFNLHMR 304          

HSP 11 Score: 63.929 bits (154), Expect = 1.311e-9
Identity = 61/256 (23.83%), Postives = 96/256 (37.50%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPE------------GRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            P++C+ C K F+++SN   H+ +HT  +P+ C +C K FR   SL  H  T                   S   L  H+++H  E  + C  C K F     L +H+     EK    + C +   +            G KP   ++ T      +      K ++    E P     C  C   F   +  + H  +    EK      C K+F  +S    H++ +H     + C QC   F Q SS   H +
Sbjct:  171 PFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSH--LNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKP---ITCTQCGKSFHQSSSLYKHMRIHTGEKP---FTCTQCGKSFRQASSLNKHMRIHT-GEKPITCTQCGKSFRQSSSLYKHMR-IHTGEKPFTCTQCGKSFRQTSSLNKHMR 416          

HSP 12 Score: 63.1586 bits (152), Expect = 2.303e-9
Identity = 35/107 (32.71%), Postives = 50/107 (46.73%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            P++C+ C K FNR+SNL QH+ +HT  +P+ C +C K FR   SL  H  T                   S   L  H+++H  E  + C  C K F     L +H+
Sbjct:  535 PFTCTQCGKSFNRSSNLDQHIRIHTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSH--LNQHIRIHTGEKPIMCTQCGKSFRQSSSLYKHM 639          

HSP 13 Score: 60.4622 bits (145), Expect = 1.710e-8
Identity = 34/106 (32.08%), Postives = 52/106 (49.06%), Query Frame = 1
Query: 2383 FKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            F C  CGKS++    LN+H++ H +      C  C  SF     ++QH+R  H   + F+C QC   F   ++L  H  +H+  KP+ C  C + F      D+HI
Sbjct:   32 FMCTQCGKSFRQASSLNKHMRIH-TGEKPFTCTQCGISFNCSSYLKQHMRI-HTGEKPFTCTQCGRSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHI 135          

HSP 14 Score: 59.3066 bits (142), Expect = 3.812e-8
Identity = 35/136 (25.74%), Postives = 62/136 (45.59%), Query Frame = 1
Query: 2299 KPLIWNELLNQPIPIAEIDK--RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            KP +  +        + ++K  R  +  + F C  CG S+    YL +H++ H +      C  C +SF    ++  H+R  H   + F+C QC   F   ++L +H  +H+  KP  C LC + F+      +H+
Sbjct:   30 KPFMCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIH-TGEKPFTCTQCGRSFNRSSNLDHHMRI-HTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHM 163          

HSP 15 Score: 59.3066 bits (142), Expect = 3.978e-8
Identity = 62/259 (23.94%), Postives = 96/259 (37.07%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPE------------GRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVH 4965
            P++C+ C K FNR+S+L QH+ +HT  +P  C +C K FR   SL  H                      S   L  H+++H  E  + C  C K F     L +H+     EK    + C +   +            G KP   ++ T             K ++    E P     C  C   F   +  + H  +    EK      C  +F  +S    H++ +H     + C QC   F   SS ++H   +H
Sbjct:  227 PFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSNFNL--HMRIHTGEKPITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRIHTGEKP---ITCTQCGKSFRQSSSLYKHMRIHTGEKP---FTCTQCGKSFRQTSSLNKHMRIHT-GEKPFTCTQCGISFNCSSYLKQHMR-IHTGEKPFTCTQCGRSF-NRSSNLDHHMRIH 474          

HSP 16 Score: 58.9214 bits (141), Expect = 4.923e-8
Identity = 35/107 (32.71%), Postives = 48/107 (44.86%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            P++C+ C K FNR+SNL QH+ +HT  +P  C  C K FR   SL  H  T                   S   L  H+++H  E    C  C K F     L++H+
Sbjct:  479 PFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFNRSSN--LDQHIRIHTGEKPFTCTQCGKSFRQASSLNKHM 583          

HSP 17 Score: 58.5362 bits (140), Expect = 6.197e-8
Identity = 55/240 (22.92%), Postives = 83/240 (34.58%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            P++C+ C + FNR+SNL  H+ +HT  +P+ C +C K F                                   L  H+++H  E  + C +C K F     LS+H+                G KP    + T             + I+    E P     C  C   F   +  + H       EK      C K+F  +S    H++ +H       C QC   F Q SS   H +
Sbjct:  451 PFTCTQCGRSFNRSSNLDHHMRIHTGEKPFTCTQCGKSF------------------------------NRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTH------------TGEKP---FTCTQCGKSFNRSSNLDQHIRIHTGEKP---FTCTQCGKSFRQASSLNKHM-RTHTGEKPFTCTQCGKSFNRSSHLNQHIR-IHTGEKPIMCTQCGKSFRQSSSLYKHMR 640          

HSP 18 Score: 58.151 bits (139), Expect = 9.737e-8
Identity = 62/261 (23.75%), Postives = 98/261 (37.55%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSL----KTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFD----LQEDLSRHVDEKHAASSSCIEG------------LPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            P++C+ C K F +AS+L +H+ +HT  +P  C +C K FR   SL    + H   K  + T+  +            +L  H+++H  E    C  C   F+    L++ +  H  EK    + C               +  G KP    + T             + I+    E P   I C  C   F   +    H       EK      C K+F  +S    H++ +H     + C QC   F Q SS   H ++
Sbjct:  339 PFTCTQCGKSFRQASSLNKHMRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFRQTS------SLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRSSNLDHHMRIHTGEKP---FTCTQCGKSFNRSSNLDQHIRIHTGEKP---ITCTLCGKSFRQSSSLSKHM-RTHTGEKPFTCTQCGKSFNRSSNLDQHIR-IHTGEKPFTCTQCGKSFRQASSLNKHMRT 585          

HSP 19 Score: 57.7658 bits (138), Expect = 1.268e-7
Identity = 55/242 (22.73%), Postives = 92/242 (38.02%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSL----KTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 4950
            P++C+ C K F+++SN   H+ +HT  +P  C +C K F    SL    + H   K  + T+  +            +L  H+++H  E  + C  C K F     L +H+             +  G KP    + T             K ++    E P     C  C   FN  +    H  +    EK      C ++F  +S   +H++ +H     + C QC   F + S+   H
Sbjct:  283 PFTCTQCGKSFSQSSNFNLHMRIHTGEKPITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKSFRQAS------SLNKHMRIHTGEKPITCTQCGKSFRQSSSLYKHMR------------IHTGEKP---FTCTQCGKSFRQTSSLNKHMRIHTGEKP---FTCTQCGISFNCSSYLKQHMRIHT-GEKPFTCTQCGRSFNRSSNLDHHMR-IHTGEKPFTCTQCGKSFNRSSNLDQH 498          

HSP 20 Score: 54.299 bits (129), Expect = 1.451e-6
Identity = 55/241 (22.82%), Postives = 86/241 (35.68%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            P+ C+ C K F +AS+L +H+ +HT  +P+ C +C   F   CS                              L+ H+++H  E    C  C + F+   +L  H+             +  G KP    + T             + I+    E P   I C  C   F   +    H       EK      C K+F  +S F  H++ +H     + C QC   F Q SS   H ++
Sbjct:   31 PFMCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGISF--NCS----------------------------SYLKQHMRIHTGEKPFTCTQCGRSFNRSSNLDHHMR------------IHTGEKP---FTCTQCGKSFNRSSNLDQHIRIHTGEKP---ITCTLCGKSFRQSSSLSKHM-RTHTGEKPFTCTQCGKSFSQSSNFNLHMR-IHTGEKPFTCTQCGKSFRQASSLNKHMRT 221          

HSP 21 Score: 53.9138 bits (128), Expect = 1.905e-6
Identity = 30/109 (27.52%), Postives = 51/109 (46.79%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C   F  S +L +H++  H   +  TC +C K+F    SL  H +TH   +    F C  C + F    +L +H+R+   +    + CT C K ++    L+ H++
Sbjct:  482 CTQCGKSFNRSSNLDQHIRI-HTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKP---FTCTQCGKSFNRSSNLDQHIRIHTGE--KPFTCTQCGKSFRQASSLNKHMR 584          

HSP 22 Score: 52.373 bits (124), Expect = 4.987e-6
Identity = 42/140 (30.00%), Postives = 57/140 (40.71%), Query Frame = 1
Query:  505 TCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNE----CTVVNDS-------NQEMN-------YKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEE 870
            TC +C   F    +  KHM  H  ++ F C+ C  S+N   NL  HI  IHT E    CT    S       N+ M        + C  C   F+R      H  IH  ++ + C  C   F+    L KH+  H  GE+
Sbjct:  509 TCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFNRSSNLDQHIR-IHTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPIMCTQCGKSFRQSSSLYKHMRIH-TGEK 646          

HSP 23 Score: 51.9878 bits (123), Expect = 7.192e-6
Identity = 31/109 (28.44%), Postives = 51/109 (46.79%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C   F  S +L +H++  H   + FTC  C K+F    SL  H +TH   +    F C  C + F     L++H+R+   +   +  CT C K ++ +  L  H++
Sbjct:  538 CTQCGKSFNRSSNLDQHIRI-HTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKP---FTCTQCGKSFNRSSHLNQHIRIHTGEKPIM--CTQCGKSFRQSSSLYKHMR 640          
BLAST of Zinc finger, C2H2 type vs. Ensembl Zebrafish
Match: BX248122.1 (gastrula zinc finger protein XlCGF57.1-like [Source:NCBI gene;Acc:103910472])

HSP 1 Score: 149.443 bits (376), Expect = 3.227e-37
Identity = 140/502 (27.89%), Postives = 201/502 (40.04%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNEN---HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSED---VERIDKETGQ---IQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLK-SVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C  CGK+F     L+ H   HTG K F C  C K F + SS+ IHM +H   K F C  CGK+F++  ++N H+ +         SQ  +     S+          N   +I     T + P    +  +     +P N++   H   +P       S      +F      K H  I   E      +  K  GQ   +  H  I    TG + F C  C K + +S    RH+RIHT +KPF C  C KSF  + S L  H K H   K F+C +C K F     L  H ++H  +K  F+C  C + F+   HL +H      R      P                     K  + S+N            LN+ + +   +K        F C  CGKS+     LN H++ H S      C  C KSF     + QH+R  H   + F+C QC   F   +S   H + H+  KP++C  C + F    Y +RH+
Sbjct:   48 CTQCGKSFGRKGYLKIHMRIHTGEKPFTCIQCGKSFIRLSSLNIHMRIHTGEKPFTCTRCGKSFSHSSSLNHHMIIHAGEKPSTCSQCGKSFSCSSHL---------NHHMRI----HTGEKPFTCTQCGKGFSQSSPLNKHMRIHTGEKP------FSCTQCGNSFRHSLSLKQHMRIHTGEKPFTCTQCGKSFGQSSSLNHHMRIH---TGEKPFTCTQCEKSFSQSSHFNRHMRIHTGEKPFTCTRCGKSFSHQLSALNRHIKIHTGEKPFTCTLCGKSFKCLSYLNEHMRIHSGEKP-FICTQCGKSFSQSSHLNHHM-----RVHTGEKPFTCTQC--------------GKSFSQSSN------------LNKHMRVHTGEK-------PFTCTQCGKSFSQSLSLNHHMRVH-SGEKPFTCTQCGKSFNCSSHLNQHMRI-HTGEKPFTCTQCGRSFSQSSSRNLHMMSHTGEKPFSCTQCGKSFTCSSYLNRHM 486          

HSP 2 Score: 99.7525 bits (247), Expect = 6.953e-21
Identity = 81/289 (28.03%), Postives = 116/289 (40.14%), Query Frame = 1
Query: 1843 RFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDK--RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLI-RHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            RF C  C K + +   L  H+RIHT +KPF C  C KSF   S L  H + H   K F+C  C K F+   +L  H  +H  +K    C  C + F+   HL +H      R      P                       T         KP    +  N       + +  R  +  + F C  CGKS+     LN H++ H +      C  C KSF       +H+R  H   + F+C +C   F  + S + RH  +H+  KP+ C LC + FK   Y + H+
Sbjct:   45 RFTCTQCGKSFGRKGYLKIHMRIHTGEKPFTCIQCGKSFIRLSSLNIHMRIHTGEKPFTCTRCGKSFSHSSSLNHHMIIHAGEKPS-TCSQCGKSFSCSSHLNHHM-----RIHTGEKPFTCTQCGKGFSQSSPLNKHMRIHTGE-------KPFSCTQCGNSFRHSLSLKQHMRIHTGEKPFTCTQCGKSFGQSSSLNHHMRIH-TGEKPFTCTQCEKSFSQSSHFNRHMRI-HTGEKPFTCTRCGKSFSHQLSALNRHIKIHTGEKPFTCTLCGKSFKCLSYLNEHM 318          

HSP 3 Score: 80.8777 bits (198), Expect = 5.738e-15
Identity = 80/316 (25.32%), Postives = 116/316 (36.71%), Query Frame = 1
Query:  505 TCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            TC  CE  F     + +HM IH  ++ F C+ C  S++++++ L     IHT E            + C +C   F        H  IH  ++   C  C   F     L+ H+  H  GE+            C  C   F    N+ KH +R H   +G  P                                 Q  K ++Q  S    M+      +    +P             C  CGK+F     L +H   HTG K F C  C + F+Q SS  +HM+ H   K F C  CGK+FT    +N H++V
Sbjct:  243 TCTQCEKSFSQSSHFNRHMRIHTGEKPFTCTRCGKSFSHQLSALNRHIKIHTGE----------KPFTCTLCGKSFKCLSYLNEHMRIHSGEKPFICTQCGKSFSQSSHLNHHMRVH-TGEK---------PFTCTQCGKSFSQSSNLNKH-MRVH---TGEKPF-----------------------------TCTQCGKSFSQSLSLNHHMR------VHSGEKPFT-----------CTQCGKSFNCSSHLNQHMRIHTGEKPFTCTQCGRSFSQSSSRNLHMMSHTGEKPFSCTQCGKSFTCSSYLNRHMRV 488          

HSP 4 Score: 77.7962 bits (190), Expect = 5.105e-14
Identity = 77/316 (24.37%), Postives = 121/316 (38.29%), Query Frame = 1
Query:  505 TCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            TC  C   F       KHM IH  ++ F C+ C  S+ + ++L  H+  IHT           E  + C  C   F +  +   H  IH  ++   C  C   F      ++H+  H  GE+            C  C   F +  +    +++ H   +G  P    +  K   +  + + E  + +  +   I  Q  K ++Q       M+           +P             C  CGK+F     L +H   HTG K F C  C K F+Q  S+  HM VH   K F C  CGK+F    ++N H+++
Sbjct:  159 TCTQCGKGFSQSSPLNKHMRIHTGEKPFSCTQCGNSFRHSLSLKQHMR-IHTG----------EKPFTCTQCGKSFGQSSSLNHHMRIHTGEKPFTCTQCEKSFSQSSHFNRHMRIH-TGEK---------PFTCTRCGKSFSHQLSALNRHIKIH---TGEKPFTCTLCGKSF-KCLSYLNEHMRIHSGEKPFICTQCGKSFSQSSHLNHHMRVHTGE------KP-----------FTCTQCGKSFSQSSNLNKHMRVHTGEKPFTCTQCGKSFSQSLSLNHHMRVHSGEKPFTCTQCGKSFNCSSHLNQHMRI 432          

HSP 5 Score: 70.4774 bits (171), Expect = 9.704e-12
Identity = 83/327 (25.38%), Postives = 120/327 (36.70%), Query Frame = 1
Query:  505 TCEICEVEFPSKRTYLK-HMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWP---------IEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFT-QKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            TC  C   F  ++ YLK HM IH  ++ F C  C  S+    +L +H+ I HT E            + C  C   FS   +   H +IH  ++   C  C   F C   L+ H+  H  GE+            C  C   F     + KH +R H   +G  P             + +K   R+ T           +      Q  K + Q  S    M+           +P             C  C K+F       RH   HTG K F C  C K F+ Q S++  H+ +H   K F C  CGK+F     +N H+++
Sbjct:   47 TCTQCGKSF-GRKGYLKIHMRIHTGEKPFTCIQCGKSFIRLSSLNIHMRI-HTGE----------KPFTCTRCGKSFSHSSSLNHHMIIHAGEKPSTCSQCGKSFSCSSHLNHHMRIH-TGEK---------PFTCTQCGKGFSQSSPLNKH-MRIH---TGEKPFSCTQCGNSFRHSLSLKQHMRIHTG----------EKPFTCTQCGKSFGQSSSLNHHMRIHTGE------KP-----------FTCTQCEKSFSQSSHFNRHMRIHTGEKPFTCTRCGKSFSHQLSALNRHIKIHTGEKPFTCTLCGKSFKCLSYLNEHMRI 320          

HSP 6 Score: 68.1662 bits (165), Expect = 6.388e-11
Identity = 60/240 (25.00%), Postives = 97/240 (40.42%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            P++C+ C KGF+++S L +H+ +HT  +P+ C +C   FRH  SLK H    H+               +S  +L +H+++H  E    C  C K F      +RH+                 R   GE   T T        Q     + +     +K   C  C   F   +  + H  +    EK  +   C K+F  +S   +H++ VH     + C QC   F+Q S+   H +
Sbjct:  157 PFTCTQCGKGFSQSSPLNKHMRIHTGEKPFSCTQCGNSFRHSLSLKQHMRI-HTGEKPFTCTQCGKSFGQSS-SLNHHMRIHTGEKPFTCTQCEKSFSQSSHFNRHM-----------------RIHTGEKPFTCTRCGKSFSHQLSALNRHIKIHTGEKPFTCTLCGKSFKCLSYLNEHMRI-HSGEKPFICTQCGKSFSQSSHLNHHMR-VHTGEKPFTCTQCGKSFSQSSNLNKHMR 375          

HSP 7 Score: 66.2402 bits (160), Expect = 2.031e-10
Identity = 40/123 (32.52%), Postives = 58/123 (47.15%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGF----HLRYHYSTSHHRSIA 2187
            TG + F C  C K + +S  L  H+R+H+ +KPF C  C KSF   S L  H + H   K F+C  C + F+   +  +H   H  +K  F C  C + F        H+R H    H  +I+
Sbjct:  378 TGEKPFTCTQCGKSFSQSLSLNHHMRVHSGEKPFTCTQCGKSFNCSSHLNQHMRIHTGEKPFTCTQCGRSFSQSSSRNLHMMSHTGEKP-FSCTQCGKSFTCSSYLNRHMRVHTGKKHSHAIS 499          

HSP 8 Score: 63.5438 bits (153), Expect = 1.554e-9
Identity = 59/243 (24.28%), Postives = 96/243 (39.51%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVH 4965
            P++C  C K F R S+L  H+ +HT  +P+ C +C K F H  SL  H                      S   L +H+++H  E    C  C KGF     L++H+             +  G KP    S T   +   H    ++ ++    E P     C  C   F   +  ++H  +    EK      C+K+F  +S F  H++ +H     + C +C   F+ + S +N    +H
Sbjct:   73 PFTCIQCGKSFIRLSSLNIHMRIHTGEKPFTCTRCGKSFSHSSSLNHHMIIHAGEKPSTCSQCGKSFSCSSH--LNHHMRIHTGEKPFTCTQCGKGFSQSSPLNKHMR------------IHTGEKP---FSCTQCGNSFRHSLSLKQHMRIHTGEKP---FTCTQCGKSFGQSSSLNHHMRI-HTGEKPFTCTQCEKSFSQSSHFNRHMR-IHTGEKPFTCTRCGKSFSHQLSALNRHIKIH 293          

HSP 9 Score: 60.077 bits (144), Expect = 2.128e-8
Identity = 59/250 (23.60%), Postives = 93/250 (37.20%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFD----LQEDLSRHVDEKHAASSSCIEGLPE------------GRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESS 4938
            P++C+ C K F+++S+  +H+ +HT  +P+ C +C K F H+ S                             AL  H+K+H  E    C +C K F     L E +  H  EK    + C +   +            G KP    + T             K ++    E P     C  C   F+     ++H  V    EK      C K+F  +S    H++ +H     + C QC   F+Q SS
Sbjct:  241 PFTCTQCEKSFSQSSHFNRHMRIHTGEKPFTCTRCGKSFSHQLS-----------------------------ALNRHIKIHTGEKPFTCTLCGKSFKCLSYLNEHMRIHSGEKPFICTQCGKSFSQSSHLNHHMRVHTGEKP---FTCTQCGKSFSQSSNLNKHMRVHTGEKP---FTCTQCGKSFSQSLSLNHHMRV-HSGEKPFTCTQCGKSFNCSSHLNQHMR-IHTGEKPFTCTQCGRSFSQSSS 453          
BLAST of Zinc finger, C2H2 type vs. Ensembl Zebrafish
Match: BX927193.2 (pep chromosome:GRCz11:4:46524666:46648979:-1 gene:ENSDARG00000111026.1 transcript:ENSDART00000162101.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX927193.2)

HSP 1 Score: 148.288 bits (373), Expect = 9.533e-37
Identity = 132/497 (26.56%), Postives = 202/497 (40.64%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAEN-FIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTG----FHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            CA CGK+F     L+ H + HTG K F C  C K F+Q S + +HM+ H   K FLC  CGK+F+   ++N H++V         +Q  +     S+ ++        +        ++    S   +  +    E P    HFS+  +   N    I + E  F      KS                +  + LH  I    TG + F C  C K + +S +L +H+RIHT++KPF C  C KSF L S L  H + H   K F+C  C K F+    L  H+ +H  +K  F C  C + F+       H+R H                                   KP   +      K    +  LN       I  R  +  + F C  CGKS+     LN+H+K H +      C  C +SF    S+ +H+   H   + F+C QC   F   ++L +H  +H+  KP+ C  C + F    + ++H+
Sbjct:   79 CAQCGKSFGRKDHLKIHMMIHTGEKPFTCTQCGKSFSQSSYLNLHMMSHTGEKPFLCTECGKSFSCSSHLNQHMRVHTGEKPFTCTQCGKSFSQSSHLNKHMRIHTGEKPFICTQCGKSFNCSSHLNKHMRIHTGEKPFTCTHFSHSSS--LNLHMRIHTGEKPFTCTQCGKSFS-------------HSSSLNLHMRIH---TGEKPFTCTQCGKCFSQSSNLNQHMRIHTKEKPFTCTYCGKSFSLSSSLNIHMRIHTGEKPFACTQCGKSFSCLSHLNHHKWIHTGEK-PFTCSQCGKSFSQSSSLNIHMRIHTG--------------------------------EKPFTCTQCG---KSFSQSSSLN-------IHMRIHTGEKPFTCTQCGKSFNCSSLLNKHMKIH-TGEKPFACTQCGRSFSHSSSLNRHMMI-HTGEKPFTCSQCRKSFSQSSNLKKHMRIHTGEKPFRCTQCGKSFSQSSHLNKHM 512          

HSP 2 Score: 94.7449 bits (234), Expect = 2.414e-19
Identity = 79/284 (27.82%), Postives = 110/284 (38.73%), Query Frame = 1
Query: 1846 FRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            F C  C K + +   L  H+ IHT +KPF C  C KSF   S L  H  SH   K F C  C K F+    L  H ++H  +K  F C  C + F+   HL  H      R      P                   K+        P        +  LN       +  R  +  + F C  CGKS+     LN H++ H +      C  C K F    ++ QH+R  H   + F+C  C   F   +SL  H  +H+  KP+AC  C + F    + + H
Sbjct:   77 FTCAQCGKSFGRKDHLKIHMMIHTGEKPFTCTQCGKSFSQSSYLNLHMMSHTGEKPFLCTECGKSFSCSSHLNQHMRVHTGEK-PFTCTQCGKSFSQSSHLNKHM-----RIHTGEKP--FICTQCGKSFNCSSHLNKHMRIHTGEKPFTCTHFSHSSSLN-------LHMRIHTGEKPFTCTQCGKSFSHSSSLNLHMRIH-TGEKPFTCTQCGKCFSQSSNLNQHMRI-HTKEKPFTCTYCGKSFSLSSSLNIHMRIHTGEKPFACTQCGKSFSCLSHLNHH 343          

HSP 3 Score: 60.077 bits (144), Expect = 1.869e-8
Identity = 34/84 (40.48%), Postives = 41/84 (48.81%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH 2082
            TG + F C  C + +  S  L RH+ IHT +KPF C  C KSF   S LK H + H   K F C  C K F+    L  H   H
Sbjct:  432 TGEKPFACTQCGRSFSHSSSLNRHMMIHTGEKPFTCSQCRKSFSQSSNLKKHMRIHTGEKPFRCTQCGKSFSQSSHLNKHMMSH 515          

HSP 4 Score: 57.3806 bits (137), Expect = 1.493e-7
Identity = 62/251 (24.70%), Postives = 94/251 (37.45%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEG-------RKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            P++C+ C K F+++SNL QH+ +HTK +P+ C  C K F    SL +                          +L  H+++H  E    C  C K F     L+     H  EK    S C +   +        R   GE   T T       Q     I   I    +K   C  C   FN  +  + H  +    EK      C ++F  +S    H+  +H     + C+QC   F+Q S+   H +
Sbjct:  268 PFTCTQCGKCFSQSSNLNQHMRIHTKEKPFTCTYCGKSF----SLSS--------------------------SLNIHMRIHTGEKPFACTQCGKSFSCLSHLNHHKWIHTGEKPFTCSQCGKSFSQSSSLNIHMRIHTGEKPFTCTQCGKSFSQSSSLNIHMRI-HTGEKPFTCTQCGKSFNCSSLLNKHMKIHT-GEKPFACTQCGRSFSHSSSLNRHMM-IHTGEKPFTCSQCRKSFSQSSNLKKHMR 485          
BLAST of Zinc finger, C2H2 type vs. Ensembl Xenopus
Match: gpr89b (G protein-coupled receptor 89B [Source:Xenbase;Acc:XB-GENE-484935])

HSP 1 Score: 246.899 bits (629), Expect = 3.375e-65
Identity = 205/772 (26.55%), Postives = 328/772 (42.49%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHE-NDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGT---EVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSD-------------DAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWD--------KSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKP----TANSNNP----PDVKPLIWNEL-LNQPIPIAE-------IDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C+IC + FP +  Y +HM  HE ND+  +C  C +S+N + NL +H A  + ++ T            C  C   FSR  + +AH ++H+ +E L C  C   F     L  H+ +H+         + +    CK C   F++   +K+     H KT  H+ I          RV                          A  RS         NR+I + G            + +C  CGK F+ P  L RH   HTG + F+C IC K F QK ++  HMV H   K   C FC  AF+ + N+ +HI+ +H   T    V +Q+     + S     +     +  +++  L+E   +P +             + +I Q     +  +    +  P+  S   + +   E       D        +  +     +  +RI K+        + ++  +G R   C +C K ++K  DL RHIRIHT +KPF+C  C ++F +KS L  H K+H  +K F C+ C K F+   +LKVH +LH   +  F C  CD++F T  H + H + SH +                     +    + KP       SN P    P  +P++  +L L QPIP          I+      +R +KC +C ++YK   +L +H++ H +      C  C + F +   ++ H+RT H   R + CL C   F T  SL RH  +H++ +PY CP C + FK  + C +H+
Sbjct:   33 CDICLLSFPKETQYQRHMRDHERNDKAHRCDQCPMSFNIDFNLTLHKATHNVDDPT------------CPACRKKFSRVASLKAHIMLHEKEETLICSECGDEFTLPNNLSLHMEEHR------QELVGSKTYSCKSCKKTFDSTPQLKE-----HMKT--HFKI----------RV--------------------------ANTRS--------YNRNIDRSG-----------FSYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCNICGKAFNQKGALATHMVKHTGEKPHACAFCPAAFSQKGNLQSHIQRVHSEVTVFQAVPAQTDSTDCSASEQQGPQQPAVTDVIQQLLELSEPVDNPQNSQSEQQLNISVGINRDILQQALENSGLSSIPVAALPSDTSQAKATVQEIECLSTQQMDCNDQEHEVEHEEQDKADKTEKRIIKKKSAFSAGSVREE--SGIRWHICTYCNKEFKKPSDLVRHIRIHTHEKPFKCLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKCFSTSGSLKVHIRLHTGVR-PFACPHCDKKFRTSGHRKTHIA-SHFKQC-----------------ELRKLRQQRKPGKVRVGKSNVPVSEIPLQEPILITDLGLIQPIPRNSQFFQNYFINSYTHEVDRPYKCYYCHRAYKKSCHLKQHIRSH-TGEKPFKCTQCGRGFASSGVLKAHIRT-HTGLRDYKCLVCNGAFTTGGSLRRHMCIHNDLRPYMCPYCQKTFKTSLNCKKHM 701          

HSP 2 Score: 135.961 bits (341), Expect = 3.893e-31
Identity = 103/327 (31.50%), Postives = 149/327 (45.57%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFR---RFR--CRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTG----FHLRYHYSTSHHR 2178
            C +CG+ F +  +L+ HE THTG+K + C IC   FT   S+  HM  H ++K + C FC + F    +   H+K  H+N    L     H +  +N                              +I +    E+ + E   S +  H   T +   +AE    L   +  +G  +SE V  + +   +      IKD+        +F   C FC K ++K  DL RHIRIHT +KPF+C  C KSF +KS L +H K+H   K FSC +C+  F+ K +LKVH +LH   K  F C  CD RF T      H++ HY     R
Sbjct:  934 CTMCGRGFVSSGVLKSHEKTHTGVKAYSCTICNAAFTTNGSLTRHMSTHISMKPYKCPFCDETFRTTVHCKKHMKK-HQNIGPAL-----HAMVLAN----------------------------GGDICK---TEDESAERSASRKSRHGVITFTEEETAE----LAKIRPREGATISEKV--LVQSAAEKDRISEIKDKQAEMETEPKFANCCSFCPKSFKKPSDLIRHIRIHTGEKPFKCDECGKSFTVKSTLDSHVKTHAGQKLFSCHVCSNSFSTKGSLKVHMRLHTGAK-PFKCPHCDMRFRTSGRRKTHIQCHYKADAKR 1216          

HSP 3 Score: 124.02 bits (310), Expect = 1.639e-27
Identity = 98/343 (28.57%), Postives = 146/343 (42.57%), Query Frame = 1
Query: 1771 ERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYS-------TSHHRSIAN------PDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIP----IAEIDKRKLSNNRLFK----CNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNR 2736
            E I+ +T      E  +D+    R +RC +C K ++KS  L +HIR HT +KP++C MC + F    VLK+H K+H  +K +SC ICN  F    +L  H   H   K  + C  CD  F T  H + H           H   +AN       +    +               + +    +   P     I  ++L Q       I+EI  ++       K    C+ C KS+K    L  H++ H +      C  C KSF    ++  H++T H  ++ FSC  C   F TK SL  H  +H+ +KP+ CP C  RF+       HI     +  KR R
Sbjct:  881 EEIELQTQSAPFLESTEDR--SRRAYRCDYCNKGFKKSSHLKQHIRSHTGEKPYKCTMCGRGFVSSGVLKSHEKTHTGVKAYSCTICNAAFTTNGSLTRHMSTHISMK-PYKCPFCDETFRTTVHCKKHMKKHQNIGPALHAMVLANGGDICKTEDESAERSASRKSRHGVITFTEEETAELAKIRPREGATISEKVLVQSAAEKDRISEIKDKQAEMETEPKFANCCSFCPKSFKKPSDLIRHIRIH-TGEKPFKCDECGKSFTVKSTLDSHVKT-HAGQKLFSCHVCSNSFSTKGSLKVHMRLHTGAKPFKCPHCDMRFRTSGRRKTHIQCHYKADAKRIR 1218          

HSP 4 Score: 94.3597 bits (233), Expect = 1.601e-18
Identity = 83/355 (23.38%), Postives = 150/355 (42.25%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV--------IHKNGTEVLSQSQEHLLNESNXXXXXXQKD-----PNRFKKIASLAETNQSPSDDA---EITQYLWNEN-PTNENHF-SYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETG--QIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLT---------RHIRIHTQQKPF------------QCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            C  CG+ F +  +L+ H  THTG+++++C +C   FT   S++ HM +H++++ ++C +C K F    N   H+K         +H++   V  ++    ++ SN  + E   D      +  ++  ++ + +  P  D     + Q L  +N  T+E+ F + Q   Q N + Y  +       D     QG  +++   +  + +   Q+Q    ++ Q       +          + ++T           I + TQ  PF            +C  C+K F+  S LK H +SH   K + C +C + F     LK H + H   K  + C IC+  F T   L  H ST
Sbjct:  628 CTQCGRGFASSGVLKAHIRTHTGLRDYKCLVCNGAFTTGGSLRRHMCIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHRYEVASQLHQHQPAVSEETPADQIHVSNQIQVEIAGDGLHQSSSVARQPEAILQLSPQPVLDTVSPALGQTLTEQNLETDEDRFVTSQHALQENINQYETTELPTQSYDQQGLSQGFTVTDSFSQQAQFSAVQQLQDSSTLESQALSTSYQQPTLLEVPTADTINVTARLIQEGTHEEIELQTQSAPFLESTEDRSRRAYRCDYCNKGFKKSSHLKQHIRSHTGEKPYKCTMCGRGFVSSGVLKSHEKTHTGVKA-YSCTICNAAFTTNGSLTRHMST 981          

HSP 5 Score: 91.2781 bits (225), Expect = 1.614e-17
Identity = 39/109 (35.78%), Postives = 63/109 (57.80%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            R ++C +C++ Y+KSC L +HIR HT +KPF+C  C + F    VLK H ++H  L+++ C +CN  F    +L+ H  +H  D   ++C  C + F T  + + H  T
Sbjct:  596 RPYKCYYCHRAYKKSCHLKQHIRSHTGEKPFKCTQCGRGFASSGVLKAHIRTHTGLRDYKCLVCNGAFTTGGSLRRHMCIHN-DLRPYMCPYCQKTFKTSLNCKKHMKT 703          

HSP 6 Score: 86.2705 bits (212), Expect = 4.951e-16
Identity = 80/296 (27.03%), Postives = 123/296 (41.55%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIF----NLKQTLKVHR-----QLHE 2085
            C  C +AF     L  H  TH+GIK F+C  C K F+   S+K+H+ +H  V+ F C  C K F    +  THI   H    E+    Q              Q+ P + +   S    ++ P  +  +   L    P   N   +Q N+  N  SY    +   K  +              R  K++  ++ H  I+   TG + F+C  C + +  S  L  HIR HT  + ++C +C+ +F     L+ H   H  L+ + C  C K F    N K+ +K HR     QLH+
Sbjct:  452 CLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKCFSTSGSLKVHIRLHTGVRPFACPHCDKKFRTSGHRKTHI-ASHFKQCELRKLRQ--------------QRKPGKVRVGKSNVPVSEIPLQEPILITDLGLIQPIPRNSQFFQ-NYFIN--SYTHEVDRPYKCYY------------CHRAYKKSCHLKQH--IRSH-TGEKPFKCTQCGRGFASSGVLKAHIRTHTGLRDYKCLVCNGAFTTGGSLRRHMCIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHRYEVASQLHQ 714          

HSP 7 Score: 74.3294 bits (181), Expect = 1.851e-12
Identity = 34/86 (39.53%), Postives = 48/86 (55.81%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLS 1482
            C  C KAF  P  L RH   HTG + F+C +C+K F QKS++++HM  H   K + C +C   FT + NM  H+K  H    E ++
Sbjct: 1652 CDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHMKKHTGEKPYKCDYCSMTFTQKCNMKLHMKRTHAYPGEYVA 1737          

HSP 8 Score: 72.4034 bits (176), Expect = 7.437e-12
Identity = 35/93 (37.63%), Postives = 50/93 (53.76%), Query Frame = 1
Query: 1846 FRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDR 2124
            F+C  C K + K   L RH RIHT ++PFQC +C K+F  KS L+ H K H   K + C+ C+  F  K  +K+H +        +V  I +R
Sbjct: 1650 FKCDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHMKKHTGEKPYKCDYCSMTFTQKCNMKLHMKRTHAYPGEYVAMIVNR 1742          

HSP 9 Score: 67.781 bits (164), Expect = 2.257e-10
Identity = 36/111 (32.43%), Postives = 60/111 (54.05%), Query Frame = 1
Query: 3553 YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            +H C  C+ +FK    LV H++  H   + F C  C +AF+ K +L AH KTH   ++F C  C+ C   F +  SL  H+R+  +  +  + C HC+K ++T+    +H+
Sbjct:  421 WHICTYCNKEFKKPSDLVRHIRI-HTHEKPFKCLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKC---FSTSGSLKVHIRL--HTGVRPFACPHCDKKFRTSGHRKTHI 525          

HSP 10 Score: 63.1586 bits (152), Expect = 5.271e-9
Identity = 37/123 (30.08%), Postives = 64/123 (52.03%), Query Frame = 1
Query: 3520 QSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            Q+  E  P KF + C+ C   FK    L+ H++  H   + F C+ C K+F+ K +L +H KTH   + F C V   C+  F +  SL  H+R+  +     ++C HC+  ++T+    +H++
Sbjct: 1092 QAEMETEP-KFANCCSFCPKSFKKPSDLIRHIRI-HTGEKPFKCDECGKSFTVKSTLDSHVKTHAGQKLFSCHV---CSNSFSTKGSLKVHMRL--HTGAKPFKCPHCDMRFRTSGRRKTHIQ 1207          

HSP 11 Score: 61.6178 bits (148), Expect = 1.343e-8
Identity = 33/110 (30.00%), Postives = 59/110 (53.64%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            C  C+  FK S  L +H++S H   + + C +C + F +   L +H KTH   +++ C +C   N  F +  SL+RH  M  + ++  Y+C  C++ ++TT     H+K+
Sbjct:  906 CDYCNKGFKKSSHLKQHIRS-HTGEKPYKCTMCGRGFVSSGVLKSHEKTHTGVKAYSCTIC---NAAFTTNGSLTRH--MSTHISMKPYKCPFCDETFRTTVHCKKHMKK 1009          

HSP 12 Score: 60.077 bits (144), Expect = 4.710e-8
Identity = 41/141 (29.08%), Postives = 63/141 (44.68%), Query Frame = 1
Query: 2314 NELLNQPIPIAEIDKRKLSN--NRL---FKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRK-------FSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            +EL  Q    A+I+K   ++   RL   F+CNHC   +     L EH KE       +VC  CNK+F     +++H++T      +       F C  C   F   + L RH  +H+  +P+ C LC + F  K     H+
Sbjct: 1560 SELSYQVTGDAQIEKNSQADKEGRLHQCFECNHC---FPSAAILAEHNKEAHGKERIHVCHLCNKAFKRASHLKEHMQTHQPGPSRSSQMPKLFKCDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHM 1697          

HSP 13 Score: 59.3066 bits (142), Expect = 6.598e-8
Identity = 34/115 (29.57%), Postives = 55/115 (47.83%), Query Frame = 1
Query: 1852 CRFCYKLYRKSCDLTRHIRIH------TQQKP--FQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            C  C K ++++  L  H++ H      + Q P  F+C  C K+F   S L+ H + H   + F C +C K FN K  L+VH + H  +K  + C  C   F    +++ H   +H
Sbjct: 1616 CHLCNKAFKRASHLKEHMQTHQPGPSRSSQMPKLFKCDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHMKKHTGEK-PYKCDYCSMTFTQKCNMKLHMKRTH 1729          

HSP 14 Score: 57.3806 bits (137), Expect = 2.857e-7
Identity = 62/263 (23.57%), Postives = 102/263 (38.78%), Query Frame = 1
Query: 1849 RCRFCYKLYRKSCDLTRHIRIHTQ-QKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIA-------EIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRH 2613
            +C  C   + K     RH+R H +  K  +C  C  SF +   L  H  +H  + + +C  C K F+   +LK H  LHE ++   +C  C   F    +L  H        + +                + +     K T +S   P +K  +        I +A        ID+   S    + C HCGK+++    L  H++ H +      C  C K+F    ++  H+  +H   +  +C  CPA F  K +L  H
Sbjct:   32 KCDICLLSFPKETQYQRHMRDHERNDKAHRCDQCPMSFNIDFNLTLHKATH-NVDDPTCPACRKKFSRVASLKAHIMLHEKEET-LICSECGDEFTLPNNLSLHMEEHRQELVGS----------------KTYSCKSCKKTFDST--PQLKEHMKTHF---KIRVANTRSYNRNIDRSGFS----YSCPHCGKTFQKPSQLTRHIRIH-TGERPFKCNICGKAFNQKGALATHM-VKHTGEKPHACAFCPAAFSQKGNLQSH 265          

HSP 15 Score: 55.8398 bits (133), Expect = 9.608e-7
Identity = 36/117 (30.77%), Postives = 51/117 (43.59%), Query Frame = 1
Query: 3556 HGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFG-----CFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            H C  C+H F  +  L EH K  H   R   C++C+KAF     L  H +TH    S        F C  C++ F     L RH R+   +    ++CT C K +     L  H+K+
Sbjct: 1585 HQCFECNHCFPSAAILAEHNKEAHGKERIHVCHLCNKAFKRASHLKEHMQTHQPGPSRSSQMPKLFKCDTCDKAFAKPSQLERHSRIHTGE--RPFQCTLCEKAFNQKSALQVHMKK 1699          

HSP 16 Score: 55.0694 bits (131), Expect = 1.404e-6
Identity = 36/125 (28.80%), Postives = 61/125 (48.80%), Query Frame = 1
Query: 2359 RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA--KKCSKKK 2727
            R+ S  R   C +C K +K    L  H++ H +      C  C ++F    ++  H++T H   + F C  C   F T  SL  H  +H+  +P+ACP C ++F+   +   HI++  K+C  +K
Sbjct:  414 REESGIRWHICTYCNKEFKKPSDLVRHIRIH-THEKPFKCLQCFRAFAVKSTLTAHIKT-HSGIKAFKCDFCMKCFSTSGSLKVHIRLHTGVRPFACPHCDKKFRTSGHRKTHIASHFKQCELRK 536          
BLAST of Zinc finger, C2H2 type vs. Ensembl Xenopus
Match: gpr89b (G protein-coupled receptor 89B [Source:Xenbase;Acc:XB-GENE-484935])

HSP 1 Score: 162.54 bits (410), Expect = 2.725e-39
Identity = 99/306 (32.35%), Postives = 151/306 (49.35%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKP----TANSNNP----PDVKPLIWNEL-LNQPIPIAE-------IDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            +G R   C +C K ++K  DL RHIRIHT +KPF+C  C ++F +KS L  H K+H  +K F C+ C K F+   +LKVH +LH   +  F C  CD++F T  H + H + SH +                     +    + KP       SN P    P  +P++  +L L QPIP          I+      +R +KC +C ++YK   +L +H++ H +      C  C + F +   ++ H+RT H   R + CL C   F T  SL RH  +H++ +PY CP C + FK  + C +H+
Sbjct:  456 SGIRWHICTYCNKEFKKPSDLVRHIRIHTHEKPFKCLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKCFSTSGSLKVHIRLHTGVR-PFACPHCDKKFRTSGHRKTHIA-SHFKQC-----------------ELRKLRQQRKPGKVRVGKSNVPVSEIPLQEPILITDLGLIQPIPRNSQFFQNYFINSYTHEVDRPYKCYYCHRAYKKSCHLKQHIRSH-TGEKPFKCTQCGRGFASSGVLKAHIRT-HTGLRDYKCLVCNGAFTTGGSLRRHMCIHNDLRPYMCPYCQKTFKTSLNCKKHM 740          

HSP 2 Score: 143.28 bits (360), Expect = 2.079e-33
Identity = 103/327 (31.50%), Postives = 156/327 (47.71%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFR---RFR--CRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTG----FHLRYHYSTSHHR 2178
            C +CG+ F +  +L+ HE THTG+K + C IC   FT   S+  HM  H ++K + C FC + F    +   H+K  H+N    L                              + +T+++ +++ +I +    E+ + E   S +  H   T +   +AE    L   +  +G  +SE V  +     + ++ E IKD+        +F   C FC K ++K  DL RHIRIHT +KPF+C  C KSF +KS L +H K+H   K FSC +C+  F+ K +LKVH +LH   K  F C  CD RF T      H++ HY     R
Sbjct:  973 CTMCGRGFVSSGVLKSHEKTHTGVKAYSCTICNAAFTTNGSLTRHMSTHISMKPYKCPFCDETFRTTVHCKKHMKK-HQNIGPAL------------------------------VPDTDETATEEGDICK---TEDESAERSASRKSRHGVITFTEEETAE----LAKIRPREGATISEKV-LVQSAAEKDRISE-IKDKQAEMETEPKFANCCSFCPKSFKKPSDLIRHIRIHTGEKPFKCDECGKSFTVKSTLDSHVKTHAGQKLFSCHVCSNSFSTKGSLKVHMRLHTGAK-PFKCPHCDMRFRTSGRRKTHIQCHYKADAKR 1258          

HSP 3 Score: 124.405 bits (311), Expect = 1.155e-27
Identity = 109/426 (25.59%), Postives = 173/426 (40.61%), Query Frame = 1
Query: 1771 ERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHY----------------STSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIP----IAEIDKRKLSNNRLFK----CNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNR---FQQNDLM-------------TGIINRNPIGSLTNQIGQSDLEANDQSETFTAFRLEDLDMNSAQSSNI-LVTNYVNE 2925
            E I+ +T      E  +D+    R +RC +C K ++KS  L +HIR HT +KP++C MC + F    VLK+H K+H  +K +SC ICN  F    +L  H   H   K  + C  CD  F T  H + H                 + +    I   +    +               + +    +   P     I  ++L Q       I+EI  ++       K    C+ C KS+K    L  H++ H +      C  C KSF    ++  H++T H  ++ FSC  C   F TK SL  H  +H+ +KP+ CP C  RF+       HI     +  KR R    Q  +L+             + +++     SL   +GQ+ L A+  +       L D  + + +   + L  N V +
Sbjct:  920 EEIELQTQSAPFLESTEDR--SRRAYRCDYCNKGFKKSSHLKQHIRSHTGEKPYKCTMCGRGFVSSGVLKSHEKTHTGVKAYSCTICNAAFTTNGSLTRHMSTHISMK-PYKCPFCDETFRTTVHCKKHMKKHQNIGPALVPDTDETATEEGDICKTEDESAERSASRKSRHGVITFTEEETAELAKIRPREGATISEKVLVQSAAEKDRISEIKDKQAEMETEPKFANCCSFCPKSFKKPSDLIRHIRIH-TGEKPFKCDECGKSFTVKSTLDSHVKT-HAGQKLFSCHVCSNSFSTKGSLKVHMRLHTGAKPFKCPHCDMRFRTSGRRKTHIQCHYKADAKRIRKPSLQPINLLNTSATDPSVFITNSSVLSSQFDQSLQGLVGQAILPASVSAGGDLTVSLSDGSLATLEGIQLQLAANLVGQ 1340          

HSP 4 Score: 114.39 bits (285), Expect = 1.339e-24
Identity = 93/325 (28.62%), Postives = 137/325 (42.15%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHE-NDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH---KNGT 1470
            C+IC + FP +  Y +HM  HE ND+  +C  C +S+N + NL +H A  + ++ T            C  C   FSR  + +AH ++H+ +E L C  C   F     L  H+ +H+         + +    CK C   F++   +K+     H KT  H+ I          RV                          A  RS         NR+I + G            + +C  CGK F+ P  L RH   HTG + F+C IC K F QK ++  HMV H   K   C FC  AF+ + N+ +HI+ +H   KNG 
Sbjct:   23 CDICLLSFPKETQYQRHMRDHERNDKAHRCDQCPMSFNIDFNLTLHKATHNVDDPT------------CPACRKKFSRVASLKAHIMLHEKEETLICSECGDEFTLPNNLSLHMEEHR------QELVGSKTYSCKSCKKTFDSTPQLKE-----HMKT--HFKI----------RV--------------------------ANTRS--------YNRNIDRSG-----------FSYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCNICGKAFNQKGALATHMVKHTGEKPHACAFCPAAFSQKGNLQSHIQRVHSEVKNGA 267          

HSP 5 Score: 94.7449 bits (234), Expect = 1.265e-18
Identity = 83/355 (23.38%), Postives = 150/355 (42.25%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV--------IHKNGTEVLSQSQEHLLNESNXXXXXXQKD-----PNRFKKIASLAETNQSPSDDA---EITQYLWNEN-PTNENHF-SYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETG--QIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLT---------RHIRIHTQQKPF------------QCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            C  CG+ F +  +L+ H  THTG+++++C +C   FT   S++ HM +H++++ ++C +C K F    N   H+K         +H++   V  ++    ++ SN  + E   D      +  ++  ++ + +  P  D     + Q L  +N  T+E+ F + Q   Q N + Y  +       D     QG  +++   +  + +   Q+Q    ++ Q       +          + ++T           I + TQ  PF            +C  C+K F+  S LK H +SH   K + C +C + F     LK H + H   K  + C IC+  F T   L  H ST
Sbjct:  667 CTQCGRGFASSGVLKAHIRTHTGLRDYKCLVCNGAFTTGGSLRRHMCIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHRYEVASQLHQHQPAVSEETPADQIHVSNQIQVEIAGDGLHQSSSVARQPEAILQLSPQPVLDTVSPALGQTLTEQNLETDEDRFVTSQHALQENINQYETTELPTQSYDQQGLSQGFTVTDSFSQQAQFSAVQQLQDSSTLESQALSTSYQQPTLLEVPTADTINVTARLIQEGTHEEIELQTQSAPFLESTEDRSRRAYRCDYCNKGFKKSSHLKQHIRSHTGEKPYKCTMCGRGFVSSGVLKSHEKTHTGVKA-YSCTICNAAFTTNGSLTRHMST 1020          

HSP 6 Score: 91.6633 bits (226), Expect = 1.181e-17
Identity = 39/109 (35.78%), Postives = 63/109 (57.80%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            R ++C +C++ Y+KSC L +HIR HT +KPF+C  C + F    VLK H ++H  L+++ C +CN  F    +L+ H  +H  D   ++C  C + F T  + + H  T
Sbjct:  635 RPYKCYYCHRAYKKSCHLKQHIRSHTGEKPFKCTQCGRGFASSGVLKAHIRTHTGLRDYKCLVCNGAFTTGGSLRRHMCIHN-DLRPYMCPYCQKTFKTSLNCKKHMKT 742          

HSP 7 Score: 86.2705 bits (212), Expect = 4.432e-16
Identity = 80/296 (27.03%), Postives = 123/296 (41.55%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIF----NLKQTLKVHR-----QLHE 2085
            C  C +AF     L  H  TH+GIK F+C  C K F+   S+K+H+ +H  V+ F C  C K F    +  THI   H    E+    Q              Q+ P + +   S    ++ P  +  +   L    P   N   +Q N+  N  SY    +   K  +              R  K++  ++ H  I+   TG + F+C  C + +  S  L  HIR HT  + ++C +C+ +F     L+ H   H  L+ + C  C K F    N K+ +K HR     QLH+
Sbjct:  491 CLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKCFSTSGSLKVHIRLHTGVRPFACPHCDKKFRTSGHRKTHI-ASHFKQCELRKLRQ--------------QRKPGKVRVGKSNVPVSEIPLQEPILITDLGLIQPIPRNSQFFQ-NYFIN--SYTHEVDRPYKCYY------------CHRAYKKSCHLKQH--IRSH-TGEKPFKCTQCGRGFASSGVLKAHIRTHTGLRDYKCLVCNGAFTTGGSLRRHMCIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHRYEVASQLHQ 753          

HSP 8 Score: 75.8702 bits (185), Expect = 7.886e-13
Identity = 35/91 (38.46%), Postives = 49/91 (53.85%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEH 1497
            C  C KAF  P  L RH   HTG + F+C +C+K F QKS++++HM  H   K + C +C   FT + NM  H+K  H    E ++    H
Sbjct: 1689 CDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHMKKHTGEKPYKCDYCSMTFTQKCNMKLHMKRTHAYPGEYVAMPSPH 1779          

HSP 9 Score: 71.633 bits (174), Expect = 1.443e-11
Identity = 32/77 (41.56%), Postives = 45/77 (58.44%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVH 2070
            + F+C  C K + K   L RH RIHT ++PFQC +C K+F  KS L+ H K H   K + C+ C+  F  K  +K+H
Sbjct: 1685 KLFKCDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHMKKHTGEKPYKCDYCSMTFTQKCNMKLH 1761          

HSP 10 Score: 68.5514 bits (166), Expect = 1.099e-10
Identity = 42/117 (35.90%), Postives = 57/117 (48.72%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQ-LHEPDK--LRFVCKICDRRFNTGFHLRYHYSTSH 2172
            +GF  + C  C K ++K   LTRHIRIHT ++PF+C +C K+F  K  L  H   H   K  +C  C   F+ K  L+ H Q +H   K    + C  C   F +   L  H S  H
Sbjct:  177 SGFS-YSCPHCGKTFQKPSQLTRHIRIHTGERPFKCNICGKAFNQKGALATHMVKHTGEKPHACAFCPAAFSQKGNLQSHIQRVHSEVKNGATYHCTDCSCIFKSLGSLNTHISKMH 292          

HSP 11 Score: 67.781 bits (164), Expect = 2.050e-10
Identity = 36/111 (32.43%), Postives = 60/111 (54.05%), Query Frame = 1
Query: 3553 YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            +H C  C+ +FK    LV H++  H   + F C  C +AF+ K +L AH KTH   ++F C  C+ C   F +  SL  H+R+  +  +  + C HC+K ++T+    +H+
Sbjct:  460 WHICTYCNKEFKKPSDLVRHIRI-HTHEKPFKCLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKC---FSTSGSLKVHIRL--HTGVRPFACPHCDKKFRTSGHRKTHI 564          

HSP 12 Score: 67.0106 bits (162), Expect = 3.098e-10
Identity = 74/310 (23.87%), Postives = 111/310 (35.81%), Query Frame = 1
Query: 1795 QIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKL---RFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRH-GLVHS---NSKPYACPLCLRRFKAKIYCDRHIS 2703
            + Q    ++D     +  RC  C   +    +LT H   H    P  C  C K F   + LK H   H K +   C  C   F L   L +H + H  + +    + CK C + F++   L+ H  T     +AN                          + N N                      ID+   S    + C HCGK+++    L  H++ H +      C  C K+F    ++  H+  +H   +  +C  CPA F  K +L  H   VHS   N   Y C  C   FK+    + HIS
Sbjct:   33 ETQYQRHMRDHERNDKAHRCDQCPMSFNIDFNLTLHKATHNVDDP-TCPACRKKFSRVASLKAHIMLHEKEETLICSECGDEFTLPNNLSLHMEEHRQELVGSKTYSCKSCKKTFDSTPQLKEHMKTHFKIRVANTR------------------------SYNRN----------------------IDRSGFS----YSCPHCGKTFQKPSQLTRHIRIH-TGERPFKCNICGKAFNQKGALATHM-VKHTGEKPHACAFCPAAFSQKGNLQSHIQRVHSEVKNGATYHCTDCSCIFKSLGSLNTHIS 289          

HSP 13 Score: 63.5438 bits (153), Expect = 4.148e-9
Identity = 35/124 (28.23%), Postives = 67/124 (54.03%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSDYDALIINSNQ 3933
            C  C+  FK S  L +H++S H   + + C +C + F +   L +H KTH   +++ C +C   N  F +  SL+RH  M  + ++  Y+C  C++ ++TT     H+K+  +   AL+ ++++
Sbjct:  945 CDYCNKGFKKSSHLKQHIRS-HTGEKPYKCTMCGRGFVSSGVLKSHEKTHTGVKAYSCTIC---NAAFTTNGSLTRH--MSTHISMKPYKCPFCDETFRTTVHCKKHMKKHQNIGPALVPDTDE 1062          

HSP 14 Score: 63.1586 bits (152), Expect = 4.787e-9
Identity = 37/123 (30.08%), Postives = 64/123 (52.03%), Query Frame = 1
Query: 3520 QSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            Q+  E  P KF + C+ C   FK    L+ H++  H   + F C+ C K+F+ K +L +H KTH   + F C V   C+  F +  SL  H+R+  +     ++C HC+  ++T+    +H++
Sbjct: 1134 QAEMETEP-KFANCCSFCPKSFKKPSDLIRHIRI-HTGEKPFKCDECGKSFTVKSTLDSHVKTHAGQKLFSCHV---CSNSFSTKGSLKVHMRL--HTGAKPFKCPHCDMRFRTSGRRKTHIQ 1249          

HSP 15 Score: 61.6178 bits (148), Expect = 1.543e-8
Identity = 34/117 (29.06%), Postives = 57/117 (48.72%), Query Frame = 1
Query: 3550 FYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHND--NLNLYRCTHCNKVYKTTRELDSHVKQL 3894
            F + C +C   F+    L  H++  H   R F CN+C KAF+ K +L  H   H   +   C  C A    F    +L  H++  H++  N   Y CT C+ ++K+   L++H+ ++
Sbjct:  179 FSYSCPHCGKTFQKPSQLTRHIRI-HTGERPFKCNICGKAFNQKGALATHMVKHTGEKPHACAFCPAA---FSQKGNLQSHIQRVHSEVKNGATYHCTDCSCIFKSLGSLNTHISKM 291          

HSP 16 Score: 60.8474 bits (146), Expect = 2.495e-8
Identity = 29/76 (38.16%), Postives = 40/76 (52.63%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            C  C K FK P  L RH   HT  K F+C  C + F  KS++  H+  H  +K F C FC K F+   ++  HI++
Sbjct:  463 CTYCNKEFKKPSDLVRHIRIHTHEKPFKCLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKCFSTSGSLKVHIRL 538          

HSP 17 Score: 60.8474 bits (146), Expect = 2.807e-8
Identity = 37/127 (29.13%), Postives = 59/127 (46.46%), Query Frame = 1
Query: 1852 CRFCYKLYRKSCDLTRHIRIH------TQQKP--FQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH---HRSIANPDP 2199
            C  C K ++++  L  H++ H      + Q P  F+C  C K+F   S L+ H + H   + F C +C K FN K  L+VH + H  +K  + C  C   F    +++ H   +H      +A P P
Sbjct: 1653 CHLCNKAFKRASHLKEHMQTHQPGPSRSSQMPKLFKCDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHMKKHTGEK-PYKCDYCSMTFTQKCNMKLHMKRTHAYPGEYVAMPSP 1778          

HSP 18 Score: 60.077 bits (144), Expect = 4.731e-8
Identity = 58/243 (23.87%), Postives = 91/243 (37.45%), Query Frame = 1
Query: 2020 CEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPD-PXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNV---------------CQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C+IC   F  +   + H + HE +     C  C   FN  F+L  H +T    ++ +P  P+  +               + + T   +   D   L  N  L+      E  +++L  ++ + C  C K++     L EH+K H      N                C  C K+F     + +H+R  H   R F C  C   F  K +L  H + H+  KP+AC  C   F  K     HI
Sbjct:   23 CDICLLSFPKETQYQRHMRDHERNDKAHRCDQCPMSFNIDFNLTLHKAT---HNVDDPTCPACRKKFSRVASLKAHIMLHEKEETLICSECGDEFTLPNNLSLHM-----EEHRQELVGSKTYSCKSCKKTFDSTPQLKEHMKTHFKIRVANTRSYNRNIDRSGFSYSCPHCGKTFQKPSQLTRHIRI-HTGERPFKCNICGKAFNQKGALATHMVKHTGEKPHACAFCPAAFSQKGNLQSHI 256          

HSP 19 Score: 59.3066 bits (142), Expect = 8.111e-8
Identity = 33/113 (29.20%), Postives = 50/113 (44.25%), Query Frame = 1
Query: 2383 FKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRK-------FSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            F+CNHC   +     L EH KE       +VC  CNK+F     +++H++T      +       F C  C   F   + L RH  +H+  +P+ C LC + F  K     H+
Sbjct: 1625 FECNHC---FPSAAILAEHNKEAHGKERIHVCHLCNKAFKRASHLKEHMQTHQPGPSRSSQMPKLFKCDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHM 1734          

HSP 20 Score: 58.151 bits (139), Expect = 1.673e-7
Identity = 36/127 (28.35%), Postives = 56/127 (44.09%), Query Frame = 1
Query: 2341 IAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNV-------CQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            +AE +K      R+  C+ C K++K   +L EH++ H    + +        C  C+K+F     +++H R  H   R F C  C   F  K++L  H   H+  KPY C  C   F  K     H+
Sbjct: 1637 LAEHNKEAHGKERIHVCHLCNKAFKRASHLKEHMQTHQPGPSRSSQMPKLFKCDTCDKAFAKPSQLERHSRI-HTGERPFQCTLCEKAFNQKSALQVHMKKHTGEKPYKCDYCSMTFTQKCNMKLHM 1762          

HSP 21 Score: 55.8398 bits (133), Expect = 7.493e-7
Identity = 40/131 (30.53%), Postives = 56/131 (42.75%), Query Frame = 1
Query: 3517 LQSHP-EISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFG-----CFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            LQ HP +       H C  C+H F  +  L EH K  H   R   C++C+KAF     L  H +TH    S        F C  C++ F     L RH R+   +    ++CT C K +     L  H+K+
Sbjct: 1608 LQIHPGQADKEGRLHQCFECNHCFPSAAILAEHNKEAHGKERIHVCHLCNKAFKRASHLKEHMQTHQPGPSRSSQMPKLFKCDTCDKAFAKPSQLERHSRIHTGE--RPFQCTLCEKAFNQKSALQVHMKK 1736          

HSP 22 Score: 55.4546 bits (132), Expect = 1.123e-6
Identity = 36/125 (28.80%), Postives = 61/125 (48.80%), Query Frame = 1
Query: 2359 RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA--KKCSKKK 2727
            R+ S  R   C +C K +K    L  H++ H +      C  C ++F    ++  H++T H   + F C  C   F T  SL  H  +H+  +P+ACP C ++F+   +   HI++  K+C  +K
Sbjct:  453 REESGIRWHICTYCNKEFKKPSDLVRHIRIH-THEKPFKCLQCFRAFAVKSTLTAHIKT-HSGIKAFKCDFCMKCFSTSGSLKVHIRLHTGVRPFACPHCDKKFRTSGHRKTHIASHFKQCELRK 575          

HSP 23 Score: 54.6842 bits (130), Expect = 1.668e-6
Identity = 58/255 (22.75%), Postives = 107/255 (41.96%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKP-----IKEVIPEIPK---KLIKCLSCSFIFNTKAKYDNHFCVG-----LKAEKSHLNRC--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            Y C  C+KGF ++S+L+QH+  HT  +PY+C  C + F     LK+HE T H+ V K   C +C     +  +L  H+  H+      C  C + F       +H+ +      + +    E     G++  T          ++ +       +E   E+ K   +    +S   +  + A+ D    +      ++ E    N C  C K+F+  S  + H++ +H     + C +C   F  +S+  +H K+
Sbjct:  943 YRCDYCNKGFKKSSHLKQHIRSHTGEKPYKCTMCGRGFVSSGVLKSHEKT-HTGV-KAYSCTICNAAFTTNGSLTRHMSTHISMKPYKCPFCDETFRTTVHCKKHMKKHQNIGPALVPDTDETATEEGDICKTEDESAERSASRKSRHGVITFTEEETAELAKIRPREGATISEKVLVQSAAEKDRISEIKDKQAEMETEPKFANCCSFCPKSFKKPSDLIRHIR-IHTGEKPFKCDECGKSFTVKSTLDSHVKT 1194          
BLAST of Zinc finger, C2H2 type vs. Ensembl Xenopus
Match: gpr89b (G protein-coupled receptor 89B [Source:Xenbase;Acc:XB-GENE-484935])

HSP 1 Score: 162.54 bits (410), Expect = 2.805e-39
Identity = 99/306 (32.35%), Postives = 151/306 (49.35%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKP----TANSNNP----PDVKPLIWNEL-LNQPIPIAE-------IDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            +G R   C +C K ++K  DL RHIRIHT +KPF+C  C ++F +KS L  H K+H  +K F C+ C K F+   +LKVH +LH   +  F C  CD++F T  H + H + SH +                     +    + KP       SN P    P  +P++  +L L QPIP          I+      +R +KC +C ++YK   +L +H++ H +      C  C + F +   ++ H+RT H   R + CL C   F T  SL RH  +H++ +PY CP C + FK  + C +H+
Sbjct:  466 SGIRWHICTYCNKEFKKPSDLVRHIRIHTHEKPFKCLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKCFSTSGSLKVHIRLHTGVR-PFACPHCDKKFRTSGHRKTHIA-SHFKQC-----------------ELRKLRQQRKPGKVRVGKSNVPVSEIPLQEPILITDLGLIQPIPRNSQFFQNYFINSYTHEVDRPYKCYYCHRAYKKSCHLKQHIRSH-TGEKPFKCTQCGRGFASSGVLKAHIRT-HTGLRDYKCLVCNGAFTTGGSLRRHMCIHNDLRPYMCPYCQKTFKTSLNCKKHM 750          

HSP 2 Score: 143.28 bits (360), Expect = 2.213e-33
Identity = 103/327 (31.50%), Postives = 156/327 (47.71%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFR---RFR--CRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTG----FHLRYHYSTSHHR 2178
            C +CG+ F +  +L+ HE THTG+K + C IC   FT   S+  HM  H ++K + C FC + F    +   H+K  H+N    L                              + +T+++ +++ +I +    E+ + E   S +  H   T +   +AE    L   +  +G  +SE V  +     + ++ E IKD+        +F   C FC K ++K  DL RHIRIHT +KPF+C  C KSF +KS L +H K+H   K FSC +C+  F+ K +LKVH +LH   K  F C  CD RF T      H++ HY     R
Sbjct:  983 CTMCGRGFVSSGVLKSHEKTHTGVKAYSCTICNAAFTTNGSLTRHMSTHISMKPYKCPFCDETFRTTVHCKKHMKK-HQNIGPAL------------------------------VPDTDETATEEGDICK---TEDESAERSASRKSRHGVITFTEEETAE----LAKIRPREGATISEKV-LVQSAAEKDRISE-IKDKQAEMETEPKFANCCSFCPKSFKKPSDLIRHIRIHTGEKPFKCDECGKSFTVKSTLDSHVKTHAGQKLFSCHVCSNSFSTKGSLKVHMRLHTGAK-PFKCPHCDMRFRTSGRRKTHIQCHYKADAKR 1268          

HSP 3 Score: 124.405 bits (311), Expect = 1.187e-27
Identity = 109/426 (25.59%), Postives = 173/426 (40.61%), Query Frame = 1
Query: 1771 ERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHY----------------STSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIP----IAEIDKRKLSNNRLFK----CNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNR---FQQNDLM-------------TGIINRNPIGSLTNQIGQSDLEANDQSETFTAFRLEDLDMNSAQSSNI-LVTNYVNE 2925
            E I+ +T      E  +D+    R +RC +C K ++KS  L +HIR HT +KP++C MC + F    VLK+H K+H  +K +SC ICN  F    +L  H   H   K  + C  CD  F T  H + H                 + +    I   +    +               + +    +   P     I  ++L Q       I+EI  ++       K    C+ C KS+K    L  H++ H +      C  C KSF    ++  H++T H  ++ FSC  C   F TK SL  H  +H+ +KP+ CP C  RF+       HI     +  KR R    Q  +L+             + +++     SL   +GQ+ L A+  +       L D  + + +   + L  N V +
Sbjct:  930 EEIELQTQSAPFLESTEDR--SRRAYRCDYCNKGFKKSSHLKQHIRSHTGEKPYKCTMCGRGFVSSGVLKSHEKTHTGVKAYSCTICNAAFTTNGSLTRHMSTHISMK-PYKCPFCDETFRTTVHCKKHMKKHQNIGPALVPDTDETATEEGDICKTEDESAERSASRKSRHGVITFTEEETAELAKIRPREGATISEKVLVQSAAEKDRISEIKDKQAEMETEPKFANCCSFCPKSFKKPSDLIRHIRIH-TGEKPFKCDECGKSFTVKSTLDSHVKT-HAGQKLFSCHVCSNSFSTKGSLKVHMRLHTGAKPFKCPHCDMRFRTSGRRKTHIQCHYKADAKRIRKPSLQPINLLNTSATDPSVFITNSSVLSSQFDQSLQGLVGQAILPASVSAGGDLTVSLSDGSLATLEGIQLQLAANLVGQ 1350          

HSP 4 Score: 114.39 bits (285), Expect = 1.265e-24
Identity = 93/325 (28.62%), Postives = 137/325 (42.15%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHE-NDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH---KNGT 1470
            C+IC + FP +  Y +HM  HE ND+  +C  C +S+N + NL +H A  + ++ T            C  C   FSR  + +AH ++H+ +E L C  C   F     L  H+ +H+         + +    CK C   F++   +K+     H KT  H+ I          RV                          A  RS         NR+I + G            + +C  CGK F+ P  L RH   HTG + F+C IC K F QK ++  HMV H   K   C FC  AF+ + N+ +HI+ +H   KNG 
Sbjct:   33 CDICLLSFPKETQYQRHMRDHERNDKAHRCDQCPMSFNIDFNLTLHKATHNVDDPT------------CPACRKKFSRVASLKAHIMLHEKEETLICSECGDEFTLPNNLSLHMEEHR------QELVGSKTYSCKSCKKTFDSTPQLKE-----HMKT--HFKI----------RV--------------------------ANTRS--------YNRNIDRSG-----------FSYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCNICGKAFNQKGALATHMVKHTGEKPHACAFCPAAFSQKGNLQSHIQRVHSEVKNGA 277          

HSP 5 Score: 94.7449 bits (234), Expect = 1.310e-18
Identity = 83/355 (23.38%), Postives = 150/355 (42.25%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV--------IHKNGTEVLSQSQEHLLNESNXXXXXXQKD-----PNRFKKIASLAETNQSPSDDA---EITQYLWNEN-PTNENHF-SYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETG--QIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLT---------RHIRIHTQQKPF------------QCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            C  CG+ F +  +L+ H  THTG+++++C +C   FT   S++ HM +H++++ ++C +C K F    N   H+K         +H++   V  ++    ++ SN  + E   D      +  ++  ++ + +  P  D     + Q L  +N  T+E+ F + Q   Q N + Y  +       D     QG  +++   +  + +   Q+Q    ++ Q       +          + ++T           I + TQ  PF            +C  C+K F+  S LK H +SH   K + C +C + F     LK H + H   K  + C IC+  F T   L  H ST
Sbjct:  677 CTQCGRGFASSGVLKAHIRTHTGLRDYKCLVCNGAFTTGGSLRRHMCIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHRYEVASQLHQHQPAVSEETPADQIHVSNQIQVEIAGDGLHQSSSVARQPEAILQLSPQPVLDTVSPALGQTLTEQNLETDEDRFVTSQHALQENINQYETTELPTQSYDQQGLSQGFTVTDSFSQQAQFSAVQQLQDSSTLESQALSTSYQQPTLLEVPTADTINVTARLIQEGTHEEIELQTQSAPFLESTEDRSRRAYRCDYCNKGFKKSSHLKQHIRSHTGEKPYKCTMCGRGFVSSGVLKSHEKTHTGVKA-YSCTICNAAFTTNGSLTRHMST 1030          

HSP 6 Score: 91.6633 bits (226), Expect = 1.213e-17
Identity = 39/109 (35.78%), Postives = 63/109 (57.80%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            R ++C +C++ Y+KSC L +HIR HT +KPF+C  C + F    VLK H ++H  L+++ C +CN  F    +L+ H  +H  D   ++C  C + F T  + + H  T
Sbjct:  645 RPYKCYYCHRAYKKSCHLKQHIRSHTGEKPFKCTQCGRGFASSGVLKAHIRTHTGLRDYKCLVCNGAFTTGGSLRRHMCIHN-DLRPYMCPYCQKTFKTSLNCKKHMKT 752          

HSP 7 Score: 86.2705 bits (212), Expect = 4.184e-16
Identity = 80/296 (27.03%), Postives = 123/296 (41.55%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIF----NLKQTLKVHR-----QLHE 2085
            C  C +AF     L  H  TH+GIK F+C  C K F+   S+K+H+ +H  V+ F C  C K F    +  THI   H    E+    Q              Q+ P + +   S    ++ P  +  +   L    P   N   +Q N+  N  SY    +   K  +              R  K++  ++ H  I+   TG + F+C  C + +  S  L  HIR HT  + ++C +C+ +F     L+ H   H  L+ + C  C K F    N K+ +K HR     QLH+
Sbjct:  501 CLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKCFSTSGSLKVHIRLHTGVRPFACPHCDKKFRTSGHRKTHI-ASHFKQCELRKLRQ--------------QRKPGKVRVGKSNVPVSEIPLQEPILITDLGLIQPIPRNSQFFQ-NYFIN--SYTHEVDRPYKCYY------------CHRAYKKSCHLKQH--IRSH-TGEKPFKCTQCGRGFASSGVLKAHIRTHTGLRDYKCLVCNGAFTTGGSLRRHMCIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHRYEVASQLHQ 763          

HSP 8 Score: 75.485 bits (184), Expect = 7.962e-13
Identity = 35/91 (38.46%), Postives = 49/91 (53.85%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEH 1497
            C  C KAF  P  L RH   HTG + F+C +C+K F QKS++++HM  H   K + C +C   FT + NM  H+K  H    E ++    H
Sbjct: 1699 CDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHMKKHTGEKPYKCDYCSMTFTQKCNMKLHMKRTHAYPGEYVAMPSPH 1789          

HSP 9 Score: 71.633 bits (174), Expect = 1.397e-11
Identity = 32/77 (41.56%), Postives = 45/77 (58.44%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVH 2070
            + F+C  C K + K   L RH RIHT ++PFQC +C K+F  KS L+ H K H   K + C+ C+  F  K  +K+H
Sbjct: 1695 KLFKCDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHMKKHTGEKPYKCDYCSMTFTQKCNMKLH 1771          

HSP 10 Score: 68.5514 bits (166), Expect = 1.119e-10
Identity = 42/117 (35.90%), Postives = 57/117 (48.72%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQ-LHEPDK--LRFVCKICDRRFNTGFHLRYHYSTSH 2172
            +GF  + C  C K ++K   LTRHIRIHT ++PF+C +C K+F  K  L  H   H   K  +C  C   F+ K  L+ H Q +H   K    + C  C   F +   L  H S  H
Sbjct:  187 SGFS-YSCPHCGKTFQKPSQLTRHIRIHTGERPFKCNICGKAFNQKGALATHMVKHTGEKPHACAFCPAAFSQKGNLQSHIQRVHSEVKNGATYHCTDCSCIFKSLGSLNTHISKMH 302          

HSP 11 Score: 67.781 bits (164), Expect = 2.070e-10
Identity = 36/111 (32.43%), Postives = 60/111 (54.05%), Query Frame = 1
Query: 3553 YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            +H C  C+ +FK    LV H++  H   + F C  C +AF+ K +L AH KTH   ++F C  C+ C   F +  SL  H+R+  +  +  + C HC+K ++T+    +H+
Sbjct:  470 WHICTYCNKEFKKPSDLVRHIRI-HTHEKPFKCLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKC---FSTSGSLKVHIRL--HTGVRPFACPHCDKKFRTSGHRKTHI 574          

HSP 12 Score: 67.0106 bits (162), Expect = 3.024e-10
Identity = 74/310 (23.87%), Postives = 111/310 (35.81%), Query Frame = 1
Query: 1795 QIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKL---RFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRH-GLVHS---NSKPYACPLCLRRFKAKIYCDRHIS 2703
            + Q    ++D     +  RC  C   +    +LT H   H    P  C  C K F   + LK H   H K +   C  C   F L   L +H + H  + +    + CK C + F++   L+ H  T     +AN                          + N N                      ID+   S    + C HCGK+++    L  H++ H +      C  C K+F    ++  H+  +H   +  +C  CPA F  K +L  H   VHS   N   Y C  C   FK+    + HIS
Sbjct:   43 ETQYQRHMRDHERNDKAHRCDQCPMSFNIDFNLTLHKATHNVDDP-TCPACRKKFSRVASLKAHIMLHEKEETLICSECGDEFTLPNNLSLHMEEHRQELVGSKTYSCKSCKKTFDSTPQLKEHMKTHFKIRVANTR------------------------SYNRN----------------------IDRSGFS----YSCPHCGKTFQKPSQLTRHIRIH-TGERPFKCNICGKAFNQKGALATHM-VKHTGEKPHACAFCPAAFSQKGNLQSHIQRVHSEVKNGATYHCTDCSCIFKSLGSLNTHIS 299          

HSP 13 Score: 63.5438 bits (153), Expect = 4.117e-9
Identity = 35/124 (28.23%), Postives = 67/124 (54.03%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSDYDALIINSNQ 3933
            C  C+  FK S  L +H++S H   + + C +C + F +   L +H KTH   +++ C +C   N  F +  SL+RH  M  + ++  Y+C  C++ ++TT     H+K+  +   AL+ ++++
Sbjct:  955 CDYCNKGFKKSSHLKQHIRS-HTGEKPYKCTMCGRGFVSSGVLKSHEKTHTGVKAYSCTIC---NAAFTTNGSLTRH--MSTHISMKPYKCPFCDETFRTTVHCKKHMKKHQNIGPALVPDTDE 1072          

HSP 14 Score: 63.1586 bits (152), Expect = 4.751e-9
Identity = 37/123 (30.08%), Postives = 64/123 (52.03%), Query Frame = 1
Query: 3520 QSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            Q+  E  P KF + C+ C   FK    L+ H++  H   + F C+ C K+F+ K +L +H KTH   + F C V   C+  F +  SL  H+R+  +     ++C HC+  ++T+    +H++
Sbjct: 1144 QAEMETEP-KFANCCSFCPKSFKKPSDLIRHIRI-HTGEKPFKCDECGKSFTVKSTLDSHVKTHAGQKLFSCHV---CSNSFSTKGSLKVHMRL--HTGAKPFKCPHCDMRFRTSGRRKTHIQ 1259          

HSP 15 Score: 61.6178 bits (148), Expect = 1.519e-8
Identity = 34/117 (29.06%), Postives = 57/117 (48.72%), Query Frame = 1
Query: 3550 FYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHND--NLNLYRCTHCNKVYKTTRELDSHVKQL 3894
            F + C +C   F+    L  H++  H   R F CN+C KAF+ K +L  H   H   +   C  C A    F    +L  H++  H++  N   Y CT C+ ++K+   L++H+ ++
Sbjct:  189 FSYSCPHCGKTFQKPSQLTRHIRI-HTGERPFKCNICGKAFNQKGALATHMVKHTGEKPHACAFCPAA---FSQKGNLQSHIQRVHSEVKNGATYHCTDCSCIFKSLGSLNTHISKM 301          

HSP 16 Score: 60.8474 bits (146), Expect = 2.455e-8
Identity = 29/76 (38.16%), Postives = 40/76 (52.63%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            C  C K FK P  L RH   HT  K F+C  C + F  KS++  H+  H  +K F C FC K F+   ++  HI++
Sbjct:  473 CTYCNKEFKKPSDLVRHIRIHTHEKPFKCLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKCFSTSGSLKVHIRL 548          

HSP 17 Score: 60.8474 bits (146), Expect = 2.762e-8
Identity = 37/127 (29.13%), Postives = 59/127 (46.46%), Query Frame = 1
Query: 1852 CRFCYKLYRKSCDLTRHIRIH------TQQKP--FQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH---HRSIANPDP 2199
            C  C K ++++  L  H++ H      + Q P  F+C  C K+F   S L+ H + H   + F C +C K FN K  L+VH + H  +K  + C  C   F    +++ H   +H      +A P P
Sbjct: 1663 CHLCNKAFKRASHLKEHMQTHQPGPSRSSQMPKLFKCDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHMKKHTGEK-PYKCDYCSMTFTQKCNMKLHMKRTHAYPGEYVAMPSP 1788          

HSP 18 Score: 60.077 bits (144), Expect = 4.540e-8
Identity = 58/243 (23.87%), Postives = 91/243 (37.45%), Query Frame = 1
Query: 2020 CEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPD-PXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNV---------------CQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C+IC   F  +   + H + HE +     C  C   FN  F+L  H +T    ++ +P  P+  +               + + T   +   D   L  N  L+      E  +++L  ++ + C  C K++     L EH+K H      N                C  C K+F     + +H+R  H   R F C  C   F  K +L  H + H+  KP+AC  C   F  K     HI
Sbjct:   33 CDICLLSFPKETQYQRHMRDHERNDKAHRCDQCPMSFNIDFNLTLHKAT---HNVDDPTCPACRKKFSRVASLKAHIMLHEKEETLICSECGDEFTLPNNLSLHM-----EEHRQELVGSKTYSCKSCKKTFDSTPQLKEHMKTHFKIRVANTRSYNRNIDRSGFSYSCPHCGKTFQKPSQLTRHIRI-HTGERPFKCNICGKAFNQKGALATHMVKHTGEKPHACAFCPAAFSQKGNLQSHI 266          

HSP 19 Score: 59.3066 bits (142), Expect = 8.118e-8
Identity = 33/113 (29.20%), Postives = 50/113 (44.25%), Query Frame = 1
Query: 2383 FKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRK-------FSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            F+CNHC   +     L EH KE       +VC  CNK+F     +++H++T      +       F C  C   F   + L RH  +H+  +P+ C LC + F  K     H+
Sbjct: 1635 FECNHC---FPSAAILAEHNKEAHGKERIHVCHLCNKAFKRASHLKEHMQTHQPGPSRSSQMPKLFKCDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHM 1744          

HSP 20 Score: 58.151 bits (139), Expect = 1.777e-7
Identity = 36/127 (28.35%), Postives = 56/127 (44.09%), Query Frame = 1
Query: 2341 IAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNV-------CQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            +AE +K      R+  C+ C K++K   +L EH++ H    + +        C  C+K+F     +++H R  H   R F C  C   F  K++L  H   H+  KPY C  C   F  K     H+
Sbjct: 1647 LAEHNKEAHGKERIHVCHLCNKAFKRASHLKEHMQTHQPGPSRSSQMPKLFKCDTCDKAFAKPSQLERHSRI-HTGERPFQCTLCEKAFNQKSALQVHMKKHTGEKPYKCDYCSMTFTQKCNMKLHM 1772          

HSP 21 Score: 56.225 bits (134), Expect = 7.189e-7
Identity = 40/131 (30.53%), Postives = 56/131 (42.75%), Query Frame = 1
Query: 3517 LQSHP-EISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGC-----FVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            LQ HP +       H C  C+H F  +  L EH K  H   R   C++C+KAF     L  H +TH    S        F C  C++ F     L RH R+   +    ++CT C K +     L  H+K+
Sbjct: 1618 LQIHPGQADKEGRLHQCFECNHCFPSAAILAEHNKEAHGKERIHVCHLCNKAFKRASHLKEHMQTHQPGPSRSSQMPKLFKCDTCDKAFAKPSQLERHSRIHTGE--RPFQCTLCEKAFNQKSALQVHMKK 1746          

HSP 22 Score: 55.4546 bits (132), Expect = 1.133e-6
Identity = 36/125 (28.80%), Postives = 61/125 (48.80%), Query Frame = 1
Query: 2359 RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA--KKCSKKK 2727
            R+ S  R   C +C K +K    L  H++ H +      C  C ++F    ++  H++T H   + F C  C   F T  SL  H  +H+  +P+ACP C ++F+   +   HI++  K+C  +K
Sbjct:  463 REESGIRWHICTYCNKEFKKPSDLVRHIRIH-THEKPFKCLQCFRAFAVKSTLTAHIKT-HSGIKAFKCDFCMKCFSTSGSLKVHIRLHTGVRPFACPHCDKKFRTSGHRKTHIASHFKQCELRK 585          

HSP 23 Score: 55.0694 bits (131), Expect = 1.496e-6
Identity = 58/255 (22.75%), Postives = 107/255 (41.96%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKP-----IKEVIPEIPK---KLIKCLSCSFIFNTKAKYDNHFCVG-----LKAEKSHLNRC--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            Y C  C+KGF ++S+L+QH+  HT  +PY+C  C + F     LK+HE T H+ V K   C +C     +  +L  H+  H+      C  C + F       +H+ +      + +    E     G++  T          ++ +       +E   E+ K   +    +S   +  + A+ D    +      ++ E    N C  C K+F+  S  + H++ +H     + C +C   F  +S+  +H K+
Sbjct:  953 YRCDYCNKGFKKSSHLKQHIRSHTGEKPYKCTMCGRGFVSSGVLKSHEKT-HTGV-KAYSCTICNAAFTTNGSLTRHMSTHISMKPYKCPFCDETFRTTVHCKKHMKKHQNIGPALVPDTDETATEEGDICKTEDESAERSASRKSRHGVITFTEEETAELAKIRPREGATISEKVLVQSAAEKDRISEIKDKQAEMETEPKFANCCSFCPKSFKKPSDLIRHIR-IHTGEKPFKCDECGKSFTVKSTLDSHVKT 1204          
BLAST of Zinc finger, C2H2 type vs. Ensembl Xenopus
Match: gpr89b (G protein-coupled receptor 89B [Source:Xenbase;Acc:XB-GENE-484935])

HSP 1 Score: 162.155 bits (409), Expect = 3.540e-39
Identity = 99/306 (32.35%), Postives = 151/306 (49.35%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKP----TANSNNP----PDVKPLIWNEL-LNQPIPIAE-------IDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            +G R   C +C K ++K  DL RHIRIHT +KPF+C  C ++F +KS L  H K+H  +K F C+ C K F+   +LKVH +LH   +  F C  CD++F T  H + H + SH +                     +    + KP       SN P    P  +P++  +L L QPIP          I+      +R +KC +C ++YK   +L +H++ H +      C  C + F +   ++ H+RT H   R + CL C   F T  SL RH  +H++ +PY CP C + FK  + C +H+
Sbjct:  466 SGIRWHICTYCNKEFKKPSDLVRHIRIHTHEKPFKCLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKCFSTSGSLKVHIRLHTGVR-PFACPHCDKKFRTSGHRKTHIA-SHFKQC-----------------ELRKLRQQRKPGKVRVGKSNVPVSEIPLQEPILITDLGLIQPIPRNSQFFQNYFINSYTHEVDRPYKCYYCHRAYKKSCHLKQHIRSH-TGEKPFKCTQCGRGFASSGVLKAHIRT-HTGLRDYKCLVCNGAFTTGGSLRRHMCIHNDLRPYMCPYCQKTFKTSLNCKKHM 750          

HSP 2 Score: 135.961 bits (341), Expect = 3.949e-31
Identity = 103/327 (31.50%), Postives = 149/327 (45.57%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFR---RFR--CRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTG----FHLRYHYSTSHHR 2178
            C +CG+ F +  +L+ HE THTG+K + C IC   FT   S+  HM  H ++K + C FC + F    +   H+K  H+N    L     H +  +N                              +I +    E+ + E   S +  H   T +   +AE    L   +  +G  +SE V  + +   +      IKD+        +F   C FC K ++K  DL RHIRIHT +KPF+C  C KSF +KS L +H K+H   K FSC +C+  F+ K +LKVH +LH   K  F C  CD RF T      H++ HY     R
Sbjct:  983 CTMCGRGFVSSGVLKSHEKTHTGVKAYSCTICNAAFTTNGSLTRHMSTHISMKPYKCPFCDETFRTTVHCKKHMKK-HQNIGPAL-----HAMVLAN----------------------------GGDICK---TEDESAERSASRKSRHGVITFTEEETAE----LAKIRPREGATISEKV--LVQSAAEKDRISEIKDKQAEMETEPKFANCCSFCPKSFKKPSDLIRHIRIHTGEKPFKCDECGKSFTVKSTLDSHVKTHAGQKLFSCHVCSNSFSTKGSLKVHMRLHTGAK-PFKCPHCDMRFRTSGRRKTHIQCHYKADAKR 1265          

HSP 3 Score: 124.02 bits (310), Expect = 1.577e-27
Identity = 98/343 (28.57%), Postives = 146/343 (42.57%), Query Frame = 1
Query: 1771 ERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYS-------TSHHRSIAN------PDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIP----IAEIDKRKLSNNRLFK----CNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNR 2736
            E I+ +T      E  +D+    R +RC +C K ++KS  L +HIR HT +KP++C MC + F    VLK+H K+H  +K +SC ICN  F    +L  H   H   K  + C  CD  F T  H + H           H   +AN       +    +               + +    +   P     I  ++L Q       I+EI  ++       K    C+ C KS+K    L  H++ H +      C  C KSF    ++  H++T H  ++ FSC  C   F TK SL  H  +H+ +KP+ CP C  RF+       HI     +  KR R
Sbjct:  930 EEIELQTQSAPFLESTEDR--SRRAYRCDYCNKGFKKSSHLKQHIRSHTGEKPYKCTMCGRGFVSSGVLKSHEKTHTGVKAYSCTICNAAFTTNGSLTRHMSTHISMK-PYKCPFCDETFRTTVHCKKHMKKHQNIGPALHAMVLANGGDICKTEDESAERSASRKSRHGVITFTEEETAELAKIRPREGATISEKVLVQSAAEKDRISEIKDKQAEMETEPKFANCCSFCPKSFKKPSDLIRHIRIH-TGEKPFKCDECGKSFTVKSTLDSHVKT-HAGQKLFSCHVCSNSFSTKGSLKVHMRLHTGAKPFKCPHCDMRFRTSGRRKTHIQCHYKADAKRIR 1267          

HSP 4 Score: 114.39 bits (285), Expect = 1.421e-24
Identity = 93/325 (28.62%), Postives = 137/325 (42.15%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHE-NDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH---KNGT 1470
            C+IC + FP +  Y +HM  HE ND+  +C  C +S+N + NL +H A  + ++ T            C  C   FSR  + +AH ++H+ +E L C  C   F     L  H+ +H+         + +    CK C   F++   +K+     H KT  H+ I          RV                          A  RS         NR+I + G            + +C  CGK F+ P  L RH   HTG + F+C IC K F QK ++  HMV H   K   C FC  AF+ + N+ +HI+ +H   KNG 
Sbjct:   33 CDICLLSFPKETQYQRHMRDHERNDKAHRCDQCPMSFNIDFNLTLHKATHNVDDPT------------CPACRKKFSRVASLKAHIMLHEKEETLICSECGDEFTLPNNLSLHMEEHR------QELVGSKTYSCKSCKKTFDSTPQLKE-----HMKT--HFKI----------RV--------------------------ANTRS--------YNRNIDRSG-----------FSYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCNICGKAFNQKGALATHMVKHTGEKPHACAFCPAAFSQKGNLQSHIQRVHSEVKNGA 277          

HSP 5 Score: 94.3597 bits (233), Expect = 1.548e-18
Identity = 83/355 (23.38%), Postives = 150/355 (42.25%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV--------IHKNGTEVLSQSQEHLLNESNXXXXXXQKD-----PNRFKKIASLAETNQSPSDDA---EITQYLWNEN-PTNENHF-SYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETG--QIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLT---------RHIRIHTQQKPF------------QCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            C  CG+ F +  +L+ H  THTG+++++C +C   FT   S++ HM +H++++ ++C +C K F    N   H+K         +H++   V  ++    ++ SN  + E   D      +  ++  ++ + +  P  D     + Q L  +N  T+E+ F + Q   Q N + Y  +       D     QG  +++   +  + +   Q+Q    ++ Q       +          + ++T           I + TQ  PF            +C  C+K F+  S LK H +SH   K + C +C + F     LK H + H   K  + C IC+  F T   L  H ST
Sbjct:  677 CTQCGRGFASSGVLKAHIRTHTGLRDYKCLVCNGAFTTGGSLRRHMCIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHRYEVASQLHQHQPAVSEETPADQIHVSNQIQVEIAGDGLHQSSSVARQPEAILQLSPQPVLDTVSPALGQTLTEQNLETDEDRFVTSQHALQENINQYETTELPTQSYDQQGLSQGFTVTDSFSQQAQFSAVQQLQDSSTLESQALSTSYQQPTLLEVPTADTINVTARLIQEGTHEEIELQTQSAPFLESTEDRSRRAYRCDYCNKGFKKSSHLKQHIRSHTGEKPYKCTMCGRGFVSSGVLKSHEKTHTGVKA-YSCTICNAAFTTNGSLTRHMST 1030          

HSP 6 Score: 91.2781 bits (225), Expect = 1.586e-17
Identity = 39/109 (35.78%), Postives = 63/109 (57.80%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            R ++C +C++ Y+KSC L +HIR HT +KPF+C  C + F    VLK H ++H  L+++ C +CN  F    +L+ H  +H  D   ++C  C + F T  + + H  T
Sbjct:  645 RPYKCYYCHRAYKKSCHLKQHIRSHTGEKPFKCTQCGRGFASSGVLKAHIRTHTGLRDYKCLVCNGAFTTGGSLRRHMCIHN-DLRPYMCPYCQKTFKTSLNCKKHMKT 752          

HSP 7 Score: 86.2705 bits (212), Expect = 4.394e-16
Identity = 80/296 (27.03%), Postives = 123/296 (41.55%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIF----NLKQTLKVHR-----QLHE 2085
            C  C +AF     L  H  TH+GIK F+C  C K F+   S+K+H+ +H  V+ F C  C K F    +  THI   H    E+    Q              Q+ P + +   S    ++ P  +  +   L    P   N   +Q N+  N  SY    +   K  +              R  K++  ++ H  I+   TG + F+C  C + +  S  L  HIR HT  + ++C +C+ +F     L+ H   H  L+ + C  C K F    N K+ +K HR     QLH+
Sbjct:  501 CLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKCFSTSGSLKVHIRLHTGVRPFACPHCDKKFRTSGHRKTHI-ASHFKQCELRKLRQ--------------QRKPGKVRVGKSNVPVSEIPLQEPILITDLGLIQPIPRNSQFFQ-NYFIN--SYTHEVDRPYKCYY------------CHRAYKKSCHLKQH--IRSH-TGEKPFKCTQCGRGFASSGVLKAHIRTHTGLRDYKCLVCNGAFTTGGSLRRHMCIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHRYEVASQLHQ 763          

HSP 8 Score: 74.3294 bits (181), Expect = 1.992e-12
Identity = 34/86 (39.53%), Postives = 48/86 (55.81%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLS 1482
            C  C KAF  P  L RH   HTG + F+C +C+K F QKS++++HM  H   K + C +C   FT + NM  H+K  H    E ++
Sbjct: 1701 CDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHMKKHTGEKPYKCDYCSMTFTQKCNMKLHMKRTHAYPGEYVA 1786          

HSP 9 Score: 72.4034 bits (176), Expect = 7.670e-12
Identity = 35/93 (37.63%), Postives = 50/93 (53.76%), Query Frame = 1
Query: 1846 FRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDR 2124
            F+C  C K + K   L RH RIHT ++PFQC +C K+F  KS L+ H K H   K + C+ C+  F  K  +K+H +        +V  I +R
Sbjct: 1699 FKCDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHMKKHTGEKPYKCDYCSMTFTQKCNMKLHMKRTHAYPGEYVAMIVNR 1791          

HSP 10 Score: 68.1662 bits (165), Expect = 1.464e-10
Identity = 42/117 (35.90%), Postives = 57/117 (48.72%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQ-LHEPDK--LRFVCKICDRRFNTGFHLRYHYSTSH 2172
            +GF  + C  C K ++K   LTRHIRIHT ++PF+C +C K+F  K  L  H   H   K  +C  C   F+ K  L+ H Q +H   K    + C  C   F +   L  H S  H
Sbjct:  187 SGFS-YSCPHCGKTFQKPSQLTRHIRIHTGERPFKCNICGKAFNQKGALATHMVKHTGEKPHACAFCPAAFSQKGNLQSHIQRVHSEVKNGATYHCTDCSCIFKSLGSLNTHISKMH 302          

HSP 11 Score: 67.3958 bits (163), Expect = 2.426e-10
Identity = 36/111 (32.43%), Postives = 60/111 (54.05%), Query Frame = 1
Query: 3553 YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            +H C  C+ +FK    LV H++  H   + F C  C +AF+ K +L AH KTH   ++F C  C+ C   F +  SL  H+R+  +  +  + C HC+K ++T+    +H+
Sbjct:  470 WHICTYCNKEFKKPSDLVRHIRI-HTHEKPFKCLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKC---FSTSGSLKVHIRL--HTGVRPFACPHCDKKFRTSGHRKTHI 574          

HSP 12 Score: 66.6254 bits (161), Expect = 4.641e-10
Identity = 74/310 (23.87%), Postives = 111/310 (35.81%), Query Frame = 1
Query: 1795 QIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKL---RFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRH-GLVHS---NSKPYACPLCLRRFKAKIYCDRHIS 2703
            + Q    ++D     +  RC  C   +    +LT H   H    P  C  C K F   + LK H   H K +   C  C   F L   L +H + H  + +    + CK C + F++   L+ H  T     +AN                          + N N                      ID+   S    + C HCGK+++    L  H++ H +      C  C K+F    ++  H+  +H   +  +C  CPA F  K +L  H   VHS   N   Y C  C   FK+    + HIS
Sbjct:   43 ETQYQRHMRDHERNDKAHRCDQCPMSFNIDFNLTLHKATHNVDDP-TCPACRKKFSRVASLKAHIMLHEKEETLICSECGDEFTLPNNLSLHMEEHRQELVGSKTYSCKSCKKTFDSTPQLKEHMKTHFKIRVANTR------------------------SYNRN----------------------IDRSGFS----YSCPHCGKTFQKPSQLTRHIRIH-TGERPFKCNICGKAFNQKGALATHM-VKHTGEKPHACAFCPAAFSQKGNLQSHIQRVHSEVKNGATYHCTDCSCIFKSLGSLNTHIS 299          

HSP 13 Score: 63.1586 bits (152), Expect = 5.617e-9
Identity = 37/123 (30.08%), Postives = 64/123 (52.03%), Query Frame = 1
Query: 3520 QSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            Q+  E  P KF + C+ C   FK    L+ H++  H   + F C+ C K+F+ K +L +H KTH   + F C V   C+  F +  SL  H+R+  +     ++C HC+  ++T+    +H++
Sbjct: 1141 QAEMETEP-KFANCCSFCPKSFKKPSDLIRHIRI-HTGEKPFKCDECGKSFTVKSTLDSHVKTHAGQKLFSCHV---CSNSFSTKGSLKVHMRL--HTGAKPFKCPHCDMRFRTSGRRKTHIQ 1256          

HSP 14 Score: 61.6178 bits (148), Expect = 1.407e-8
Identity = 33/110 (30.00%), Postives = 59/110 (53.64%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            C  C+  FK S  L +H++S H   + + C +C + F +   L +H KTH   +++ C +C   N  F +  SL+RH  M  + ++  Y+C  C++ ++TT     H+K+
Sbjct:  955 CDYCNKGFKKSSHLKQHIRS-HTGEKPYKCTMCGRGFVSSGVLKSHEKTHTGVKAYSCTIC---NAAFTTNGSLTRH--MSTHISMKPYKCPFCDETFRTTVHCKKHMKK 1058          

HSP 15 Score: 61.2326 bits (147), Expect = 1.857e-8
Identity = 34/117 (29.06%), Postives = 57/117 (48.72%), Query Frame = 1
Query: 3550 FYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHND--NLNLYRCTHCNKVYKTTRELDSHVKQL 3894
            F + C +C   F+    L  H++  H   R F CN+C KAF+ K +L  H   H   +   C  C A    F    +L  H++  H++  N   Y CT C+ ++K+   L++H+ ++
Sbjct:  189 FSYSCPHCGKTFQKPSQLTRHIRI-HTGERPFKCNICGKAFNQKGALATHMVKHTGEKPHACAFCPAA---FSQKGNLQSHIQRVHSEVKNGATYHCTDCSCIFKSLGSLNTHISKM 301          

HSP 16 Score: 60.8474 bits (146), Expect = 2.515e-8
Identity = 29/76 (38.16%), Postives = 40/76 (52.63%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            C  C K FK P  L RH   HT  K F+C  C + F  KS++  H+  H  +K F C FC K F+   ++  HI++
Sbjct:  473 CTYCNKEFKKPSDLVRHIRIHTHEKPFKCLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKCFSTSGSLKVHIRL 548          

HSP 17 Score: 60.077 bits (144), Expect = 4.893e-8
Identity = 41/141 (29.08%), Postives = 63/141 (44.68%), Query Frame = 1
Query: 2314 NELLNQPIPIAEIDKRKLSN--NRL---FKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRK-------FSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            +EL  Q    A+I+K   ++   RL   F+CNHC   +     L EH KE       +VC  CNK+F     +++H++T      +       F C  C   F   + L RH  +H+  +P+ C LC + F  K     H+
Sbjct: 1609 SELSYQVTGDAQIEKNSQADKEGRLHQCFECNHC---FPSAAILAEHNKEAHGKERIHVCHLCNKAFKRASHLKEHMQTHQPGPSRSSQMPKLFKCDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHM 1746          

HSP 18 Score: 59.6918 bits (143), Expect = 5.413e-8
Identity = 58/243 (23.87%), Postives = 91/243 (37.45%), Query Frame = 1
Query: 2020 CEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPD-PXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNV---------------CQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C+IC   F  +   + H + HE +     C  C   FN  F+L  H +T    ++ +P  P+  +               + + T   +   D   L  N  L+      E  +++L  ++ + C  C K++     L EH+K H      N                C  C K+F     + +H+R  H   R F C  C   F  K +L  H + H+  KP+AC  C   F  K     HI
Sbjct:   33 CDICLLSFPKETQYQRHMRDHERNDKAHRCDQCPMSFNIDFNLTLHKAT---HNVDDPTCPACRKKFSRVASLKAHIMLHEKEETLICSECGDEFTLPNNLSLHM-----EEHRQELVGSKTYSCKSCKKTFDSTPQLKEHMKTHFKIRVANTRSYNRNIDRSGFSYSCPHCGKTFQKPSQLTRHIRI-HTGERPFKCNICGKAFNQKGALATHMVKHTGEKPHACAFCPAAFSQKGNLQSHI 266          

HSP 19 Score: 59.3066 bits (142), Expect = 6.626e-8
Identity = 34/115 (29.57%), Postives = 55/115 (47.83%), Query Frame = 1
Query: 1852 CRFCYKLYRKSCDLTRHIRIH------TQQKP--FQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            C  C K ++++  L  H++ H      + Q P  F+C  C K+F   S L+ H + H   + F C +C K FN K  L+VH + H  +K  + C  C   F    +++ H   +H
Sbjct: 1665 CHLCNKAFKRASHLKEHMQTHQPGPSRSSQMPKLFKCDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHMKKHTGEK-PYKCDYCSMTFTQKCNMKLHMKRTH 1778          

HSP 20 Score: 55.4546 bits (132), Expect = 9.892e-7
Identity = 36/117 (30.77%), Postives = 51/117 (43.59%), Query Frame = 1
Query: 3556 HGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFG-----CFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            H C  C+H F  +  L EH K  H   R   C++C+KAF     L  H +TH    S        F C  C++ F     L RH R+   +    ++CT C K +     L  H+K+
Sbjct: 1634 HQCFECNHCFPSAAILAEHNKEAHGKERIHVCHLCNKAFKRASHLKEHMQTHQPGPSRSSQMPKLFKCDTCDKAFAKPSQLERHSRIHTGE--RPFQCTLCEKAFNQKSALQVHMKK 1748          

HSP 21 Score: 55.0694 bits (131), Expect = 1.409e-6
Identity = 36/125 (28.80%), Postives = 61/125 (48.80%), Query Frame = 1
Query: 2359 RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA--KKCSKKK 2727
            R+ S  R   C +C K +K    L  H++ H +      C  C ++F    ++  H++T H   + F C  C   F T  SL  H  +H+  +P+ACP C ++F+   +   HI++  K+C  +K
Sbjct:  463 REESGIRWHICTYCNKEFKKPSDLVRHIRIH-THEKPFKCLQCFRAFAVKSTLTAHIKT-HSGIKAFKCDFCMKCFSTSGSLKVHIRLHTGVRPFACPHCDKKFRTSGHRKTHIASHFKQCELRK 585          
BLAST of Zinc finger, C2H2 type vs. Ensembl Xenopus
Match: ENSXETT00000016954.1 (Small ubiquitin-related modifier 3 [Source:UniProtKB/Swiss-Prot;Acc:Q6DK72])

HSP 1 Score: 152.14 bits (383), Expect = 2.220e-36
Identity = 190/782 (24.30%), Postives = 291/782 (37.21%), Query Frame = 1
Query:  427 TYNQNKYQYDNLDPTVYKTINGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIG----EEC-----DDRKL--------TTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDG------MPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQ--SPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQG--ILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRF--NTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAE--IDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAK 2679
            T+  N +   +L  T  +  +G    +C  C   F    + + H+ IH  ++ F C+ C  +Y  + NL  H               + E  + C  C   F+++   + H  IH  ++   C  C   F  K  L +H   HK       EC     D  KL             KCK+C   F   G++ K + R H     +   E G      + +K  ER+ T                 C        G+S   ++    +  I    RP             C  CGK F     L+ HE  HTG K F C  C K FT+K +++IH  +H   K F C  CGK F  +  ++ H ++  + G    ++  +     S        K  +  KK  + AE  +  S     +I Q +     T E  F+     +  T        N       K H G       +  +   E G +++HE I    +G + F C  C K +  +  L +H +IHT +KPF C  C K F  K  L+ H + H  +K F+C  C K F  K  L++H ++H   K  F C  C + F   +  H+       H R      P                   K     +      VKP    E   +    +   I K + +  + F C  CGKS+  K+ L  H + H +      C  C KSF+   ++ +H +  H   + F+C +C   F  K  L  H   H+  KP+ C  C + F  K
Sbjct:  187 TFTVNSHLLAHLCGTQRRNYSGEKLYSCTECGKRFSLLPSLVTHLRIHAGEKPFTCTECGKTYTKQSNLRSH-----------QKTHSGEKPFTCTECGKSFAKQANLRKHQKIHTGEKPFTCTKCGKKFSEKRKLRRHETTHKYKPYACSECGKSFSDMEKLCRHQAIHTGEKAFKCKVCEKGFSRKGDL-KIHERIHTGERPYTCTECGKGFSRKIHLKFHERIHT-----------GERPYTCTEC-----GKSFSRKIHLKFHERIHTGERPYT-----------CTECGKGFSRKSNLKIHERIHTGEKPFTCTECGKRFTEKGTLRIHERIHTGEKPFTCTECGKGFPIKKQLHMHERIHTRKGPFTCTECGKSFFAMS---MFHIHKKIHSRKKPFTCAECGKCFSRKTGLQIHQKIH----TGEKPFTCTECRKCFTT-------NCSLQKHQKIHTGEKPFTCTECGKCFTEKGSLRIHERIH---SGEKPFTCTECGKCFITNRSLQKHQKIHTGEKPFTCTECGKCFTEKGSLRIHERIHTGVKPFTCTECGKCFIGKSNLRIHERIHTGVKP-FTCTECGKCFPEKSSLHI-------HERIHTGVKPFTCTECGKSFSH-------KGSLRLHGKIHTGVKPFTCKECGKKFTLKSSLCIHKMRHTGEKPFACTECGKSFTEKRTLLIHERIH-TGEKPCTCTKCGKSFIEKSTLNRHQKI-HTGEKPFTCTECEKCFSRKRGLQIHQKTHTGEKPFTCTECGKCFSDK 895          

HSP 2 Score: 137.502 bits (345), Expect = 7.591e-32
Identity = 128/501 (25.55%), Postives = 202/501 (40.32%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGI-------LLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAE---IDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            C  CGK F   I L+ HE  HTG + + C  C K F++K  +K H  +H   + + C  CGK F+ + N+  H ++           + E     +   +   +K   R   I     T + P    E  +    +    + H   + + +    +     ++F  +     H+ I         +E  +   ++TG +Q+H+ I    TG + F C  C K +  +C L +H +IHT +KPF C  C K F  K  L+ H + H   K F+C  C K F   ++L+ H+++H  +K  F C  C + F     LR      H R      P                   +   T        VKP    E   +  P      I +R  +  + F C  CGKS+  K  L  H K H +      C+ C K F    S+  H + +H   + F+C +C   F  K +L+ H  +H+  KP  C  C + F  K   +RH
Sbjct:  381 CTECGKGFSRKIHLKFHERIHTGERPYTCTECGKSFSRKIHLKFHERIHTGERPYTCTECGKGFSRKSNLKIHERI----------HTGEKPFTCTECGKRFTEKGTLR---IHERIHTGEKPFTCTECGKGFPIKK---QLHMHERIHTRKGPFTCTECGKSFFAMSMFHIHKKIHSRKKPFTCAECGKCFSRKTG-LQIHQKIH---TGEKPFTCTECRKCFTTNCSLQKHQKIHTGEKPFTCTECGKCFTEKGSLRIHERIHSGEKPFTCTECGKCFITNRSLQKHQKIHTGEKP-FTCTECGKCFTEKGSLRI-----HERIHTGVKPFTCTECGKCFIGKSNLRIHERIHTG-------VKPFTCTE-CGKCFPEKSSLHIHERIHTGVKPFTCTECGKSFSHKGSLRLHGKIH-TGVKPFTCKECGKKFTLKSSLCIH-KMRHTGEKPFACTECGKSFTEKRTLLIHERIHTGEKPCTCTKCGKSFIEKSTLNRH 845          

HSP 3 Score: 121.324 bits (303), Expect = 7.748e-27
Identity = 120/504 (23.81%), Postives = 187/504 (37.10%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNEN---HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLN--QPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAK----IYCDRHISAK 2709
            C VC K F     L+ HE  HTG + + C  C KGF++K  +K H  +H   + + C  CGK+F+ + ++  H ++         ++  +    +SN              KI     T + P    E  +    +     +   H   +P   +      P  +     +   + +G     +  +         +H+ I  +    + F C  C K + +   L  H +IHT +KPF C  C K F     L+ H K H   K F+C  C K F  K +L++H ++H  +K  F C  C + F T   L+       H+ I   +                                  KP    E            I +R  +  + F C  CGK +  K  L  H + H        C  C K F    S+  H R  H   + F+C +C   F  K SL  HG +H+  KP+ C  C ++F  K    I+  RH   K
Sbjct:  353 CKVCEKGFSRKGDLKIHERIHTGERPYTCTECGKGFSRKIHLKFHERIHTGERPYTCTECGKSFSRKIHLKFHERIHTGERPYTCTECGKGFSRKSNL-------------KIHERIHTGEKPFTCTECGKRFTEKGTLRIHERIHTGEKPFTCTECGKGFPIKKQLHMHERIHTRKGPFTCTECGKSFFAMSMFHIHKKIHSRK---KPFTCAECGKCFSRKTGLQIHQKIHTGEKPFTCTECRKCFTTNCSLQKHQKIHTGEKPFTCTECGKCFTEKGSLRIHERIHSGEKP-FTCTECGKCFITNRSLQK------HQKIHTGE----------------------------------KPFTCTECGKCFTEKGSLRIHERIHTGVKPFTCTECGKCFIGKSNLRIHERIHTGVKP-FTCTECGKCFPEKSSLHIHERI-HTGVKPFTCTECGKSFSHKGSLRLHGKIHTGVKPFTCKECGKKFTLKSSLCIHKMRHTGEK 797          

HSP 4 Score: 108.997 bits (271), Expect = 4.552e-23
Identity = 96/320 (30.00%), Postives = 141/320 (44.06%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTN---ENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGI---LLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            C  CGK+F     LR H   HTG+K F C  C K FT KSS+ IH + H   K F C  CGK+FT +  +  H ++         ++  +  + +S           NR +KI     T + P    E  +    +       + H   +P   +       S +  ++L  ++ H G+     SE  ++   ++  + +HE ++   TG + F C  C K +     L  H RIHT  KP  C  C KSF  KS L  H K H   K F+C  C K F +K+TL +H ++H  +K  F C  C + F     LR H  T
Sbjct:  745 CTECGKSFSHKGSLRLHGKIHTGVKPFTCKECGKKFTLKSSLCIHKMRHTGEKPFACTECGKSFTEKRTLLIHERIHTGEKPCTCTKCGKSFIEKSTL---------NRHQKI----HTGEKPFTCTECEKCFSRKRGLQIHQKTHTGEKPFTCTECGKCF-SDKGSLRL-HERIHTGVKPFTCSECGKKFTLKS-SLCIHEKMRH--TGEKPFACTECGKSFTVKRTLLIHERIHTGVKPCTCTECGKSFTEKSTLNRHQKIHIGEKPFTCTDCGKSFTVKRTLLIHERIHTGEKP-FTCTDCGKSFTVKHDLRRHEKT 1045          

HSP 5 Score: 104.375 bits (259), Expect = 1.018e-21
Identity = 84/294 (28.57%), Postives = 119/294 (40.48%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNE-----LLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            TG + F C  C K + +   L  H RIHT +KP  C  C KSF  KS L  H K H   K F+C  C K F+ K+ L++H++ H  +K  F C  C + F+    LR H                                              VKP   +E      L   + I E  K + +  + F C  CGKS+  K+ L  H + H        C  C KSF    ++ +H +  H+  + F+C  C   F  K +L+ H  +H+  KP+ C  C + F  K    RH
Sbjct:  794 TGEKPFACTECGKSFTEKRTLLIHERIHTGEKPCTCTKCGKSFIEKSTLNRHQKIHTGEKPFTCTECEKCFSRKRGLQIHQKTHTGEKP-FTCTECGKCFSDKGSLRLHERIH----------------------------------------TGVKPFTCSECGKKFTLKSSLCIHE--KMRHTGEKPFACTECGKSFTVKRTLLIHERIHTGVKPC-TCTECGKSFTEKSTLNRHQKI-HIGEKPFTCTDCGKSFTVKRTLLIHERIHTGEKPFTCTDCGKSFTVKHDLRRH 1042          

HSP 6 Score: 102.064 bits (253), Expect = 5.421e-21
Identity = 108/448 (24.11%), Postives = 175/448 (39.06%), Query Frame = 1
Query: 1384 GFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHF-SYQPNHQSNTD-SYIPSAENFIKLDWDKSHQGILLSEDVERIDK------ETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQ--PIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            GF+C  CG+ FT    +N+H+ + H  GT+  + S E L + +            RF  + SL    +  + +   T     +  T +++  S+Q  H      +     ++F K    + HQ I   E      K      E  +++ HE        ++ + C  C K +     L RH  IHT +K F+C +C K F  K  LK H + H   + ++C  C K F+ K  LK H ++H  ++  + C  C + F+   HL++     H R      P                +  +   T         KP    E   +        I +R  +  + F C  CGK +  KK L+ H + H +      C  C KSF        H +  H  ++ F+C +C   F  K  L  H  +H+  KP+ C  C + F       +H
Sbjct:  178 GFICYKCGETFT----VNSHL-LAHLCGTQRRNYSGEKLYSCTECG--------KRFSLLPSLVTHLRIHAGEKPFTCTECGKTYTKQSNLRSHQKTHSGEKPFTCTECGKSFAKQANLRKHQKIHTGEKPFTCTKCGKKFSEKRKLRRHETTHK----YKPYACSECGKSFSDMEKLCRHQAIHTGEKAFKCKVCEKGFSRKGDLKIHERIHTGERPYTCTECGKGFSRKIHLKFHERIHTGERP-YTCTECGKSFSRKIHLKF-----HERIHTGERPYTCTECGKGFSRKSNLKIHERIHTGE-------KPFTCTECGKRFTEKGTLRIHERIHTGEKPFTCTECGKGFPIKKQLHMHERIH-TRKGPFTCTECGKSFFAMSMFHIHKKI-HSRKKPFTCAECGKCFSRKTGLQIHQKIHTGEKPFTCTECRKCFTTNCSLQKH 593          

HSP 7 Score: 97.8265 bits (242), Expect = 1.074e-19
Identity = 83/284 (29.23%), Postives = 113/284 (39.79%), Query Frame = 1
Query: 1798 IQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYAC 2649
            + +HE I    TG +   C  C K + +   L RH +IHT +KPF C  C K F  K  L+ H K+H   K F+C  C K F+ K +L++H ++H   K  F C  C ++F     L  H    H                              KP A +         +   LL        I +R  +  +   C  CGKS+  K  LN H K H+       C  C KSF   R++  H R  H   + F+C  C   F  K  L RH   H+  KP  C
Sbjct:  814 LLIHERIH---TGEKPCTCTKCGKSFIEKSTLNRHQKIHTGEKPFTCTECEKCFSRKRGLQIHQKTHTGEKPFTCTECGKCFSDKGSLRLHERIHTGVKP-FTCSECGKKFTLKSSLCIHEKMRH---------------------------TGEKPFACTECGKSF--TVKRTLL--------IHERIHTGVKPCTCTECGKSFTEKSTLNRHQKIHI-GEKPFTCTDCGKSFTVKRTLLIHERI-HTGEKPFTCTDCGKSFTVKHDLRRHEKTHTGEKPLTC 1054          

HSP 8 Score: 65.0846 bits (157), Expect = 1.258e-9
Identity = 34/124 (27.42%), Postives = 59/124 (47.58%), Query Frame = 1
Query: 2341 IAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKK 2712
            +    +R  S  +L+ C  CGK +     L  HL+ H +      C  C K++    +++ H +T H   + F+C +C   F  +A+L +H  +H+  KP+ C  C ++F  K    RH +  K
Sbjct:  198 LCGTQRRNYSGEKLYSCTECGKRFSLLPSLVTHLRIH-AGEKPFTCTECGKTYTKQSNLRSHQKT-HSGEKPFTCTECGKSFAKQANLRKHQKIHTGEKPFTCTKCGKKFSEKRKLRRHETTHK 319          

HSP 9 Score: 62.003 bits (149), Expect = 9.420e-9
Identity = 73/260 (28.08%), Postives = 105/260 (40.38%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLS----RHVDEKHAASSSCIEGLPEGRK-------PAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNR----C--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVH 4965
            P++C+ C K F   SNL+ H  +HT ++P+ C +C K F  + SL  HE   H+ V K   C  C K    + +LR H K+H       CK C K F L+  L     RH  EK  A + C +   E R          GE   T T       ++      + I    +K   C  C   F+ K     H       +K+H       C  C K F        H + +H  +  + C++C   F  +SS   H+K  H
Sbjct:  686 PFTCTECGKCFIGKSNLRIHERIHTGVKPFTCTECGKCFPEKSSLHIHERI-HTGV-KPFTCTECGKSFSHKGSLRLHGKIHTGVKPFTCKECGKKFTLKSSLCIHKMRHTGEKPFACTECGKSFTEKRTLLIHERIHTGEKPCTCTKCGKSFIEKSTLNRHQKI-HTGEKPFTCTECEKCFSRKRGLQIH-------QKTHTGEKPFTCTECGKCFSDKGSLRLH-ERIHTGVKPFTCSECGKKFTLKSSLCIHEKMRH 934          

HSP 10 Score: 60.8474 bits (146), Expect = 2.471e-8
Identity = 37/125 (29.60%), Postives = 58/125 (46.40%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLS----RHVDEKHAASSSCIEGL 4599
            P++C+ C K F + +NL++H  +HT  +P+ C KC K+F  +  L+ HE T H                  ++    H  +H  E +  CKVC KGF  + DL      H  E+    + C +G 
Sbjct:  267 PFTCTECGKSFAKQANLRKHQKIHTGEKPFTCTKCGKKFSEKRKLRRHETT-HKYKPYACSECGKSFSDMEKLC--RHQAIHTGEKAFKCKVCEKGFSRKGDLKIHERIHTGERPYTCTECGKGF 388          

HSP 11 Score: 56.9954 bits (136), Expect = 3.515e-7
Identity = 32/106 (30.19%), Postives = 48/106 (45.28%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH 4554
            PY+C+ C KGF+R SNL+ H  +HT  +P+ C +C KRF  + +L+ HE                              ++H  E    C  C KGF +++ L  H
Sbjct:  434 PYTCTECGKGFSRKSNLKIHERIHTGEKPFTCTECGKRFTEKGTLRIHE------------------------------RIHTGEKPFTCTECGKGFPIKKQLHMH 509          

HSP 12 Score: 53.5286 bits (127), Expect = 3.504e-6
Identity = 38/132 (28.79%), Postives = 48/132 (36.36%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGC-------------------------FVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSH 3882
            C  C   F +  +L  H K  H   + FTC  C K FS K  L  H KTH   + F C                         F C  C ++F    SL  H +M+H      + CT C K +   R L  H
Sbjct:  829 CTKCGKSFIEKSTLNRHQKI-HTGEKPFTCTECEKCFSRKRGLQIHQKTHTGEKPFTCTECGKCFSDKGSLRLHERIHTGVKPFTCSECGKKFTLKSSLCIHEKMRHTGE-KPFACTECGKSFTVKRTLLIH 958          

HSP 13 Score: 52.7582 bits (125), Expect = 6.495e-6
Identity = 31/107 (28.97%), Postives = 50/107 (46.73%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSH 3882
            C  C  +F    SLV H++  H   + FTC  C K ++ + +L +H KTH   +    F C  C + F    +L +H ++   +    + CT C K +   R+L  H
Sbjct:  214 CTECGKRFSLLPSLVTHLRI-HAGEKPFTCTECGKTYTKQSNLRSHQKTHSGEKP---FTCTECGKSFAKQANLRKHQKIHTGE--KPFTCTKCGKKFSEKRKLRRH 314          

HSP 14 Score: 52.373 bits (124), Expect = 8.880e-6
Identity = 32/109 (29.36%), Postives = 48/109 (44.04%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C  +F    SL  H K +H   + F C  C K+F+ K +L  H + H   +      C  C + FI   +L+RH ++   +    + CT C K +   R L  H K
Sbjct:  773 CKECGKKFTLKSSLCIH-KMRHTGEKPFACTECGKSFTEKRTLLIHERIHTGEKP---CTCTKCGKSFIEKSTLNRHQKIHTGE--KPFTCTECEKCFSRKRGLQIHQK 875          
BLAST of Zinc finger, C2H2 type vs. Ensembl Mouse
Match: Zfp236 (zinc finger protein 236 [Source:MGI Symbol;Acc:MGI:1926950])

HSP 1 Score: 218.009 bits (554), Expect = 2.158e-56
Identity = 156/536 (29.10%), Postives = 253/536 (47.20%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGT-----------------------EVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQS----PSDDAEITQYLWNENPTNENH-----FSYQPNHQSNTDSYIPSAENFIKLDWD--KSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDV---KPLIWNEL-LNQPIPIAEIDKRKLSN------NRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C  CGK F+ P  L RH   HTG + F+C  C K F QK +++ HM+ H   K   C FC  AF+ + N+ +H++ +H   T                       + +S   + LL  S     E Q+ P   ++++     NQ       +++ ++       P++ +H      S Q  H S+      SAE    +D +  K  +    ++  E+   +     L   I+++  G R   C +C K +RK  DL RHIRIHT +KPF+C  C ++F +KS L  H K+H  +K F C+ C K F+   +LKVH +LH   +  F C  CD++F T  H + H + SH +                 +  QQ + +K +   +S   PD+   +P++  +L L QPIP  +  +   +N      +R +KC +C ++YK   +L +H++ H +      C  C + FV+   ++ H+RT H   + F CL C   F T  SL RH  +H++ +PY CP C + FK  + C +H+
Sbjct:  201 CPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPHACAFCPAAFSQKGNLQSHVQRVHSEATIFQTLPLQQVEAQVSSVSSEQSSQAVSDVIQQLLELSEPGPVEAQQSPQSGRQLSVTVGINQDILQQALENSGLSSLPVAAPPSDCSHAQTATVSTQSPHASSV-----SAEQADPMDAEQEKGQESPEKTDKKEKKLLKKKSPFLPGSIREE-NGVRWHVCPYCTKEFRKPSDLVRHIRIHTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCMKSFSTSGSLKVHIRLHTGVR-PFACPHCDKKFRTSGHRKTHVA-SHFK------------HTELRKLRQQRKPVKGRVGKSSVPVPDIPLQEPILITDLGLIQPIPKNQFFQNYFNNSFGNEADRPYKCFYCHRAYKKSCHLKQHIRSH-TGEKPFKCSQCGRGFVSAGVLKAHVRT-HTGLKSFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHM 714          

HSP 2 Score: 110.538 bits (275), Expect = 1.626e-23
Identity = 94/361 (26.04%), Postives = 150/361 (41.55%), Query Frame = 1
Query: 1750 ILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNP-PDVKPLIWNELLN----QPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQ---------------------------HLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNR 2736
            +L     E +D +T   Q  E  +DQ    R +RC +C K ++KS  L +H+R HT +KP++C +C ++F    VLK+H K+H  +K FSC ICN  F    +L  H   H   K  + C  C+  F T  H R H     H+++++   +   +   E       E  +N   + S  P P+V      E       QP   A + ++ L  +         +  +  +  ++  +      + N C +C KSF     + +H+R                             H  ++ FSC  C   F TK SL  H  +H+ +KP+ CP C  RF+       H+     S  K+ R
Sbjct:  892 LLPESSQEDLDLQTQGPQFLEDSEDQ--SRRSYRCDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRAFVSSGVLKSHEKTHTGVKAFSCSICNASFTTNGSLTRHMATHMSMK-PYKCPFCEEGFRTAVHCRKHM--KRHQAVSS---AAAAAAETEGGDTCVEEDEENSDRSASRKPRPEVITFTEEETAQLAKIQPQESATVSEKVLVQS-------AAEKDRISEMKDKQAELEAEPKHANCCTYCPKSFKKPSDLVRHVRIHTGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCELRFRTSGRRKTHMQFHYKSDPKKAR 1237          

HSP 3 Score: 99.7525 bits (247), Expect = 3.038e-20
Identity = 77/308 (25.00%), Postives = 128/308 (41.56%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIK-----------VIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAE--NFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH---EPDKLR 2100
            C +CG+AF +  +L+ HE THTG+K F C IC   FT   S+  HM  H ++K + C FC + F    +   H+K                G +   +  E   + S   +   +      ++ A LA+    P + A +++ +  ++   ++  S   + Q+  ++    A    +    + K         D+ R       +++H       TG + ++C  C K +     L  H++ HT QK F C++C  +F  K  LK H + H   K F C  C   F      K H Q H   +P K R
Sbjct:  952 CKLCGRAFVSSGVLKSHEKTHTGVKAFSCSICNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTAVHCRKHMKRHQAVSSAAAAAAETEGGDTCVEEDEENSDRSASRKPRPEVITFTEEETAQLAKIQ--PQESATVSEKVLVQSAAEKDRISEMKDKQAELEAEPKHANCCTYCPKSFKK-------PSDLVR------HVRIH-------TGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCELRFRTSGRRKTHMQFHYKSDPKKAR 1237          

HSP 4 Score: 71.633 bits (174), Expect = 9.622e-12
Identity = 51/162 (31.48%), Postives = 79/162 (48.77%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHE-NDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHY-VRCHPKTSG 987
            CEIC + FP +  + +HM  HE ND+  +C  C  ++N E NL +H       +CT     N E +  C +C+  FSR  + +AH ++H+ +E L C  C   F     L  H+ +H+  +E  + +  T    CK C   FE    +K+H    C  + SG
Sbjct:   41 CEICLLSFPKESQFQRHMREHEQNDKPHRCDQCPQTFNVEFNLTLH-------KCT----HNAE-DPVCPVCNKKFSRVASLKAHIMLHEKEENLICSECGDEFTLHSQLAIHMEEHR--QELANTRAHT----CKACKKEFETSPELKEHMKTHCKVRASG 184          

HSP 5 Score: 71.633 bits (174), Expect = 1.065e-11
Identity = 32/90 (35.56%), Postives = 51/90 (56.67%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQE 1494
            C+ CG+ F +  +L+ H  THTG+K F+C IC   FT   S++ HM +H++++ ++C +C K F    N   H+K       + L Q QE
Sbjct:  641 CSQCGRGFVSAGVLKAHVRTHTGLKSFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHRYELAQQLQQHQE 730          

HSP 6 Score: 70.4774 bits (171), Expect = 2.216e-11
Identity = 31/78 (39.74%), Postives = 43/78 (55.13%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH 1458
            C  C KAF  P  L RH   HTG + F C +C K F QKS++++H+  H   + + C +C   FT + NM  H+K  H
Sbjct: 1679 CDSCEKAFAKPSQLERHSRIHTGERPFHCTLCDKAFNQKSALQVHLKKHTGERPYRCDYCVMGFTQKSNMKLHMKRAH 1756          

HSP 7 Score: 70.0922 bits (170), Expect = 3.078e-11
Identity = 31/77 (40.26%), Postives = 43/77 (55.84%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVH 2070
            R F+C  C K + K   L RH RIHT ++PF C +C K+F  KS L+ H K H   + + C+ C   F  K  +K+H
Sbjct: 1675 RVFKCDSCEKAFAKPSQLERHSRIHTGERPFHCTLCDKAFNQKSALQVHLKKHTGERPYRCDYCVMGFTQKSNMKLH 1751          

HSP 8 Score: 68.5514 bits (166), Expect = 9.844e-11
Identity = 62/256 (24.22%), Postives = 107/256 (41.80%), Query Frame = 1
Query: 1849 RCRFCYKLYRKSCDLTRHIRIHTQ-QKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRH 2613
            +C  C   + K     RH+R H Q  KP +C  C ++F ++  L  H  +H   ++  C +CNK F+   +LK H  LHE ++   +C  C   F     L  H    H + +AN             ++       K   T+     P++K  +      +       ++    ++  + C HCGK+++    L  H++ H +      C  C K+F    ++Q H+  +H   +  +C  CPA F  K +L  H
Sbjct:   40 KCEICLLSFPKESQFQRHMREHEQNDKPHRCDQCPQTFNVEFNLTLHKCTH-NAEDPVCPVCNKKFSRVASLKAHIMLHEKEE-NLICSECGDEFTLHSQLAIHME-EHRQELAN------------TRAHTCKACKKEFETS-----PELKEHMKTHCKVRASGTRSYNRNIDRSSFPYSCPHCGKTFQKPSQLTRHIRIH-TGERPFKCSECGKAFNQKGALQTHM-IKHTGEKPHACAFCPAAFSQKGNLQSH 273          

HSP 9 Score: 68.1662 bits (165), Expect = 1.080e-10
Identity = 31/77 (40.26%), Postives = 42/77 (54.55%), Query Frame = 1
Query: 1846 FRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQ 2076
            + C  C K ++K   LTRHIRIHT ++PF+C  C K+F  K  L+ H   H   K  +C  C   F+ K  L+ H Q
Sbjct:  199 YSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPHACAFCPAAFSQKGNLQSHVQ 275          

HSP 10 Score: 65.4698 bits (158), Expect = 7.188e-10
Identity = 35/111 (31.53%), Postives = 59/111 (53.15%), Query Frame = 1
Query: 3553 YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            +H C  C  +F+    LV H++  H   + F C  C +AF+ K +L AH KTH   ++F C  C+   + F +  SL  H+R+  +  +  + C HC+K ++T+    +HV
Sbjct:  435 WHVCPYCTKEFRKPSDLVRHIRI-HTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCM---KSFSTSGSLKVHIRL--HTGVRPFACPHCDKKFRTSGHRKTHV 539          

HSP 11 Score: 64.6994 bits (156), Expect = 1.152e-9
Identity = 39/109 (35.78%), Postives = 57/109 (52.29%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C   +K S  L +H++S H   + F C+ C + F +   L AH +TH   +SF C +   CN  F +  SL RH+ + HND L  Y C +C K +KT+     H+K
Sbjct:  613 CFYCHRAYKKSCHLKQHIRS-HTGEKPFKCSQCGRGFVSAGVLKAHVRTHTGLKSFKCLI---CNGAFTTGGSLRRHMGI-HND-LRPYMCPYCQKTFKTSLNCKKHMK 715          

HSP 12 Score: 62.7734 bits (151), Expect = 4.743e-9
Identity = 38/125 (30.40%), Postives = 61/125 (48.80%), Query Frame = 1
Query: 1825 QVTGFRRFR-CRFCYKLYRKSCDLTRHIRIH------TQQKP--FQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            +V G  R   CR C K ++++  L  H+  H      + QKP  F+C  C K+F   S L+ H + H   + F C +C+K FN K  L+VH + H  ++  + C  C   F    +++ H   +H
Sbjct: 1633 EVHGKERIHGCRVCRKAFKRATHLKEHMLTHQAGPSLSSQKPRVFKCDSCEKAFAKPSQLERHSRIHTGERPFHCTLCDKAFNQKSALQVHLKKHTGER-PYRCDYCVMGFTQKSNMKLHMKRAH 1756          

HSP 13 Score: 62.003 bits (149), Expect = 7.862e-9
Identity = 38/133 (28.57%), Postives = 56/133 (42.11%), Query Frame = 1
Query: 2347 EIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSAN-------NTNV--------CQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            E  +++L+N R   C  C K ++    L EH+K H           N N+        C  C K+F     + +H+R  H   R F C +C   F  K +L  H + H+  KP+AC  C   F  K     H+
Sbjct:  143 EEHRQELANTRAHTCKACKKEFETSPELKEHMKTHCKVRASGTRSYNRNIDRSSFPYSCPHCGKTFQKPSQLTRHIRI-HTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPHACAFCPAAFSQKGNLQSHV 274          

HSP 14 Score: 61.6178 bits (148), Expect = 1.065e-8
Identity = 35/110 (31.82%), Postives = 58/110 (52.73%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            C  C+  FK S  L +HV+S H   + + C +C +AF +   L +H KTH   ++F C +   CN  F +  SL+RH  M  + ++  Y+C  C + ++T      H+K+
Sbjct:  924 CDYCNKGFKKSSHLKQHVRS-HTGEKPYKCKLCGRAFVSSGVLKSHEKTHTGVKAFSCSI---CNASFTTNGSLTRH--MATHMSMKPYKCPFCEEGFRTAVHCRKHMKR 1027          

HSP 15 Score: 58.9214 bits (141), Expect = 7.388e-8
Identity = 72/257 (28.02%), Postives = 111/257 (43.19%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIP---EIPKKLIK-------CLSCSFIFNTKAKYD-----NHFCVGLKAEKSHLNRC--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            Y C  C+KGF ++S+L+QH+  HT  +PY+C  C + F     LK+HE T H+ V K   C +C     +  +L  H+  H+      C  C +GF       +H+ ++H A SS      E     G  +       +      +KP  EVI    E   +L K        +S   +  + A+ D           L+AE  H N C  C K+F+  S  + HV+ +H     Y C +C   F  +S+   H K+
Sbjct:  922 YRCDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRAFVSSGVLKSHEKT-HTGV-KAFSCSICNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTAVHCRKHM-KRHQAVSSAAAAAAETE---GGDTCVEEDEENSDRSASRKPRPEVITFTEEETAQLAKIQPQESATVSEKVLVQSAAEKDRISEMKDKQAELEAEPKHANCCTYCPKSFKKPSDLVRHVR-IHTGEKPYKCDECGKSFTVKSTLDCHVKT 1171          

HSP 16 Score: 58.5362 bits (140), Expect = 9.920e-8
Identity = 48/192 (25.00%), Postives = 75/192 (39.06%), Query Frame = 1
Query: 3331 SSLADKFPILKASLFSDDELTSNPKESNPFTNSSMVTNSNGSQFXXXXXXXXXXXXXXXXXXLQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTH-----IDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            +S   +FP    +L +D  L+      +P     ++  S+  Q    +   +    +   A L  H +       H C +CD  F  +  L+ H K  H   R   C VC KAF     L  H  TH     + S+    F C +C + F     L RH R+   +    + CT C+K +     L  H+K+
Sbjct: 1545 TSQGQQFP----ALLTDPSLSGQGGAGSP----QVILVSHTPQSSSAAGEEIAYQVTDVPAQLTPHSQPEKEGLSHQCLDCDRAFSSAAVLMHHSKEVHGKERIHGCRVCRKAFKRATHLKEHMLTHQAGPSLSSQKPRVFKCDSCEKAFAKPSQLERHSRIHTGE--RPFHCTLCDKAFNQKSALQVHLKK 1726          

HSP 17 Score: 57.3806 bits (137), Expect = 1.946e-7
Identity = 33/109 (30.28%), Postives = 54/109 (49.54%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C   FK    LV HV+  H   + + C+ C K+F+ K +L  H KTH   + F C V   C+  F +  SL  H+R+  +     ++C HC   ++T+    +H++
Sbjct: 1124 CTYCPKSFKKPSDLVRHVRI-HTGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHV---CSNAFSTKGSLKVHMRL--HTGAKPFKCPHCELRFRTSGRRKTHMQ 1226          

HSP 18 Score: 56.6102 bits (135), Expect = 3.785e-7
Identity = 25/74 (33.78%), Postives = 37/74 (50.00%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHI 1446
            C  C K FK    L++H  +HTG K ++C +C + F     +K H   H  VK F C  C  +FT   ++  H+
Sbjct:  924 CDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRAFVSSGVLKSHEKTHTGVKAFSCSICNASFTTNGSLTRHM 997          

HSP 19 Score: 55.8398 bits (133), Expect = 6.599e-7
Identity = 23/50 (46.00%), Postives = 33/50 (66.00%), Query Frame = 1
Query: 4231 SFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTH 4380
            SFPYSC  C K F + S L +H+ +HT  RP++C +C K F  + +L+TH
Sbjct:  196 SFPYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTH 245          

HSP 20 Score: 55.8398 bits (133), Expect = 7.301e-7
Identity = 34/142 (23.94%), Postives = 66/142 (46.48%), Query Frame = 1
Query: 2359 RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLMTGIINRNPI 2784
            R+ +  R   C +C K ++    L  H++ H +      C  C ++F    ++  H++T H   + F C  C   F T  SL  H  +H+  +P+ACP C ++F+   +   H+++     + R   QQ   + G + ++ +
Sbjct:  428 REENGVRWHVCPYCTKEFRKPSDLVRHIRIH-THEKPFKCPQCFRAFAVKSTLTAHIKT-HTGIKAFKCQYCMKSFSTSGSLKVHIRLHTGVRPFACPHCDKKFRTSGHRKTHVASHFKHTELRKLRQQRKPVKGRVGKSSV 567          

HSP 21 Score: 55.0694 bits (131), Expect = 9.886e-7
Identity = 37/143 (25.87%), Postives = 59/143 (41.26%), Query Frame = 1
Query: 1795 QIQLH-EMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQK----------------PFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            Q+ +H E  + ++   R   C+ C K +  S +L  H++ H + +                P+ C  C K+F+  S L  H + H   + F C  C K FN K  L+ H   H  +K    C  C   F+   +L+ H    H
Sbjct:  137 QLAIHMEEHRQELANTRAHTCKACKKEFETSPELKEHMKTHCKVRASGTRSYNRNIDRSSFPYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEK-PHACAFCPAAFSQKGNLQSHVQRVH 278          

HSP 22 Score: 54.299 bits (129), Expect = 1.859e-6
Identity = 35/115 (30.43%), Postives = 51/115 (44.35%), Query Frame = 1
Query: 2377 RLFKCNHCGKSYKFKKYLNEHLKEH-----LSANNTNV--CQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            R+  C  C K++K   +L EH+  H     LS+    V  C  C K+F     +++H R  H   R F C  C   F  K++L  H   H+  +PY C  C+  F  K     H+
Sbjct: 1639 RIHGCRVCRKAFKRATHLKEHMLTHQAGPSLSSQKPRVFKCDSCEKAFAKPSQLERHSRI-HTGERPFHCTLCDKAFNQKSALQVHLKKHTGERPYRCDYCVMGFTQKSNMKLHM 1752          

HSP 23 Score: 53.5286 bits (127), Expect = 2.979e-6
Identity = 31/122 (25.41%), Postives = 54/122 (44.26%), Query Frame = 1
Query: 2389 CNHCGKSYKFKKYLNEHLKEH---LSANNTNVCQFCNKSFVTYRSMQQHLRT-------------QHLNRRKF--SCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C+ CG  +     L  H++EH   L+    + C+ C K F T   +++H++T             ++++R  F  SC  C   F   + L RH  +H+  +P+ C  C + F  K     H+
Sbjct:  125 CSECGDEFTLHSQLAIHMEEHRQELANTRAHTCKACKKEFETSPELKEHMKTHCKVRASGTRSYNRNIDRSSFPYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHM 246          
BLAST of Zinc finger, C2H2 type vs. Ensembl Mouse
Match: Zfp236 (zinc finger protein 236 [Source:MGI Symbol;Acc:MGI:1926950])

HSP 1 Score: 169.088 bits (427), Expect = 2.344e-41
Identity = 101/299 (33.78%), Postives = 157/299 (52.51%), Query Frame = 1
Query: 1834 GFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDV---KPLIWNEL-LNQPIPIAEIDKRKLSN------NRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            G R   C +C K +RK  DL RHIRIHT +KPF+C  C ++F +KS L  H K+H  +K F C+ C K F+   +LKVH +LH   +  F C  CD++F T  H + H + SH +                 +  QQ + +K +   +S   PD+   +P++  +L L QPIP  +  +   +N      +R +KC +C ++YK   +L +H++ H +      C  C + FV+   ++ H+RT H   + F CL C   F T  SL RH  +H++ +PY CP C + FK  + C +H+
Sbjct:  480 GVRWHVCPYCTKEFRKPSDLVRHIRIHTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCMKSFSTSGSLKVHIRLHTGVR-PFACPHCDKKFRTSGHRKTHVA-SHFK------------HTELRKLRQQRKPVKGRVGKSSVPVPDIPLQEPILITDLGLIQPIPKNQFFQNYFNNSFGNEADRPYKCFYCHRAYKKSCHLKQHIRSH-TGEKPFKCSQCGRGFVSAGVLKAHVRT-HTGLKSFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHM 762          

HSP 2 Score: 110.538 bits (275), Expect = 1.521e-23
Identity = 95/361 (26.32%), Postives = 150/361 (41.55%), Query Frame = 1
Query: 1750 ILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNP-PDVKPLIWNELLN----QPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQ---------------------------HLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNR 2736
            +L     E +D +T   Q  E  +DQ    R +RC +C K ++KS  L +H+R HT +KP++C +C ++F    VLK+H K+H  +K FSC ICN  F    +L  H   H   K  + C  C+  F T  H R H     H+++++   +   +   E       E  +N   + S  P P+V      E       QP   A + ++ L  +   K        +  +  ++  +      + N C +C KSF     + +H+R                             H  ++ FSC  C   F TK SL  H  +H+ +KP+ CP C  RF+       H+     S  K+ R
Sbjct:  940 LLPESSQEDLDLQTQGPQFLEDSEDQ--SRRSYRCDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRAFVSSGVLKSHEKTHTGVKAFSCSICNASFTTNGSLTRHMATHMSMK-PYKCPFCEEGFRTAVHCRKHM--KRHQAVSS---AAAAAAETEGGDTCVEEDEENSDRSASRKPRPEVITFTEEETAQLAKIQPQESATVSEKVLVQSAAEK-------DRISEMKDKQAELEAEPKHANCCTYCPKSFKKPSDLVRHVRIHTGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCELRFRTSGRRKTHMQFHYKSDPKKAR 1285          

HSP 3 Score: 99.7525 bits (247), Expect = 2.654e-20
Identity = 77/308 (25.00%), Postives = 128/308 (41.56%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIK-----------VIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAE--NFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH---EPDKLR 2100
            C +CG+AF +  +L+ HE THTG+K F C IC   FT   S+  HM  H ++K + C FC + F    +   H+K                G +   +  E   + S   +   +      ++ A LA+    P + A +++ +  ++   ++  S   + Q+  ++    A    +    + K         D+ R       +++H       TG + ++C  C K +     L  H++ HT QK F C++C  +F  K  LK H + H   K F C  C   F      K H Q H   +P K R
Sbjct: 1000 CKLCGRAFVSSGVLKSHEKTHTGVKAFSCSICNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTAVHCRKHMKRHQAVSSAAAAAAETEGGDTCVEEDEENSDRSASRKPRPEVITFTEEETAQLAKIQ--PQESATVSEKVLVQSAAEKDRISEMKDKQAELEAEPKHANCCTYCPKSFKK-------PSDLVR------HVRIH-------TGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCELRFRTSGRRKTHMQFHYKSDPKKAR 1285          

HSP 4 Score: 88.5817 bits (218), Expect = 6.804e-17
Identity = 78/287 (27.18%), Postives = 121/287 (42.16%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIF----NLKQTLKVHR 2073
            C  C +AF     L  H  THTGIK F+C  C K F+   S+K+H+ +H  V+ F C  C K F    +  TH+   H   TE+    Q              Q+ P + +   S       P  +  +   L    P  +N F +Q N+ +N  S+   A+   K  +              R  K++  ++ H  I+    G + F+C  C + +  +  L  H+R HT  K F+C +C+ +F     L+ H   H  L+ + C  C K F    N K+ +K HR
Sbjct:  514 CPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCMKSFSTSGSLKVHIRLHTGVRPFACPHCDKKFRTSGHRKTHV-ASHFKHTELRKLRQ--------------QRKPVKGRVGKSSVPVPDIPLQEPILITDLGLIQPIPKNQF-FQ-NYFNN--SFGNEADRPYKCFY------------CHRAYKKSCHLKQH--IRSHT-GEKPFKCSQCGRGFVSAGVLKAHVRTHTGLKSFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHR 766          

HSP 5 Score: 73.9442 bits (180), Expect = 2.070e-12
Identity = 74/290 (25.52%), Postives = 121/290 (41.72%), Query Frame = 1
Query: 1849 RCRFCYKLYRKSCDLTRHIRIHTQ-QKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRH-GLVHS---NSKPYACPLCLRRFKAKIYCDRHIS 2703
            +C  C   + K     RH+R H Q  KP +C  C ++F ++  L  H  +H   ++  C +CNK F+   +LK H  LHE ++   +C  C   F     L  H    H + +AN             ++       K   T+     P++K  +      +       ++    ++  + C HCGK+++    L  H++ H +      C  C K+F    ++Q H+  +H   +  +C  CPA F  K +L  H   VHS   N   Y C  C   FK+    + HIS
Sbjct:   40 KCEICLLSFPKESQFQRHMREHEQNDKPHRCDQCPQTFNVEFNLTLHKCTH-NAEDPVCPVCNKKFSRVASLKAHIMLHEKEE-NLICSECGDEFTLHSQLAIHME-EHRQELAN------------TRAHTCKACKKEFETS-----PELKEHMKTHCKVRASGTRSYNRNIDRSSFPYSCPHCGKTFQKPSQLTRHIRIH-TGERPFKCSECGKAFNQKGALQTHM-IKHTGEKPHACAFCPAAFSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHIS 307          

HSP 6 Score: 73.559 bits (179), Expect = 2.665e-12
Identity = 34/84 (40.48%), Postives = 48/84 (57.14%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH---KNG 1467
            C  CGK F+ P  L RH   HTG + F+C  C K F QK +++ HM+ H   K   C FC  AF+ + N+ +H++ +H   KNG
Sbjct:  201 CPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPHACAFCPAAFSQKGNLQSHVQRVHSEVKNG 284          

HSP 7 Score: 71.633 bits (174), Expect = 1.098e-11
Identity = 32/90 (35.56%), Postives = 51/90 (56.67%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQE 1494
            C+ CG+ F +  +L+ H  THTG+K F+C IC   FT   S++ HM +H++++ ++C +C K F    N   H+K       + L Q QE
Sbjct:  689 CSQCGRGFVSAGVLKAHVRTHTGLKSFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHRYELAQQLQQHQE 778          

HSP 8 Score: 71.633 bits (174), Expect = 1.116e-11
Identity = 51/162 (31.48%), Postives = 79/162 (48.77%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHE-NDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHY-VRCHPKTSG 987
            CEIC + FP +  + +HM  HE ND+  +C  C  ++N E NL +H       +CT     N E +  C +C+  FSR  + +AH ++H+ +E L C  C   F     L  H+ +H+  +E  + +  T    CK C   FE    +K+H    C  + SG
Sbjct:   41 CEICLLSFPKESQFQRHMREHEQNDKPHRCDQCPQTFNVEFNLTLH-------KCT----HNAE-DPVCPVCNKKFSRVASLKAHIMLHEKEENLICSECGDEFTLHSQLAIHMEEHR--QELANTRAHT----CKACKKEFETSPELKEHMKTHCKVRASG 184          

HSP 9 Score: 70.4774 bits (171), Expect = 2.485e-11
Identity = 31/78 (39.74%), Postives = 43/78 (55.13%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH 1458
            C  C KAF  P  L RH   HTG + F C +C K F QKS++++H+  H   + + C +C   FT + NM  H+K  H
Sbjct: 1727 CDSCEKAFAKPSQLERHSRIHTGERPFHCTLCDKAFNQKSALQVHLKKHTGERPYRCDYCVMGFTQKSNMKLHMKRAH 1804          

HSP 10 Score: 70.0922 bits (170), Expect = 2.796e-11
Identity = 31/77 (40.26%), Postives = 43/77 (55.84%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVH 2070
            R F+C  C K + K   L RH RIHT ++PF C +C K+F  KS L+ H K H   + + C+ C   F  K  +K+H
Sbjct: 1723 RVFKCDSCEKAFAKPSQLERHSRIHTGERPFHCTLCDKAFNQKSALQVHLKKHTGERPYRCDYCVMGFTQKSNMKLH 1799          

HSP 11 Score: 68.5514 bits (166), Expect = 9.325e-11
Identity = 40/112 (35.71%), Postives = 54/112 (48.21%), Query Frame = 1
Query: 1846 FRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQ-LHEPDK--LRFVCKICDRRFNTGFHLRYHYSTSH 2172
            + C  C K ++K   LTRHIRIHT ++PF+C  C K+F  K  L+ H   H   K  +C  C   F+ K  L+ H Q +H   K    + C  C   F +   L  H S  H
Sbjct:  199 YSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPHACAFCPAAFSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKMH 310          

HSP 12 Score: 65.4698 bits (158), Expect = 7.468e-10
Identity = 35/111 (31.53%), Postives = 59/111 (53.15%), Query Frame = 1
Query: 3553 YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            +H C  C  +F+    LV H++  H   + F C  C +AF+ K +L AH KTH   ++F C  C+   + F +  SL  H+R+  +  +  + C HC+K ++T+    +HV
Sbjct:  483 WHVCPYCTKEFRKPSDLVRHIRI-HTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCM---KSFSTSGSLKVHIRL--HTGVRPFACPHCDKKFRTSGHRKTHV 587          

HSP 13 Score: 65.4698 bits (158), Expect = 8.332e-10
Identity = 29/76 (38.16%), Postives = 43/76 (56.58%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            C  C K F+ P  L RH   HT  K F+CP C + F  KS++  H+  H  +K F CQ+C K+F+   ++  HI++
Sbjct:  486 CPYCTKEFRKPSDLVRHIRIHTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCMKSFSTSGSLKVHIRL 561          

HSP 14 Score: 64.6994 bits (156), Expect = 1.217e-9
Identity = 39/109 (35.78%), Postives = 57/109 (52.29%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C   +K S  L +H++S H   + F C+ C + F +   L AH +TH   +SF C +   CN  F +  SL RH+ + HND L  Y C +C K +KT+     H+K
Sbjct:  661 CFYCHRAYKKSCHLKQHIRS-HTGEKPFKCSQCGRGFVSAGVLKAHVRTHTGLKSFKCLI---CNGAFTTGGSLRRHMGI-HND-LRPYMCPYCQKTFKTSLNCKKHMK 763          

HSP 15 Score: 62.7734 bits (151), Expect = 4.416e-9
Identity = 38/125 (30.40%), Postives = 61/125 (48.80%), Query Frame = 1
Query: 1825 QVTGFRRFR-CRFCYKLYRKSCDLTRHIRIH------TQQKP--FQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            +V G  R   CR C K ++++  L  H+  H      + QKP  F+C  C K+F   S L+ H + H   + F C +C+K FN K  L+VH + H  ++  + C  C   F    +++ H   +H
Sbjct: 1681 EVHGKERIHGCRVCRKAFKRATHLKEHMLTHQAGPSLSSQKPRVFKCDSCEKAFAKPSQLERHSRIHTGERPFHCTLCDKAFNQKSALQVHLKKHTGER-PYRCDYCVMGFTQKSNMKLHMKRAH 1804          

HSP 16 Score: 61.6178 bits (148), Expect = 1.106e-8
Identity = 35/110 (31.82%), Postives = 58/110 (52.73%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            C  C+  FK S  L +HV+S H   + + C +C +AF +   L +H KTH   ++F C +   CN  F +  SL+RH  M  + ++  Y+C  C + ++T      H+K+
Sbjct:  972 CDYCNKGFKKSSHLKQHVRS-HTGEKPYKCKLCGRAFVSSGVLKSHEKTHTGVKAFSCSI---CNASFTTNGSLTRH--MATHMSMKPYKCPFCEEGFRTAVHCRKHMKR 1075          

HSP 17 Score: 58.9214 bits (141), Expect = 7.480e-8
Identity = 70/257 (27.24%), Postives = 110/257 (42.80%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVI----------PEIPKKLIKCLSCSFIFNTKAKYD-----NHFCVGLKAEKSHLNRC--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            Y C  C+KGF ++S+L+QH+  HT  +PY+C  C + F     LK+HE T H+ V K   C +C     +  +L  H+  H+      C  C +GF       +H+ ++H A SS      E     G  +       +      +KP  EVI           +I  +    +S   +  + A+ D           L+AE  H N C  C K+F+  S  + HV+ +H     Y C +C   F  +S+   H K+
Sbjct:  970 YRCDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRAFVSSGVLKSHEKT-HTGV-KAFSCSICNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTAVHCRKHM-KRHQAVSSAAAAAAETE---GGDTCVEEDEENSDRSASRKPRPEVITFTEEETAQLAKIQPQESATVSEKVLVQSAAEKDRISEMKDKQAELEAEPKHANCCTYCPKSFKKPSDLVRHVR-IHTGEKPYKCDECGKSFTVKSTLDCHVKT 1219          

HSP 18 Score: 58.9214 bits (141), Expect = 7.801e-8
Identity = 35/117 (29.91%), Postives = 56/117 (47.86%), Query Frame = 1
Query: 3550 FYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHND--NLNLYRCTHCNKVYKTTRELDSHVKQL 3894
            F + C +C   F+    L  H++  H   R F C+ C KAF+ K +L  H   H   +   C  C A    F    +L  HV+  H++  N   Y CT C+ V+K+   L++H+ ++
Sbjct:  197 FPYSCPHCGKTFQKPSQLTRHIRI-HTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPHACAFCPAA---FSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKM 309          

HSP 19 Score: 58.5362 bits (140), Expect = 9.876e-8
Identity = 48/192 (25.00%), Postives = 75/192 (39.06%), Query Frame = 1
Query: 3331 SSLADKFPILKASLFSDDELTSNPKESNPFTNSSMVTNSNGSQFXXXXXXXXXXXXXXXXXXLQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTH-----IDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            +S   +FP    +L +D  L+      +P     ++  S+  Q    +   +    +   A L  H +       H C +CD  F  +  L+ H K  H   R   C VC KAF     L  H  TH     + S+    F C +C + F     L RH R+   +    + CT C+K +     L  H+K+
Sbjct: 1593 TSQGQQFP----ALLTDPSLSGQGGAGSP----QVILVSHTPQSSSAAGEEIAYQVTDVPAQLTPHSQPEKEGLSHQCLDCDRAFSSAAVLMHHSKEVHGKERIHGCRVCRKAFKRATHLKEHMLTHQAGPSLSSQKPRVFKCDSCEKAFAKPSQLERHSRIHTGE--RPFHCTLCDKAFNQKSALQVHLKK 1774          

HSP 20 Score: 57.3806 bits (137), Expect = 2.072e-7
Identity = 33/109 (30.28%), Postives = 54/109 (49.54%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C   FK    LV HV+  H   + + C+ C K+F+ K +L  H KTH   + F C V   C+  F +  SL  H+R+  +     ++C HC   ++T+    +H++
Sbjct: 1172 CTYCPKSFKKPSDLVRHVRI-HTGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHV---CSNAFSTKGSLKVHMRL--HTGAKPFKCPHCELRFRTSGRRKTHMQ 1274          

HSP 21 Score: 56.6102 bits (135), Expect = 4.030e-7
Identity = 25/74 (33.78%), Postives = 37/74 (50.00%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHI 1446
            C  C K FK    L++H  +HTG K ++C +C + F     +K H   H  VK F C  C  +FT   ++  H+
Sbjct:  972 CDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRAFVSSGVLKSHEKTHTGVKAFSCSICNASFTTNGSLTRHM 1045          

HSP 22 Score: 55.8398 bits (133), Expect = 6.679e-7
Identity = 23/50 (46.00%), Postives = 33/50 (66.00%), Query Frame = 1
Query: 4231 SFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTH 4380
            SFPYSC  C K F + S L +H+ +HT  RP++C +C K F  + +L+TH
Sbjct:  196 SFPYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTH 245          

HSP 23 Score: 55.4546 bits (132), Expect = 7.971e-7
Identity = 34/142 (23.94%), Postives = 66/142 (46.48%), Query Frame = 1
Query: 2359 RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLMTGIINRNPI 2784
            R+ +  R   C +C K ++    L  H++ H +      C  C ++F    ++  H++T H   + F C  C   F T  SL  H  +H+  +P+ACP C ++F+   +   H+++     + R   QQ   + G + ++ +
Sbjct:  476 REENGVRWHVCPYCTKEFRKPSDLVRHIRIH-THEKPFKCPQCFRAFAVKSTLTAHIKT-HTGIKAFKCQYCMKSFSTSGSLKVHIRLHTGVRPFACPHCDKKFRTSGHRKTHVASHFKHTELRKLRQQRKPVKGRVGKSSV 615          

HSP 24 Score: 55.4546 bits (132), Expect = 9.044e-7
Identity = 37/143 (25.87%), Postives = 59/143 (41.26%), Query Frame = 1
Query: 1795 QIQLH-EMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQK----------------PFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            Q+ +H E  + ++   R   C+ C K +  S +L  H++ H + +                P+ C  C K+F+  S L  H + H   + F C  C K FN K  L+ H   H  +K    C  C   F+   +L+ H    H
Sbjct:  137 QLAIHMEEHRQELANTRAHTCKACKKEFETSPELKEHMKTHCKVRASGTRSYNRNIDRSSFPYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPH-ACAFCPAAFSQKGNLQSHVQRVH 278          

HSP 25 Score: 54.299 bits (129), Expect = 1.804e-6
Identity = 35/115 (30.43%), Postives = 51/115 (44.35%), Query Frame = 1
Query: 2377 RLFKCNHCGKSYKFKKYLNEHLKEH-----LSANNTNV--CQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            R+  C  C K++K   +L EH+  H     LS+    V  C  C K+F     +++H R  H   R F C  C   F  K++L  H   H+  +PY C  C+  F  K     H+
Sbjct: 1687 RIHGCRVCRKAFKRATHLKEHMLTHQAGPSLSSQKPRVFKCDSCEKAFAKPSQLERHSRI-HTGERPFHCTLCDKAFNQKSALQVHLKKHTGERPYRCDYCVMGFTQKSNMKLHM 1800          

HSP 26 Score: 53.1434 bits (126), Expect = 3.784e-6
Identity = 64/259 (24.71%), Postives = 95/259 (36.68%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYS---VH-CKVCYKGFD----LQEDLSRHVDEKHAASSSCIEGLPEGRKP-----AGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQL---IQYNCAQCNIMFAQESSYVNHQKSVH 4965
            P+ C  C + FN   NL  H   H    P  CP C K+F    SLK H          +         L SQ+A+  H++ H +E +    H CK C K F+    L+E +  H   + + + S    +     P      G+    P+              + +     ++  KC  C   FN K     H  +    EK H    C   F        HVQ VH+++     YNC +C+ +F    S   H   +H
Sbjct:   67 PHRCDQCPQTFNVEFNLTLHKCTHNAEDPV-CPVCNKKFSRVASLKAHIMLHEKEENLICSECGDEFTLHSQLAI--HMEEHRQELANTRAHTCKACKKEFETSPELKEHMKTHCKVRASGTRSYNRNIDRSSFPYSCPHCGKTFQKPSQL-----------TRHIRIHTGERPFKCSECGKAFNQKGALQTHM-IKHTGEKPHACAFCPAAFSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKMH 310          
BLAST of Zinc finger, C2H2 type vs. Ensembl Mouse
Match: Zfp780b (zinc finger protein 780B [Source:MGI Symbol;Acc:MGI:2444764])

HSP 1 Score: 152.91 bits (385), Expect = 4.115e-37
Identity = 145/514 (28.21%), Postives = 221/514 (43.00%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKN-----------GTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSY--IPSAENFIKLDWDKSHQGILLSEDVE--------RIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHIS 2703
            C  CGKAF  P LL+ H+  HTG K FEC  C K F + S++  H ++H +VK + C  CGKAF    N+  H K  H +           G  VL+Q   H    + +   E  +    F+    L    +S S +         +     +   Y     ++T  +      ++F ++     H+  L+  DV+        +  K +  +  H+ I    +G R F+C+ C K +     LTRH  IHT +K F+C  C K FR  + L  H   H   K F C +C K F L+  L  H+++H  +K  F CK+C   F   + L  HY+        + D  P+Q         Q+    +++     N P + K       LN    +    ++  S+ R +KC  CGK++     LN H   H S N    C+ C KSF    ++ QH    H   + + C +C   FI ++SL  H  +HS+ KP+ C  C + F    Y  RH S
Sbjct:  229 CNECGKAFHLPDLLKYHKTIHTGEKPFECRECGKSFNRVSNLVAHRIIHADVKPYKCSECGKAFKRRSNLVQHQKT-HSDERPFQCKDCGKGFIVLAQLTRHQNIHTGEKSFECHECGKAFRLPQQLTRHQKSHSGEKPFKCNECGKAFHLPDLLKYHKTIHTSTKPFECRECGKSFHRISNLVEHR--LIHADVKPHKCNECGKAFKRSKSLMQHQKIH---SGERPFQCQECGKAFIVLTHLTRHQTIHTGEKSFECNECGKKFRTATHLVMHQTIHTGEKPFECNVCGKAFRLQVYLSEHQKIHIEEKP-FKCKLCGSAFRRKYQLNEHYTI-------HTDEKPYQCKECGKCFRQRSNFTEHQSIHTGNKPFECKECGKFFRLN---TLLIRHQKSHSSERPYKCKECGKAFHLPSELNNHQIVHTS-NRPFECKVCGKSFKRESTLIQH-SVIHGGVKSYECNECGKAFIHRSSLFHHRKIHSDEKPFKCQECGKAFVVLAYLTRHQS 723          

HSP 2 Score: 125.561 bits (314), Expect = 1.643e-28
Identity = 126/498 (25.30%), Postives = 197/498 (39.56%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAE------------ITQYLWNEN-PTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQV---TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C  CGKAF+ P  L RH+ +H+G K FEC  C K F     +K H  +H   K F C+ CGK+F    N+  H ++IH                 ++    +  +    FK+ ++L +  ++ SD+              + Q   ++N  T E  F     H+      +P           KSH G    E   + ++      L +++K      T  + F CR C K + +  +L  H  IH   KP +C  C K+F+    L  H K H   + F C+ C K F +   L  H+ +H  +K  F C  C ++F T  HL  H                                     T ++   P  +  +  +     + ++E  K  +   + FKC  CG +++ K  LNEH   H        C+ C K F    +  +H ++ H   + F C +C  FF     LIRH   HS+ +PY C  C + F
Sbjct:  201 CEECGKAFRLPQQLTRHQKSHSGEKPFECNECGKAFHLPDLLKYHKTIHTGEKPFECRECGKSFNRVSNLVAH-RIIH-----------------ADVKPYKCSECGKAFKRRSNLVQHQKTHSDERPFQCKDCGKGFIVLAQLTRHQNIHTGEKSFEC---HECGKAFRLPQQLT----RHQKSHSG----EKPFKCNECGKAFHLPDLLKYHKTIHTSTKPFECRECGKSFHRISNLVEHRLIHADVKPHKCNECGKAFKRSKSLMQHQKIHSGERPFQCQECGKAFIVLTHLTRHQTIHTGEK-SFECNECGKKFRTATHLVMH------------------------------------QTIHTGEKP-FECNVCGKAFRLQVYLSEHQKIHI-EEKPFKCKLCGSAFRRKYQLNEHYTIHTDEKPYQ-CKECGKCFRQRSNFTEH-QSIHTGNKPFECKECGKFFRLNTLLIRHQKSHSSERPYKCKECGKAF 628          

HSP 3 Score: 125.176 bits (313), Expect = 2.443e-28
Identity = 126/491 (25.66%), Postives = 200/491 (40.73%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVK----------PLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYAC 2649
            C  CGKAF+ P  L RH+ +H+G K F+C  C K F     +K H  +H + K F C+ CGK+F    N+  H ++IH       +  + H  NE              FK+  SL +  +  S                E  F  Q              + FI L     HQ I   E      +  +  +    + +H+ I    TG + F C  C K +R    L+ H +IH ++KPF+C +C  +FR K  L  H+  H   K + C+ C K F  +     H+ +H  +K  F CK C + F     L       H +S ++  P   +          +  +  ++    SN P + K           LI + +++  +             + ++CN CGK++  +  L  H K H S      CQ C K+FV    + +H ++ H   + F C QC + F  K+ L +H   H++ K + C
Sbjct:  341 CHECGKAFRLPQQLTRHQKSHSGEKPFKCNECGKAFHLPDLLKYHKTIHTSTKPFECRECGKSFHRISNLVEH-RLIH-------ADVKPHKCNECGKA----------FKRSKSLMQHQKIHS---------------GERPFQCQE-----------CGKAFIVLTHLTRHQTIHTGEKSFECNECGKKFRTATHLVMHQTIH---TGEKPFECNVCGKAFRLQVYLSEHQKIHIEEKPFKCKLCGSAFRRKYQLNEHYTIHTDEKPYQCKECGKCFRQRSNFTEHQSIHTGNKP-FECKECGKFFRLNTLL-----IRHQKSHSSERPYKCKECGKAFHLPSELNN--HQIVHTSNRPFECKVCGKSFKRESTLIQHSVIHGGV-------------KSYECNECGKAFIHRSSLFHHRKIH-SDEKPFKCQECGKAFVVLAYLTRH-QSIHTGEKSFECQQCGSAFRYKSQLSKHQRSHTDVKLFQC 761          

HSP 4 Score: 113.235 bits (282), Expect = 1.189e-24
Identity = 90/328 (27.44%), Postives = 141/328 (42.99%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH---------ISAKKCSKKKRNRFQQNDLMTGIINRNP 2781
            TG + F CR C K + +  +L  H  IH   KP++C  C K+F+ +S L  H K+H   + F C+ C K F +   L  H+ +H  +K  F C  C + F     L     T H +S +   P                +  K   T+        KP    E       I+ + + +L  ++ +  KCN CGK++K  K L +H K H S      CQ C K+F+    + +H +T H   + F C +C   F T   L+ H  +H+  KP+ C +C + F+ ++Y   H            K C    R ++Q N+  T   +  P
Sbjct:  250 TGEKPFECRECGKSFNRVSNLVAHRIIHADVKPYKCSECGKAFKRRSNLVQHQKTHSDERPFQCKDCGKGFIVLAQLTRHQNIHTGEK-SFECHECGKAFRLPQQL-----TRHQKSHSGEKPFKCNECGKAFHLPDLLKYHKTIHTS-------TKPFECRECGKSFHRISNLVEHRLIHADVKPHKCNECGKAFKRSKSLMQHQKIH-SGERPFQCQECGKAFIVLTHLTRH-QTIHTGEKSFECNECGKKFRTATHLVMHQTIHTGEKPFECNVCGKAFRLQVYLSEHQKIHIEEKPFKCKLCGSAFRRKYQLNEHYTIHTDEKP 562          

HSP 5 Score: 111.694 bits (278), Expect = 3.444e-24
Identity = 103/381 (27.03%), Postives = 170/381 (44.62%), Query Frame = 1
Query: 1567 SLAETNQSPSDDAEI---TQYLWNENPTNENHFSYQPNHQ-------SNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRK--LSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            ++ E    PS D E     + +  ENP N   F  Q   Q        ++ S  P+   F  L   +S  G  ++ + E +   T Q   H   K        + C+ C K +     LT+H  IHT +KP++C  C K+FRL   L  H KSH   K F C  C K F+L   LK H+ +H  +K  F C+ C + FN   +L  H        I + D  P++         ++   ++++ T +     D +P    +     I +A++ + +   +  + F+C+ CGK+++  + L  H K H S      C  C K+F     ++ H +T H + + F C +C   F   ++L+ H L+H++ KP+ C  C + FK
Sbjct:   76 AVKEETDRPSPDLETDYDAENISPENPINNKKFLKQSIKQLITFDPKDSSTSIGPNYSTFHGLQDCQSDAGQQIT-NKEGVPPHTCQTLAHNTEKP-------YECKECGKCFGCRSTLTQHQSIHTGEKPYECEECGKAFRLPQQLTRHQKSHSGEKPFECNECGKAFHLPDLLKYHKTIHTGEKP-FECRECGKSFNRVSNLVAH-------RIIHADVKPYKCSECGKAFKRRSNLVQHQKTHS-----DERPFQCKDCGKGFIVLAQLTRHQNIHTGEKSFECHECGKAFRLPQQLTRHQKSH-SGEKPFKCNECGKAFHLPDLLKYH-KTIHTSTKPFECRECGKSFHRISNLVEHRLIHADVKPHKCNECGKAFK 433          

HSP 6 Score: 105.531 bits (262), Expect = 2.564e-22
Identity = 85/291 (29.21%), Postives = 137/291 (47.08%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            TG + F C  C K +R +  L  H  IHT +KPF+C +C K+FRL+  L  H K H + K F C++C   F  K  L  H  +H  D+  + CK C + F      R   + + H+SI   +  P +              ++++ + +S  P   K     +  + P   +E++  ++  ++NR F+C  CGKS+K +  L +H   H    +   C  C K+F+ +RS   H R  H + + F C +C   F+  A L RH  +H+  K + C  C   F+ K    +H
Sbjct:  474 TGEKSFECNECGKKFRTATHLVMHQTIHTGEKPFECNVCGKAFRLQVYLSEHQKIHIEEKPFKCKLCGSAFRRKYQLNEHYTIH-TDEKPYQCKECGKCF------RQRSNFTEHQSIHTGN-KPFECKECGKFFRLNTLLIRHQKSHSSERPYKCKEC--GKAFHLP---SELNNHQIVHTSNRPFECKVCGKSFKRESTLIQHSVIHGGVKSYE-CNECGKAFI-HRSSLFHHRKIHSDEKPFKCQECGKAFVVLAYLTRHQSIHTGEKSFECQQCGSAFRYKSQLSKH 749          

HSP 7 Score: 97.4413 bits (241), Expect = 8.454e-20
Identity = 140/576 (24.31%), Postives = 219/576 (38.02%), Query Frame = 1
Query:  556 HMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGE---ECDD--------RKLTTNY--------LKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV----------IHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAE-----TNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSED--------VERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYH 2157
            H +IH  ++ F+C  C  S+N   NL+ H  IIH +             YKC  C   F R+     H   H  +    C+ C   F     L +H N H  GE   EC +        ++LT +          KC  C   F ++ ++ K++   H  T    P E     K   R+   +E        K  K   +  K + + +S +   K      I    RP +           C  CGKAF     L RH+  HTG K FEC  C K F   + + +H  +H   K F C  CGKAF  +  ++ H K+          +  +      Q  EH    +++   + ++    F++ ++  E     T   P +  E  ++       N     +Q +H S              L  + ++  I+ + +         +   +E+  IQ H +I     G + + C  C K +     L  H +IH+ +KPF+C  C K+F + + L  H   H   K F C+ C   F  K  L  H++ H   KL F C      F  G +L  H
Sbjct:  245 HKTIHTGEKPFECRECGKSFNRVSNLVAH-RIIHADV----------KPYKCSECGKAFKRRSNLVQHQKTHSDERPFQCKDCGKGFIVLAQLTRHQNIH-TGEKSFECHECGKAFRLPQQLTRHQKSHSGEKPFKCNECGKAF-HLPDLLKYHKTIHTSTK---PFECRECGKSFHRISNLVEHRLIHADVKPHKCN-ECGKAFKRSKSLMQHQK------IHSGERPFQ-----------CQECGKAFIVLTHLTRHQTIHTGEKSFECNECGKKFRTATHLVMHQTIHTGEKPFECNVCGKAFRLQVYLSEHQKIHIEEKPFKCKLCGSAFRRKYQLNEHYTIHTDEKPYQCKECGKCFRQRSNFTEHQSIHTGNKPFECKECGKFFR----LNTLLIRHQKSHSSERPYKCKECGKAFHLPSELNNHQIVHTSNRPFECKVCGKSFKRESTLIQ-HSVIHG---GVKSYECNECGKAFIHRSSLFHHRKIHSDEKPFKCQECGKAFVVLAYLTRHQSIHTGEKSFECQQCGSAFRYKSQLSKHQRSHTDVKL-FQCMEGGNDFVHGTNLSIH 777          

HSP 8 Score: 74.3294 bits (181), Expect = 1.156e-12
Identity = 80/327 (24.46%), Postives = 125/327 (38.23%), Query Frame = 1
Query:  469 TVYKTINGTGKQ--TCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTH 1443
             +++TI+ TG++   C +C   F  +    +H  IH  ++ FKC  C  ++  +  L  H   IHT+          E  Y+C  C   F ++     H  IH  ++   C+ C   F+   LL +H   H           +    KCK C   F     +  H +      + + P E  +  K  +R  T I+               ++ +    G++ +       +R I    +P             C  CGKAF     L RH+  HTG K FEC  C   F  KS +  H   H +VK F C   G  F +  N++ H
Sbjct:  495 VMHQTIH-TGEKPFECNVCGKAFRLQVYLSEHQKIHIEEKPFKCKLCGSAFRRKYQLNEHYT-IHTD----------EKPYQCKECGKCFRQRSNFTEHQSIHTGNKPFECKECGKFFRLNTLLIRHQKSHS----------SERPYKCKECGKAFHLPSELNNHQIV----HTSNRPFECKVCGKSFKRESTLIQHSVIHG-------GVKSYECNECGKAFIHRSSLFHHRKIHSDEKP-----------FKCQECGKAFVVLAYLTRHQSIHTGEKSFECQQCGSAFRYKSQLSKHQRSHTDVKLFQCMEGGNDFVHGTNLSIH 777          

HSP 9 Score: 60.8474 bits (146), Expect = 1.583e-8
Identity = 69/256 (26.95%), Postives = 102/256 (39.84%), Query Frame = 1
Query: 4192 PDLNKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            PDL K        + P+ C  C K F+R SNL +H  +H  ++P++C +C K F+   SL  H+  K  S  +  +C  C K       L  H  +H  E S  C  C K F     L  H            + +  G KP  E +          +  + + I      I +K  KC  C   F  K + + H+ +    EK +  + C K F   S F  H Q +H     + C +C   F   +  + HQKS
Sbjct:  379 PDLLKYHKTIHTSTKPFECRECGKSFHRISNLVEHRLIHADVKPHKCNECGKAFKRSKSLMQHQ--KIHSGERPFQCQECGKAFIVLTHLTRHQTIHTGEKSFECNECGKKFRTATHLVMH------------QTIHTGEKPF-ECNVCGKAFRLQVYLSEHQKI-----HIEEKPFKCKLCGSAFRRKYQLNEHYTIHTD-EKPYQCKECGKCFRQRSNFTEH-QSIHTGNKPFECKECGKFFRLNTLLIRHQKS 612          

HSP 10 Score: 59.6918 bits (143), Expect = 3.258e-8
Identity = 63/251 (25.10%), Postives = 104/251 (41.43%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGF----DLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXK-------PIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            P+ C  C K F   ++L +H ++HT  + ++C +C K+FR    L  H+ T H+                 QV L  H K+H+ E    CK+C   F     L E  + H DEK      C +   + R    E  S  T +  +  ++  K        I+       ++  KC  C   F+  ++ +NH  V   + +    + C K+F+  S  + H   +H  +  Y C +C   F   SS  +H+K
Sbjct:  450 PFQCQECGKAFIVLTHLTRHQTIHTGEKSFECNECGKKFRTATHLVMHQ-TIHTGEKPFECNVCGKAFRL-QVYLSEHQKIHIEEKPFKCKLCGSAFRRKYQLNEHYTIHTDEKPYQCKECGKCFRQ-RSNFTEHQSIHTGNKPFECKECGKFFRLNTLLIRHQKSHSSERPYKCKECGKAFHLPSELNNHQIVHT-SNRPFECKVCGKSFKRESTLIQH-SVIHGGVKSYECNECGKAFIHRSSLFHHRK 695          

HSP 11 Score: 58.9214 bits (141), Expect = 6.589e-8
Identity = 68/267 (25.47%), Postives = 102/267 (38.20%), Query Frame = 1
Query: 4192 PDLNKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH----VDEKHAASSSCIEG--LPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLI-------KCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQ 4953
            PDL K          P+ C  C K FNR SNL  H  +H  ++PY+C +C K F+ R +L  H+ T         +      ++ +Q  L  H  +H  E S  C  C K F L + L+RH      EK    + C +   LP+  K    +    T    +  ++  K    +   +  +LI       KC  C   F        H  +    E+    + C K F   +    H Q +H     + C +C   F   +  V HQ
Sbjct:  239 PDLLKYHKTIHTGEKPFECRECGKSFNRVSNLVAHRIIHADVKPYKCSECGKAFKRRSNLVQHQKTHSDERPFQCKDCGKGFIVLAQ--LTRHQNIHTGEKSFECHECGKAFRLPQQLTRHQKSHSGEKPFKCNECGKAFHLPDLLKYHKTIH---TSTKPFECRECGKSFHRISNLVEHRLIHADVKPHKCNECGKAFKRSKSLMQHQKIH-SGERPFQCQECGKAFIVLTHLTRH-QTIHTGEKSFECNECGKKFRTATHLVMHQ 498          

HSP 12 Score: 57.3806 bits (137), Expect = 1.579e-7
Identity = 46/166 (27.71%), Postives = 75/166 (45.18%), Query Frame = 1
Query: 2368 SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLMTGIINRNPIGSLTN-QIGQSDLEANDQSETFTAFRL 2862
            +  + ++C  CGK+++  + L  H K H S      C  C K+F     ++ H +T H   + F C +C   F   ++L+ H ++H++ KPY C  C + FK +    +H   +K    +R  FQ  D   G I    +    N   G+   E +   E   AFRL
Sbjct:  194 TGEKPYECEECGKAFRLPQQLTRHQKSH-SGEKPFECNECGKAFHLPDLLKYH-KTIHTGEKPFECRECGKSFNRVSNLVAHRIIHADVKPYKCSECGKAFKRRSNLVQH---QKTHSDERP-FQCKDCGKGFIVLAQLTRHQNIHTGEKSFECH---ECGKAFRL 350          

HSP 13 Score: 53.9138 bits (128), Expect = 2.248e-6
Identity = 30/79 (37.97%), Postives = 41/79 (51.90%), Query Frame = 1
Query: 1846 FRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH 2082
            F+C+ C K +     LTRH  IHT +K F+C  C  +FR KS L  H +SH  +K F C      F     L +H+ +H
Sbjct:  703 FKCQECGKAFVVLAYLTRHQSIHTGEKSFECQQCGSAFRYKSQLSKHQRSHTDVKLFQCMEGGNDFVHGTNLSIHQGIH 781          

HSP 14 Score: 53.5286 bits (127), Expect = 2.999e-6
Identity = 38/106 (35.85%), Postives = 50/106 (47.17%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH 4554
            P+ C +C K F R S L QH  +H  ++ Y+C +C K F HR SL  H   K  S  K  +C  C K       L  H  +H  E S  C+ C   F  +  LS+H
Sbjct:  646 PFECKVCGKSFKRESTLIQHSVIHGGVKSYECNECGKAFIHRSSLFHHR--KIHSDEKPFKCQECGKAFVVLAYLTRHQSIHTGEKSFECQQCGSAFRYKSQLSKH 749          
BLAST of Zinc finger, C2H2 type vs. Ensembl Mouse
Match: Zfp780b (zinc finger protein 780B [Source:MGI Symbol;Acc:MGI:2444764])

HSP 1 Score: 152.91 bits (385), Expect = 4.115e-37
Identity = 145/514 (28.21%), Postives = 221/514 (43.00%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKN-----------GTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSY--IPSAENFIKLDWDKSHQGILLSEDVE--------RIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHIS 2703
            C  CGKAF  P LL+ H+  HTG K FEC  C K F + S++  H ++H +VK + C  CGKAF    N+  H K  H +           G  VL+Q   H    + +   E  +    F+    L    +S S +         +     +   Y     ++T  +      ++F ++     H+  L+  DV+        +  K +  +  H+ I    +G R F+C+ C K +     LTRH  IHT +K F+C  C K FR  + L  H   H   K F C +C K F L+  L  H+++H  +K  F CK+C   F   + L  HY+        + D  P+Q         Q+    +++     N P + K       LN    +    ++  S+ R +KC  CGK++     LN H   H S N    C+ C KSF    ++ QH    H   + + C +C   FI ++SL  H  +HS+ KP+ C  C + F    Y  RH S
Sbjct:  229 CNECGKAFHLPDLLKYHKTIHTGEKPFECRECGKSFNRVSNLVAHRIIHADVKPYKCSECGKAFKRRSNLVQHQKT-HSDERPFQCKDCGKGFIVLAQLTRHQNIHTGEKSFECHECGKAFRLPQQLTRHQKSHSGEKPFKCNECGKAFHLPDLLKYHKTIHTSTKPFECRECGKSFHRISNLVEHR--LIHADVKPHKCNECGKAFKRSKSLMQHQKIH---SGERPFQCQECGKAFIVLTHLTRHQTIHTGEKSFECNECGKKFRTATHLVMHQTIHTGEKPFECNVCGKAFRLQVYLSEHQKIHIEEKP-FKCKLCGSAFRRKYQLNEHYTI-------HTDEKPYQCKECGKCFRQRSNFTEHQSIHTGNKPFECKECGKFFRLN---TLLIRHQKSHSSERPYKCKECGKAFHLPSELNNHQIVHTS-NRPFECKVCGKSFKRESTLIQH-SVIHGGVKSYECNECGKAFIHRSSLFHHRKIHSDEKPFKCQECGKAFVVLAYLTRHQS 723          

HSP 2 Score: 125.561 bits (314), Expect = 1.643e-28
Identity = 126/498 (25.30%), Postives = 197/498 (39.56%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAE------------ITQYLWNEN-PTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQV---TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C  CGKAF+ P  L RH+ +H+G K FEC  C K F     +K H  +H   K F C+ CGK+F    N+  H ++IH                 ++    +  +    FK+ ++L +  ++ SD+              + Q   ++N  T E  F     H+      +P           KSH G    E   + ++      L +++K      T  + F CR C K + +  +L  H  IH   KP +C  C K+F+    L  H K H   + F C+ C K F +   L  H+ +H  +K  F C  C ++F T  HL  H                                     T ++   P  +  +  +     + ++E  K  +   + FKC  CG +++ K  LNEH   H        C+ C K F    +  +H ++ H   + F C +C  FF     LIRH   HS+ +PY C  C + F
Sbjct:  201 CEECGKAFRLPQQLTRHQKSHSGEKPFECNECGKAFHLPDLLKYHKTIHTGEKPFECRECGKSFNRVSNLVAH-RIIH-----------------ADVKPYKCSECGKAFKRRSNLVQHQKTHSDERPFQCKDCGKGFIVLAQLTRHQNIHTGEKSFEC---HECGKAFRLPQQLT----RHQKSHSG----EKPFKCNECGKAFHLPDLLKYHKTIHTSTKPFECRECGKSFHRISNLVEHRLIHADVKPHKCNECGKAFKRSKSLMQHQKIHSGERPFQCQECGKAFIVLTHLTRHQTIHTGEK-SFECNECGKKFRTATHLVMH------------------------------------QTIHTGEKP-FECNVCGKAFRLQVYLSEHQKIHI-EEKPFKCKLCGSAFRRKYQLNEHYTIHTDEKPYQ-CKECGKCFRQRSNFTEH-QSIHTGNKPFECKECGKFFRLNTLLIRHQKSHSSERPYKCKECGKAF 628          

HSP 3 Score: 125.176 bits (313), Expect = 2.443e-28
Identity = 126/491 (25.66%), Postives = 200/491 (40.73%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVK----------PLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYAC 2649
            C  CGKAF+ P  L RH+ +H+G K F+C  C K F     +K H  +H + K F C+ CGK+F    N+  H ++IH       +  + H  NE              FK+  SL +  +  S                E  F  Q              + FI L     HQ I   E      +  +  +    + +H+ I    TG + F C  C K +R    L+ H +IH ++KPF+C +C  +FR K  L  H+  H   K + C+ C K F  +     H+ +H  +K  F CK C + F     L       H +S ++  P   +          +  +  ++    SN P + K           LI + +++  +             + ++CN CGK++  +  L  H K H S      CQ C K+FV    + +H ++ H   + F C QC + F  K+ L +H   H++ K + C
Sbjct:  341 CHECGKAFRLPQQLTRHQKSHSGEKPFKCNECGKAFHLPDLLKYHKTIHTSTKPFECRECGKSFHRISNLVEH-RLIH-------ADVKPHKCNECGKA----------FKRSKSLMQHQKIHS---------------GERPFQCQE-----------CGKAFIVLTHLTRHQTIHTGEKSFECNECGKKFRTATHLVMHQTIH---TGEKPFECNVCGKAFRLQVYLSEHQKIHIEEKPFKCKLCGSAFRRKYQLNEHYTIHTDEKPYQCKECGKCFRQRSNFTEHQSIHTGNKP-FECKECGKFFRLNTLL-----IRHQKSHSSERPYKCKECGKAFHLPSELNN--HQIVHTSNRPFECKVCGKSFKRESTLIQHSVIHGGV-------------KSYECNECGKAFIHRSSLFHHRKIH-SDEKPFKCQECGKAFVVLAYLTRH-QSIHTGEKSFECQQCGSAFRYKSQLSKHQRSHTDVKLFQC 761          

HSP 4 Score: 113.235 bits (282), Expect = 1.189e-24
Identity = 90/328 (27.44%), Postives = 141/328 (42.99%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH---------ISAKKCSKKKRNRFQQNDLMTGIINRNP 2781
            TG + F CR C K + +  +L  H  IH   KP++C  C K+F+ +S L  H K+H   + F C+ C K F +   L  H+ +H  +K  F C  C + F     L     T H +S +   P                +  K   T+        KP    E       I+ + + +L  ++ +  KCN CGK++K  K L +H K H S      CQ C K+F+    + +H +T H   + F C +C   F T   L+ H  +H+  KP+ C +C + F+ ++Y   H            K C    R ++Q N+  T   +  P
Sbjct:  250 TGEKPFECRECGKSFNRVSNLVAHRIIHADVKPYKCSECGKAFKRRSNLVQHQKTHSDERPFQCKDCGKGFIVLAQLTRHQNIHTGEK-SFECHECGKAFRLPQQL-----TRHQKSHSGEKPFKCNECGKAFHLPDLLKYHKTIHTS-------TKPFECRECGKSFHRISNLVEHRLIHADVKPHKCNECGKAFKRSKSLMQHQKIH-SGERPFQCQECGKAFIVLTHLTRH-QTIHTGEKSFECNECGKKFRTATHLVMHQTIHTGEKPFECNVCGKAFRLQVYLSEHQKIHIEEKPFKCKLCGSAFRRKYQLNEHYTIHTDEKP 562          

HSP 5 Score: 111.694 bits (278), Expect = 3.444e-24
Identity = 103/381 (27.03%), Postives = 170/381 (44.62%), Query Frame = 1
Query: 1567 SLAETNQSPSDDAEI---TQYLWNENPTNENHFSYQPNHQ-------SNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRK--LSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            ++ E    PS D E     + +  ENP N   F  Q   Q        ++ S  P+   F  L   +S  G  ++ + E +   T Q   H   K        + C+ C K +     LT+H  IHT +KP++C  C K+FRL   L  H KSH   K F C  C K F+L   LK H+ +H  +K  F C+ C + FN   +L  H        I + D  P++         ++   ++++ T +     D +P    +     I +A++ + +   +  + F+C+ CGK+++  + L  H K H S      C  C K+F     ++ H +T H + + F C +C   F   ++L+ H L+H++ KP+ C  C + FK
Sbjct:   76 AVKEETDRPSPDLETDYDAENISPENPINNKKFLKQSIKQLITFDPKDSSTSIGPNYSTFHGLQDCQSDAGQQIT-NKEGVPPHTCQTLAHNTEKP-------YECKECGKCFGCRSTLTQHQSIHTGEKPYECEECGKAFRLPQQLTRHQKSHSGEKPFECNECGKAFHLPDLLKYHKTIHTGEKP-FECRECGKSFNRVSNLVAH-------RIIHADVKPYKCSECGKAFKRRSNLVQHQKTHS-----DERPFQCKDCGKGFIVLAQLTRHQNIHTGEKSFECHECGKAFRLPQQLTRHQKSH-SGEKPFKCNECGKAFHLPDLLKYH-KTIHTSTKPFECRECGKSFHRISNLVEHRLIHADVKPHKCNECGKAFK 433          

HSP 6 Score: 105.531 bits (262), Expect = 2.564e-22
Identity = 85/291 (29.21%), Postives = 137/291 (47.08%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            TG + F C  C K +R +  L  H  IHT +KPF+C +C K+FRL+  L  H K H + K F C++C   F  K  L  H  +H  D+  + CK C + F      R   + + H+SI   +  P +              ++++ + +S  P   K     +  + P   +E++  ++  ++NR F+C  CGKS+K +  L +H   H    +   C  C K+F+ +RS   H R  H + + F C +C   F+  A L RH  +H+  K + C  C   F+ K    +H
Sbjct:  474 TGEKSFECNECGKKFRTATHLVMHQTIHTGEKPFECNVCGKAFRLQVYLSEHQKIHIEEKPFKCKLCGSAFRRKYQLNEHYTIH-TDEKPYQCKECGKCF------RQRSNFTEHQSIHTGN-KPFECKECGKFFRLNTLLIRHQKSHSSERPYKCKEC--GKAFHLP---SELNNHQIVHTSNRPFECKVCGKSFKRESTLIQHSVIHGGVKSYE-CNECGKAFI-HRSSLFHHRKIHSDEKPFKCQECGKAFVVLAYLTRHQSIHTGEKSFECQQCGSAFRYKSQLSKH 749          

HSP 7 Score: 97.4413 bits (241), Expect = 8.454e-20
Identity = 140/576 (24.31%), Postives = 219/576 (38.02%), Query Frame = 1
Query:  556 HMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGE---ECDD--------RKLTTNY--------LKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV----------IHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAE-----TNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSED--------VERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYH 2157
            H +IH  ++ F+C  C  S+N   NL+ H  IIH +             YKC  C   F R+     H   H  +    C+ C   F     L +H N H  GE   EC +        ++LT +          KC  C   F ++ ++ K++   H  T    P E     K   R+   +E        K  K   +  K + + +S +   K      I    RP +           C  CGKAF     L RH+  HTG K FEC  C K F   + + +H  +H   K F C  CGKAF  +  ++ H K+          +  +      Q  EH    +++   + ++    F++ ++  E     T   P +  E  ++       N     +Q +H S              L  + ++  I+ + +         +   +E+  IQ H +I     G + + C  C K +     L  H +IH+ +KPF+C  C K+F + + L  H   H   K F C+ C   F  K  L  H++ H   KL F C      F  G +L  H
Sbjct:  245 HKTIHTGEKPFECRECGKSFNRVSNLVAH-RIIHADV----------KPYKCSECGKAFKRRSNLVQHQKTHSDERPFQCKDCGKGFIVLAQLTRHQNIH-TGEKSFECHECGKAFRLPQQLTRHQKSHSGEKPFKCNECGKAF-HLPDLLKYHKTIHTSTK---PFECRECGKSFHRISNLVEHRLIHADVKPHKCN-ECGKAFKRSKSLMQHQK------IHSGERPFQ-----------CQECGKAFIVLTHLTRHQTIHTGEKSFECNECGKKFRTATHLVMHQTIHTGEKPFECNVCGKAFRLQVYLSEHQKIHIEEKPFKCKLCGSAFRRKYQLNEHYTIHTDEKPYQCKECGKCFRQRSNFTEHQSIHTGNKPFECKECGKFFR----LNTLLIRHQKSHSSERPYKCKECGKAFHLPSELNNHQIVHTSNRPFECKVCGKSFKRESTLIQ-HSVIHG---GVKSYECNECGKAFIHRSSLFHHRKIHSDEKPFKCQECGKAFVVLAYLTRHQSIHTGEKSFECQQCGSAFRYKSQLSKHQRSHTDVKL-FQCMEGGNDFVHGTNLSIH 777          

HSP 8 Score: 74.3294 bits (181), Expect = 1.156e-12
Identity = 80/327 (24.46%), Postives = 125/327 (38.23%), Query Frame = 1
Query:  469 TVYKTINGTGKQ--TCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTH 1443
             +++TI+ TG++   C +C   F  +    +H  IH  ++ FKC  C  ++  +  L  H   IHT+          E  Y+C  C   F ++     H  IH  ++   C+ C   F+   LL +H   H           +    KCK C   F     +  H +      + + P E  +  K  +R  T I+               ++ +    G++ +       +R I    +P             C  CGKAF     L RH+  HTG K FEC  C   F  KS +  H   H +VK F C   G  F +  N++ H
Sbjct:  495 VMHQTIH-TGEKPFECNVCGKAFRLQVYLSEHQKIHIEEKPFKCKLCGSAFRRKYQLNEHYT-IHTD----------EKPYQCKECGKCFRQRSNFTEHQSIHTGNKPFECKECGKFFRLNTLLIRHQKSHS----------SERPYKCKECGKAFHLPSELNNHQIV----HTSNRPFECKVCGKSFKRESTLIQHSVIHG-------GVKSYECNECGKAFIHRSSLFHHRKIHSDEKP-----------FKCQECGKAFVVLAYLTRHQSIHTGEKSFECQQCGSAFRYKSQLSKHQRSHTDVKLFQCMEGGNDFVHGTNLSIH 777          

HSP 9 Score: 60.8474 bits (146), Expect = 1.583e-8
Identity = 69/256 (26.95%), Postives = 102/256 (39.84%), Query Frame = 1
Query: 4192 PDLNKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            PDL K        + P+ C  C K F+R SNL +H  +H  ++P++C +C K F+   SL  H+  K  S  +  +C  C K       L  H  +H  E S  C  C K F     L  H            + +  G KP  E +          +  + + I      I +K  KC  C   F  K + + H+ +    EK +  + C K F   S F  H Q +H     + C +C   F   +  + HQKS
Sbjct:  379 PDLLKYHKTIHTSTKPFECRECGKSFHRISNLVEHRLIHADVKPHKCNECGKAFKRSKSLMQHQ--KIHSGERPFQCQECGKAFIVLTHLTRHQTIHTGEKSFECNECGKKFRTATHLVMH------------QTIHTGEKPF-ECNVCGKAFRLQVYLSEHQKI-----HIEEKPFKCKLCGSAFRRKYQLNEHYTIHTD-EKPYQCKECGKCFRQRSNFTEH-QSIHTGNKPFECKECGKFFRLNTLLIRHQKS 612          

HSP 10 Score: 59.6918 bits (143), Expect = 3.258e-8
Identity = 63/251 (25.10%), Postives = 104/251 (41.43%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGF----DLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXK-------PIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            P+ C  C K F   ++L +H ++HT  + ++C +C K+FR    L  H+ T H+                 QV L  H K+H+ E    CK+C   F     L E  + H DEK      C +   + R    E  S  T +  +  ++  K        I+       ++  KC  C   F+  ++ +NH  V   + +    + C K+F+  S  + H   +H  +  Y C +C   F   SS  +H+K
Sbjct:  450 PFQCQECGKAFIVLTHLTRHQTIHTGEKSFECNECGKKFRTATHLVMHQ-TIHTGEKPFECNVCGKAFRL-QVYLSEHQKIHIEEKPFKCKLCGSAFRRKYQLNEHYTIHTDEKPYQCKECGKCFRQ-RSNFTEHQSIHTGNKPFECKECGKFFRLNTLLIRHQKSHSSERPYKCKECGKAFHLPSELNNHQIVHT-SNRPFECKVCGKSFKRESTLIQH-SVIHGGVKSYECNECGKAFIHRSSLFHHRK 695          

HSP 11 Score: 58.9214 bits (141), Expect = 6.589e-8
Identity = 68/267 (25.47%), Postives = 102/267 (38.20%), Query Frame = 1
Query: 4192 PDLNKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH----VDEKHAASSSCIEG--LPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLI-------KCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQ 4953
            PDL K          P+ C  C K FNR SNL  H  +H  ++PY+C +C K F+ R +L  H+ T         +      ++ +Q  L  H  +H  E S  C  C K F L + L+RH      EK    + C +   LP+  K    +    T    +  ++  K    +   +  +LI       KC  C   F        H  +    E+    + C K F   +    H Q +H     + C +C   F   +  V HQ
Sbjct:  239 PDLLKYHKTIHTGEKPFECRECGKSFNRVSNLVAHRIIHADVKPYKCSECGKAFKRRSNLVQHQKTHSDERPFQCKDCGKGFIVLAQ--LTRHQNIHTGEKSFECHECGKAFRLPQQLTRHQKSHSGEKPFKCNECGKAFHLPDLLKYHKTIH---TSTKPFECRECGKSFHRISNLVEHRLIHADVKPHKCNECGKAFKRSKSLMQHQKIH-SGERPFQCQECGKAFIVLTHLTRH-QTIHTGEKSFECNECGKKFRTATHLVMHQ 498          

HSP 12 Score: 57.3806 bits (137), Expect = 1.579e-7
Identity = 46/166 (27.71%), Postives = 75/166 (45.18%), Query Frame = 1
Query: 2368 SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLMTGIINRNPIGSLTN-QIGQSDLEANDQSETFTAFRL 2862
            +  + ++C  CGK+++  + L  H K H S      C  C K+F     ++ H +T H   + F C +C   F   ++L+ H ++H++ KPY C  C + FK +    +H   +K    +R  FQ  D   G I    +    N   G+   E +   E   AFRL
Sbjct:  194 TGEKPYECEECGKAFRLPQQLTRHQKSH-SGEKPFECNECGKAFHLPDLLKYH-KTIHTGEKPFECRECGKSFNRVSNLVAHRIIHADVKPYKCSECGKAFKRRSNLVQH---QKTHSDERP-FQCKDCGKGFIVLAQLTRHQNIHTGEKSFECH---ECGKAFRL 350          

HSP 13 Score: 53.9138 bits (128), Expect = 2.248e-6
Identity = 30/79 (37.97%), Postives = 41/79 (51.90%), Query Frame = 1
Query: 1846 FRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH 2082
            F+C+ C K +     LTRH  IHT +K F+C  C  +FR KS L  H +SH  +K F C      F     L +H+ +H
Sbjct:  703 FKCQECGKAFVVLAYLTRHQSIHTGEKSFECQQCGSAFRYKSQLSKHQRSHTDVKLFQCMEGGNDFVHGTNLSIHQGIH 781          

HSP 14 Score: 53.5286 bits (127), Expect = 2.999e-6
Identity = 38/106 (35.85%), Postives = 50/106 (47.17%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH 4554
            P+ C +C K F R S L QH  +H  ++ Y+C +C K F HR SL  H   K  S  K  +C  C K       L  H  +H  E S  C+ C   F  +  LS+H
Sbjct:  646 PFECKVCGKSFKRESTLIQHSVIHGGVKSYECNECGKAFIHRSSLFHHR--KIHSDEKPFKCQECGKAFVVLAYLTRHQSIHTGEKSFECQQCGSAFRYKSQLSKH 749          
BLAST of Zinc finger, C2H2 type vs. Ensembl Mouse
Match: Gm14326 (predicted gene 14326 [Source:MGI Symbol;Acc:MGI:3709298])

HSP 1 Score: 148.673 bits (374), Expect = 1.222e-36
Identity = 121/484 (25.00%), Postives = 198/484 (40.91%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPI--PIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C  CGK F+T  +L+ H+ THTG K ++C  C K F +   ++IH   H   K + C  CGKAF    ++  H +          +Q  +  ++           D  + K+      T + P +  +  +       +  +H        +    Y          +W++  +    S D+++              K   TG + + C+ C K +  S  L  H R HT  KP++C  C K+F +   L+ H ++H   K + C+ C K F +  TL++H+Q H  +K  + CK C + F+   HLR H      R+     P                +  K   T         KP   N+     I   + +I KR  +  + ++C  CGK++    +L  H + H +      C  C K+F+T R +Q H RT H   + + C QC   F + + L +H   HS  KPY C  C + F
Sbjct:  105 CNQCGKDFRTWNVLQIHKRTHTGEKPYDCKQCGKAFARSCHLRIHNRTHAGEKQYECNQCGKAFKRRSDLQIHKRTHTGEKPYECNQCGKAFVSSG---------DLQKHKRT----HTGEKPYECKQCGKAF-----SQSSHLRIHKRTHTGEKPY----------EWNQCGKAFARSGDLQK-------------HKRTHTGEKPYECKQCGKAFAHSSHLHIHERRHTGDKPYECKQCGKAFAVFYTLQMHKRTHTGDKPYECKQCGKAFTVIYTLQMHKQTHTGEKP-YECKQCGKAFSQSRHLRIHK-----RTHTGEKPYECNQCGKAFARSGDQQEHKRTHTGE-------KPYECNQCGKAFIRRRVLQIHKRTHTGEKSYECKQCGKAFAGSSHLRIHKRTH-TGEKPYECNQCGKAFITRRVLQIHKRT-HTGEKSYECKQCGKAFASSSDLQKHKRTHSGEKPYECKQCGKAF 532          

HSP 2 Score: 112.464 bits (280), Expect = 7.312e-25
Identity = 90/364 (24.73%), Postives = 149/364 (40.93%), Query Frame = 1
Query: 1618 YLWNENPTNENHFSYQPNHQSNTDS--------YIPSAENFIKLDWDKSHQGILLSE---DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            Y+W E+ T E+HF    +H  +  S        +I   + F      + HQ     E   D  +  K+     + ++ K   TG + + C+ C K + +SC L  H R H  +K ++C  C K+F+ +S L+ H ++H   K + C  C K F     L+ H++ H  +K  + CK C + F+   HLR H  T                                            KP  WN+         ++ K K   +  + ++C  CGK++    +L+ H + H + +    C+ C K+F  + ++Q H RT H   + + C QC   F    +L  H   H+  KPY C  C + F
Sbjct:   45 YIWEEH-TIEDHFQTSRSHGRHERSCSAEQPSEFIQCGKAFAYESGRQRHQIKHNGEKHHDCNQCGKDFRTWNVLQIHKRTHTGEKPYDCKQCGKAFARSCHLRIHNRTHAGEKQYECNQCGKAFKRRSDLQIHKRTHTGEKPYECNQCGKAFVSSGDLQKHKRTHTGEKP-YECKQCGKAFSQSSHLRIHKRTH----------------------------------------TGEKPYEWNQCGKAFARSGDLQKHKRTHTGEKPYECKQCGKAFAHSSHLHIHERRH-TGDKPYECKQCGKAFAVFYTLQMHKRT-HTGDKPYECKQCGKAFTVIYTLQMHKQTHTGEKPYECKQCGKAF 364          

HSP 3 Score: 97.4413 bits (241), Expect = 5.007e-20
Identity = 86/331 (25.98%), Postives = 137/331 (41.39%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTE------------VLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYI--PSAENFIKLDWDKSHQGILLSE---DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            C  CGKAF     LR H+ THTG K +E   C K F +   ++ H   H   K + C+ CGKAF   H+ + HI      G +            V    Q H    + D   E ++    F  I +L    Q+ + +         +  +   H        +    Y      + F +    + H+     E   +  +  K   + ++ ++ K   TG + + C+ C K +  S  L  H R HT +KP++C  C K+F  + VL+ H ++H   K + C+ C K F     L+ H++ H  +K  + CK C + F    HLR H  T
Sbjct:  217 CKQCGKAFSQSSHLRIHKRTHTGEKPYEWNQCGKAFARSGDLQKHKRTHTGEKPYECKQCGKAFA--HSSHLHIHERRHTGDKPYECKQCGKAFAVFYTLQMHKRTHTGDKPYECKQCGKAFTVIYTLQMHKQTHTGEKPYECKQCGKAFSQSRHLRIHKRTHTGEKPYECNQCGKAFARSGDQQEHKRTHTGEKPYECNQCGKAFIRRRVLQIHKRTHTGEKSYECKQCGKAFAGSSHLRIHKRTHTGEKPYECNQCGKAFITRRVLQIHKRTHTGEKSYECKQCGKAFASSSDLQKHKRTHSGEKP-YECKQCGKAFAQSSHLRIHKQT 544          

HSP 4 Score: 96.6709 bits (239), Expect = 8.328e-20
Identity = 77/293 (26.28%), Postives = 123/293 (41.98%), Query Frame = 1
Query: 1798 IQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKA 2676
            +Q+H   K   TG + + C  C K +  S DL +H R HT +KP++C  C K+F   S L+ H ++H   K +    C K F     L+ H++ H  +K  + CK C + F    HL  H      R      P   +            +   +K T   + P + K       +   I   ++ K+  +  + ++C  CGK++   ++L  H + H +      C  C K+F      Q+H RT H   + + C QC   FI +  L  H   H+  K Y C  C + F  
Sbjct:  174 LQIH---KRTHTGEKPYECNQCGKAFVSSGDLQKHKRTHTGEKPYECKQCGKAFSQSSHLRIHKRTHTGEKPYEWNQCGKAFARSGDLQKHKRTHTGEKP-YECKQCGKAFAHSSHLHIH-----ERRHTGDKPYECKQCGKAFAVFYTLQM--HKRTHTGDKPYECKQCGKAFTV---IYTLQMHKQTHTGEKPYECKQCGKAFSQSRHLRIHKRTH-TGEKPYECNQCGKAFARSGDQQEHKRT-HTGEKPYECNQCGKAFIRRRVLQIHKRTHTGEKSYECKQCGKAFAG 450          

HSP 5 Score: 52.373 bits (124), Expect = 5.622e-6
Identity = 28/88 (31.82%), Postives = 45/88 (51.14%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDK 2094
            TG + + C  C K +     L  H R HT +K ++C  C K+F   S L+ H ++H   K + C+ C K F     L++H+Q H  ++
Sbjct:  462 TGEKPYECNQCGKAFITRRVLQIHKRTHTGEKSYECKQCGKAFASSSDLQKHKRTHSGEKPYECKQCGKAFAQSSHLRIHKQTHTGER 549          

HSP 6 Score: 51.9878 bits (123), Expect = 6.844e-6
Identity = 23/57 (40.35%), Postives = 33/57 (57.89%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLC 1395
            C  CGKAF +   L++H+ TH+G K +EC  C K F Q S ++IH   H   + + C
Sbjct:  497 CKQCGKAFASSSDLQKHKRTHSGEKPYECKQCGKAFAQSSHLRIHKQTHTGERPYEC 553          
BLAST of Zinc finger, C2H2 type vs. UniProt/SwissProt
Match: sp|Q9UL36|ZN236_HUMAN (Zinc finger protein 236 OS=Homo sapiens OX=9606 GN=ZNF236 PE=1 SV=2)

HSP 1 Score: 211.075 bits (536), Expect = 2.458e-53
Identity = 204/764 (26.70%), Postives = 319/764 (41.75%), Query Frame = 1
Query:  703 YKCVICSCLFSRKKAHQAHCLIHQV-DEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDE-MKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNM--------------------------------NTHIKVIHKNGTEVLSQSQE--HLLNESNXXXXXXQKDPNR----------------FKKIASLAE-----TNQSPSDDAEIT-----------QYLWNEN---------PTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQ------LHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPT----ANSNNP-PDV---KPLIWNEL-LNQPIPIAEIDKRKLSNN------RLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            +KC IC   F ++   Q H   H+  D+   C+ CP  F  +  L  H   H  GE+            C +C+  F  V ++K H +  H K       E G       ++   +EE  +         AC+  K   +  S+L E MK      +S   R    +   +    +C  CGK F+ P  L RH   HTG + F+C  C K F QK +++ HM+ H   K   C FC  AF+ + N+                                NTHI  +H  G +  + S E  H+L  +       Q+   +                 +++  L+E     + QSP    +++           Q L N           P +  H      H  N D    S E     D ++  +     E  E++DK+  ++       L   I+++  G R   C +C K +RK  DL RHIRIHT +KPF+C  C ++F +KS L  H K+H  +K F C+ C K F+   +LKVH +LH   +  F C  CD++F T  H + H + SH +                  +  +    + KP       +N P PD+   +P++  +L L QPIP  +  +   +NN      R +KC +C ++YK   +L +H++ H +      C  C + FV+   ++ H+RT H   + F CL C   F T  SL RH  +H++ +PY CP C + FK  + C +H+
Sbjct:   37 HKCEICLLSFPKESQFQRHMRDHERNDKPHRCDQCPQTFNVEFNLTLHKCTHS-GED----------PTCPVCNKKFSRVASLKAH-IMLHEKEENLICSECGDEFTLQSQLAVHMEEHRQELAGTRQH-ACKACKKEFETSSELKEHMKTHYKIRVSST-RSYNRNIDRSGFTYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPHACAFCPAAFSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKMHMGGPQNSTSSTETAHVLTATLFQTLPLQQTEAQATSASSQPSSQAVSDVIQQLLELSEPAPVESGQSPQPGQQLSITVGINQDILQQALENSGLSSIPAAAHPNDSCHAKTSAPHAQNPDVSSVSNEQTDPTDAEQEKE----QESPEKLDKKEKKMIKKKSPFLPGSIREE-NGVRWHVCPYCAKEFRKPSDLVRHIRIHTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCMKSFSTSGSLKVHIRLHTGVR-PFACPHCDKKFRTSGHRKTHIA-SHFK-----------------HTELRKMRHQRKPAKVRVGKTNIPVPDIPLQEPILITDLGLIQPIPKNQFFQSYFNNNFVNEADRPYKCFYCHRAYKKSCHLKQHIRSH-TGEKPFKCSQCGRGFVSAGVLKAHIRT-HTGLKSFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHM 760          

HSP 2 Score: 127.872 bits (320), Expect = 4.944e-28
Identity = 95/333 (28.53%), Postives = 147/333 (44.14%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFR----CRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTG----FHLRYHYSTSHHRSIANPDP 2199
            C  C K FK    L++H  +HTG K ++C +C +GF     +K H   H  VK F C  C  +FT   ++  H+   H +    +   +     E        +K   R + + S      S + + E       E    E H     + +S  +    + E   +L   +  +   +SE V  +     + ++ E+   Q       +    C +C K ++K  DL RH+RIHT +KP++C  C KSF +KS L  H K+H   K FSC +C+  F+ K +LKVH +LH   K  F C  C+ RF T      H+++HY          PDP
Sbjct:  969 CDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCSVCNASFTTNGSLTRHM-ATHMS----MKPYKCPFCEEGFRTTVHCKKHMKRHQTVPSAV----SATGETEGGDICMEEE---EEHSDRNASRKSRPEVITFTEEETAQLAKIRPQESATVSEKV-LVQSAAEKDRISELRDKQAELQDEPKHANCCTYCPKSFKKPSDLVRHVRIHTGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAK-PFKCPHCELRFRTSGRRKTHMQFHY---------KPDP 1278          

HSP 3 Score: 122.479 bits (306), Expect = 2.322e-26
Identity = 91/327 (27.83%), Postives = 142/327 (43.43%), Query Frame = 1
Query: 1771 ERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLN----QPIPIAEIDKRKLSNNRLFK----------------------CNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            E +D +    Q  E  +DQ    R +RC +C K ++KS  L +H+R HT +KP++C +C + F    VLK+H K+H  +K FSC +CN  F    +L  H   H   K  + C  C+  F T  H + H     H+++  P                + E   +   A+  + P+V      E       +P   A + ++ L  +   K                      C +C KS+K    L  H++ H +      C  C KSF    ++  H++T H  ++ FSC  C   F TK SL  H  +H+ +KP+ CP C  RF+
Sbjct:  944 EELDLQAQGSQFLEDNEDQSR--RSYRCDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCSVCNASFTTNGSLTRHMATHMSMK-PYKCPFCEEGFRTTVHCKKHM--KRHQTV--PSAVSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQESATVSEKVLVQSAAEKDRISELRDKQAELQDEPKHANCCTYCPKSFKKPSDLVRHVRIH-TGEKPYKCDECGKSFTVKSTLDCHVKT-HTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCELRFR 1261          

HSP 4 Score: 98.9821 bits (245), Expect = 3.211e-19
Identity = 85/317 (26.81%), Postives = 136/317 (42.90%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKK------------IASLAETNQSPSDDAEITQYLWNENPTNENHFSY----------QPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH---EPDKLR 2100
            C +CG+ F +  +L+ HE THTG+K F C +C   FT   S+  HM  H ++K + C FC + F    +   H+K  H+     +S + E    +   +EEE+  D N  +K             A LA+    P + A +++ +  ++   ++  S           +P H +N  +Y P  ++F K              D+ R       +++H       TG + ++C  C K +     L  H++ HT QK F C++C  +F  K  LK H + H   K F C  C   F      K H Q H   +P K R
Sbjct:  997 CKLCGRGFVSSGVLKSHEKTHTGVKAFSCSVCNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTTVHCKKHMKR-HQTVPSAVSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIR--PQESATVSEKVLVQSAAEKDRISELRDKQAELQDEPKH-ANCCTYCP--KSFKK------------PSDLVR------HVRIH-------TGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCELRFRTSGRRKTHMQFHYKPDPKKAR 1282          

HSP 5 Score: 94.7449 bits (234), Expect = 6.246e-18
Identity = 42/109 (38.53%), Postives = 62/109 (56.88%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            R ++C +C++ Y+KSC L +HIR HT +KPF+C  C + F    VLK H ++H  LK F C ICN  F    +L+ H  +H  D   ++C  C + F T  + + H  T
Sbjct:  655 RPYKCFYCHRAYKKSCHLKQHIRSHTGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLICNGAFTTGGSLRRHMGIHN-DLRPYMCPYCQKTFKTSLNCKKHMKT 762          

HSP 6 Score: 82.0333 bits (201), Expect = 4.433e-14
Identity = 36/110 (32.73%), Postives = 60/110 (54.55%), Query Frame = 1
Query: 2371 NNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            + R ++C++C K +K   +L +H++ H +      C+ C + FV+   ++ H +T H   + FSC  C A F T  SL RH   H + KPY CP C   F+  ++C +H+
Sbjct:  963 SRRSYRCDYCNKGFKKSSHLKQHVRSH-TGEKPYKCKLCGRGFVSSGVLKSHEKT-HTGVKAFSCSVCNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTTVHCKKHM 1070          

HSP 7 Score: 72.7886 bits (177), Expect = 3.390e-11
Identity = 32/78 (41.03%), Postives = 44/78 (56.41%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH 1458
            C  C KAF  P  L RH   HTG + F C +C+K F QKS++++HM  H   + + C +C   FT + NM  H+K  H
Sbjct: 1724 CDTCEKAFAKPSQLERHSRIHTGERPFHCTLCEKAFNQKSALQVHMKKHTGERPYKCAYCVMGFTQKSNMKLHMKRAH 1801          

HSP 8 Score: 72.4034 bits (176), Expect = 3.847e-11
Identity = 45/151 (29.80%), Postives = 70/151 (46.36%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHE-NDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKH 957
            CEIC + FP +  + +HM  HE ND+  +C  C  ++N E NL +H    H+ E           +  C +C+  FSR  + +AH ++H+ +E L C  C   F  +  L  H+ +H+           T    CK C   FE    +K+H
Sbjct:   39 CEICLLSFPKESQFQRHMRDHERNDKPHRCDQCPQTFNVEFNLTLH-KCTHSGE-----------DPTCPVCNKKFSRVASLKAHIMLHEKEENLICSECGDEFTLQSQLAVHMEEHR------QELAGTRQHACKACKKEFETSSELKEH 171          

HSP 9 Score: 69.707 bits (169), Expect = 2.785e-10
Identity = 31/77 (40.26%), Postives = 42/77 (54.55%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVH 2070
            R F+C  C K + K   L RH RIHT ++PF C +C K+F  KS L+ H K H   + + C  C   F  K  +K+H
Sbjct: 1720 RVFKCDTCEKAFAKPSQLERHSRIHTGERPFHCTLCEKAFNQKSALQVHMKKHTGERPYKCAYCVMGFTQKSNMKLH 1796          

HSP 10 Score: 69.3218 bits (168), Expect = 3.804e-10
Identity = 28/76 (36.84%), Postives = 46/76 (60.53%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            C+ CG+ F +  +L+ H  THTG+K F+C IC   FT   S++ HM +H++++ ++C +C K F    N   H+K 
Sbjct:  687 CSQCGRGFVSAGVLKAHIRTHTGLKSFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHMKT 762          

HSP 11 Score: 64.6994 bits (156), Expect = 8.954e-9
Identity = 34/111 (30.63%), Postives = 59/111 (53.15%), Query Frame = 1
Query: 3553 YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            +H C  C  +F+    LV H++  H   + F C  C +AF+ K +L AH KTH   ++F C  C+   + F +  SL  H+R+  +  +  + C HC+K ++T+    +H+
Sbjct:  481 WHVCPYCAKEFRKPSDLVRHIRI-HTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCM---KSFSTSGSLKVHIRL--HTGVRPFACPHCDKKFRTSGHRKTHI 585          

HSP 12 Score: 64.6994 bits (156), Expect = 9.741e-9
Identity = 39/109 (35.78%), Postives = 57/109 (52.29%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C   +K S  L +H++S H   + F C+ C + F +   L AH +TH   +SF C +   CN  F +  SL RH+ + HND L  Y C +C K +KT+     H+K
Sbjct:  659 CFYCHRAYKKSCHLKQHIRS-HTGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLI---CNGAFTTGGSLRRHMGI-HND-LRPYMCPYCQKTFKTSLNCKKHMK 761          

HSP 13 Score: 62.7734 bits (151), Expect = 3.088e-8
Identity = 36/110 (32.73%), Postives = 58/110 (52.73%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            C  C+  FK S  L +HV+S H   + + C +C + F +   L +H KTH   ++F C V   CN  F +  SL+RH  M  + ++  Y+C  C + ++TT     H+K+
Sbjct:  969 CDYCNKGFKKSSHLKQHVRS-HTGEKPYKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCSV---CNASFTTNGSLTRH--MATHMSMKPYKCPFCEEGFRTTVHCKKHMKR 1072          

HSP 14 Score: 61.2326 bits (147), Expect = 1.030e-7
Identity = 37/125 (29.60%), Postives = 60/125 (48.00%), Query Frame = 1
Query: 1825 QVTGFRRFR-CRFCYKLYRKSCDLTRHIRIH------TQQKP--FQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            +V G  R   C  C K ++++  L  H++ H      + QKP  F+C  C K+F   S L+ H + H   + F C +C K FN K  L+VH + H  ++  + C  C   F    +++ H   +H
Sbjct: 1678 EVHGRERIHGCPVCRKAFKRATHLKEHMQTHQAGPSLSSQKPRVFKCDTCEKAFAKPSQLERHSRIHTGERPFHCTLCEKAFNQKSALQVHMKKHTGER-PYKCAYCVMGFTQKSNMKLHMKRAH 1801          

HSP 15 Score: 58.151 bits (139), Expect = 8.454e-7
Identity = 29/85 (34.12%), Postives = 43/85 (50.59%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIF----NLKQTLKVHR 2073
            TG + F+C  C + +  +  L  HIR HT  K F+C +C+ +F     L+ H   H  L+ + C  C K F    N K+ +K HR
Sbjct:  680 TGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHR 764          

HSP 16 Score: 57.7658 bits (138), Expect = 1.164e-6
Identity = 65/253 (25.69%), Postives = 96/253 (37.94%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSV----HCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKP---IKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQL---IQYNCAQCNIMFAQESSYVNHQKSVH 4965
            P+ C  C + FN   NL  H   H+   P  CP C K+F    SLK H          +         L+SQ+A+  H++ H +E +      CK C K F+   +L  H+   +    S           +G   S P     +  +  QKP    + +     ++  KC  C   FN K     H  +    EK H    C   F        HVQ VH+++     YNC +C+ +F    S   H   +H
Sbjct:   65 PHRCDQCPQTFNVEFNLTLHKCTHSGEDPT-CPVCNKKFSRVASLKAHIMLHEKEENLICSECGDEFTLQSQLAV--HMEEHRQELAGTRQHACKACKKEFETSSELKEHMKTHYKIRVSSTRSYNRNIDRSGFTYSCP-----HCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHM-IKHTGEKPHACAFCPAAFSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKMH 308          

HSP 17 Score: 57.3806 bits (137), Expect = 1.474e-6
Identity = 33/109 (30.28%), Postives = 54/109 (49.54%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C   FK    LV HV+  H   + + C+ C K+F+ K +L  H KTH   + F C V   C+  F +  SL  H+R+  +     ++C HC   ++T+    +H++
Sbjct: 1169 CTYCPKSFKKPSDLVRHVRI-HTGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHV---CSNAFSTKGSLKVHMRL--HTGAKPFKCPHCELRFRTSGRRKTHMQ 1271          

HSP 18 Score: 57.3806 bits (137), Expect = 1.617e-6
Identity = 36/117 (30.77%), Postives = 48/117 (41.03%), Query Frame = 1
Query: 3556 HGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTH-----IDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            H C  CD  F  +  L+ H K  H   R   C VC KAF     L  H +TH     + S+    F C  C + F     L RH R+   +    + CT C K +     L  H+K+
Sbjct: 1657 HQCLECDRAFSSAAVLMHHSKEVHGRERIHGCPVCRKAFKRATHLKEHMQTHQAGPSLSSQKPRVFKCDTCEKAFAKPSQLERHSRIHTGE--RPFHCTLCEKAFNQKSALQVHMKK 1771          

HSP 19 Score: 57.3806 bits (137), Expect = 1.630e-6
Identity = 69/257 (26.85%), Postives = 109/257 (42.41%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIP---EIPKKLIK-------CLSCSFIFNTKAKYD-----NHFCVGLKAEKSHLNRC--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            Y C  C+KGF ++S+L+QH+  HT  +PY+C  C + F     LK+HE T H+ V K   C +C     +  +L  H+  H+      C  C +GF       +H+ ++H    S +     G    G++        H      +K   EVI    E   +L K        +S   +  + A+ D           L+ E  H N C  C K+F+  S  + HV+ +H     Y C +C   F  +S+   H K+
Sbjct:  967 YRCDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRGFVSSGVLKSHEKT-HTGV-KAFSCSVCNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTTVHCKKHM-KRHQTVPSAVSAT--GETEGGDI-CMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQESATVSEKVLVQSAAEKDRISELRDKQAELQDEPKHANCCTYCPKSFKKPSDLVRHVR-IHTGEKPYKCDECGKSFTVKSTLDCHVKT 1216          
BLAST of Zinc finger, C2H2 type vs. UniProt/SwissProt
Match: sp|Q05481|ZNF91_HUMAN (Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2)

HSP 1 Score: 175.637 bits (444), Expect = 9.255e-43
Identity = 179/753 (23.77%), Postives = 281/753 (37.32%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNE----CTVVNDSNQEMN--------------YKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKN----GTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            CE C   F    T  KH  IH  ++ +KC  C  +++    L  H  I HT E    C   + + + ++              YKC  C   F+R      H  IH  ++   CE C   F     L KH   H                KCK C   F     + +H             I  G      E       +     K K      +  K    G++    +  + ++ I  R +P K           C  CGKAFK    L  H++ H G K ++C  C K F   SS+  H ++H   K + C+ CGKAF +   +  H K IH        E   ++  H    +        + P + K+    A +N S   + +IT            H   +P      D          K     + + +   E+  +    +  + +H+ I    TG + ++C  C K +  S  LT+H RIHT++KPF+C  C K+F   S L  H + H   K + CE C K F+   TL  H+ +H  +K  + CK C + F     L  H        +   +          + +  +    K KP   S +    K  IW+  L +        KR  +  + +KC  CGK++    +L  H + H +      C+ C K+F    ++  H +  H   + + C +C   F   ++L  H ++H+  KPY C  C + F       RH 
Sbjct:  324 CEECGKAFSRSSTLAKHKRIHTGEKPYKCKECGKAFSNSSTLANH-KITHTEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFH----------TREKPFKCKECGKAFIWSSTLTRHKR-----------IHTGEKPYKCEECGKAFRQSSTLTKHKIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHSREKPYK-----------CKECGKAFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTHKIIHTGEKSYKCEECGKAFLWSSTLRRH-KRIHTGEKPYKCEECGKAFSHSSALAKHKRIHTGEKPYKCKECGK-AFSNSSTLANHKIT------------HTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIH---TGEKPYKCEECGKAFNWSSSLTKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIHTGEKP-YKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKP---SKSEECDKAFIWSSTLTE-------HKRIHTREKTYKCEECGKAFSQPSHLTTHKRMH-TGEKPYKCEECGKAFSQSSTLTTH-KIIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHT 1013          

HSP 2 Score: 152.525 bits (384), Expect = 1.092e-35
Identity = 175/721 (24.27%), Postives = 273/721 (37.86%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            CE C   F    T  +H  IH  ++ +KC  C  ++++   L  H   IHT E            YKC  C   FSR      H  IH  ++   C+ C   F     L  H   H                KCK C   F+ +  + KH +           I  G  +   E               K      +  K    G++         ++    R +P             C  CGKAF     L RH+  HTG K ++C  C K F Q S++  H ++H   K +  + CGKAF     +N H K+IH       S+ + +   E              FK+ ++L  T++      ++  Y   E     NH S    H+      I + E   K   ++  +  L S  + R          H+ I    TG + ++C  C K +  S  L +H RIHT +KP++C  C K+F   S L NH  +H + K + C+ C+K F    TL  H+ +H  +KL + C+ C + FN   +L        H+ I   +                      KP          K   W+  L +        KR  +  + FKC  CGK++ +   L  H + H +      C+ C K+F    ++ +H +T H   + + C +C   F   ++L +H ++H+  K Y C  C + F
Sbjct:  268 CEECGKAFLWSSTLTRHKRIHTGEKPYKCEECGKAFSHSSTLAKH-KRIHTGE----------KPYKCEECGKAFSRSSTLAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITH----------TEEKPYKCKECDKAFKRLSTLTKHKI-----------IHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFHTREKP-----------FKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLTKHKIIHTGEKPYKFEECGKAFRQSLTLNKH-KIIH-------SREKPYKCKECGKA----------FKQFSTLT-THKIIHAGKKL--YKCEECGKAFNHSSSLSTHK-----IIHTGEKSYKC--EECGKAFLWSSTLRR----------HKRIH---TGEKPYKCEECGKAFSHSSALAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKL-YKCEECGKAFNRSSNLTI------HKFIHTGE----------------------KPYKCEECG---KAFNWSSSLTK-------HKRIHTREKPFKCKECGKAFIWSSTLTRHKRIH-TGEKPYKCEECGKAFSRSSTLTKH-KTIHTGEKPYKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAF 863          

HSP 3 Score: 139.813 bits (351), Expect = 9.666e-32
Identity = 168/756 (22.22%), Postives = 284/756 (37.57%), Query Frame = 1
Query:  469 TVYKTIN-GTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAV-----------------CGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQ-YLWNENPTNEN--HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            T++K I+ G     CE C   F    +  KH   H  ++ FKC  C  ++ +   L  H   IHT E            YKC  C   F +      H +IH  ++    E C   F+  + L+KH   H                KCK C   F+    +  H +           I  G  +   E            +  K      ++ K    G++ L       ++ I    +P K +      + + A+                 CGKAF     L  H++THT  K ++C  C K F + S++  H ++H   K + C+ CGKAF    N+  H K IH        +      N S+           + K+I     T + P    E  + ++W+   T     H   +P            +    K     + +     ++  +  K +  +  H++I     G + ++C  C K + +S +LT H  IHT++KP +   C K+F   S L  H + H + K + CE C K F+    L  H+++H  +K  + C+ C + F+    L  H        I +    P++         +     ++K       P   +     +  +Q   +     R  +  + +KC  CGK++     L  H   H +      C+ C K+F++  ++  H R  H   + + C +C   F   ++L RH  +H+  KPY C  C + FK
Sbjct:  422 TIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFHTREKPFKCKECGKAFIWSSTLTRH-KRIHTGE----------KPYKCEECGKAFRQSSTLTKHKIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHS----------REKPYKCKECGKAFKQFSTLTTHKI-----------IHAGKKLYKCEECGKAFNHSSSLSTHKIIHTGEKSYKCEECGKAFLWSSTLRRHKRIHTGEKPYKCEECGKAFSHSSALAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIH-KFIHTGEKPYKCEECGKAFNWSSSL--------TKHKRI----HTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALAKHKIIH---AGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKP-YKCEECGKAFSQSSTLTTH-------KIIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEEC--GKAFSQSSTLTR-HTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIH-TGEKPYKCEECGKAFISSSTLNGHKRI-HTREKPYKCEECGKAFSQSSTLTRHKRLHTGEKPYKCGECGKAFK 1116          

HSP 4 Score: 135.576 bits (340), Expect = 2.061e-30
Identity = 177/774 (22.87%), Postives = 281/774 (36.30%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNE----CTVVNDS--------------NQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGE------ECDD---RKLTTNY----------LKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQE--HLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYL-WNENPTNEN--HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            C+ C+  F    T  KH  IH  ++ +KC  C  ++N   NL +H   IHT E    C     +               +E  +KC  C   F        H  IH  ++   CE C   F+    L KH   H  GE      EC     + LT N            KCK C   F+    +  H +           I  G  +   E            +  K      ++ K    G++ L       ++ I    +P K           C  CGKAF     L +H+  HTG K ++C  C K F+  S++  H + H   K + C+ C K F     +  H K+IH    E L + +E     N S++              I     T + P    E  +   W+ + T     H   +P            +    +     + +     E+  +    +  +  H+ I    TG + ++C+ C K ++ S  L +H  IH  +K ++C  C K+F   S L  H   H K K    E C+K F    TL  H+++H  +K  + C+ C + F+   HL     T+H R      P   +             + K   T         KP    E        + + + K+  +  + +KC  CGK++     L  H + H +      C+ C K+F     +  H +  H   + + C +C   FI+ ++L  H  +H+  KPY C  C + F       RH
Sbjct:  380 CKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIH-KFIHTGEKPYKCEECGKAFNWSSSLTKHKRFHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLTKHKIIH-TGEKPYKFEECGKAFRQSLTLNKHKIIHSREKPYKCKECGKAFKQFSTLTTHKI-----------IHAGKKLYKCEECGKAFNHSSSLSTHKIIHTGEKSYKCEECGKAFLWSSTLRRHKRIHTGEKPYK-----------CEECGKAFSHSSALAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKH-KIIHAG--EKLYKCEECGKAFNRSSNLT------------IHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIH---TGEKPYKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHKRIHTREKT-YKCEECGKAFSQPSHL-----TTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGE-------KPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMH-TGEKPYKCEECGKAFNRSSKLTTH-KIIHTGEKPYKCEECGKAFISSSTLNGHKRIHTREKPYKCEECGKAFSQSSTLTRH 1096          

HSP 5 Score: 105.916 bits (263), Expect = 2.176e-21
Identity = 128/530 (24.15%), Postives = 205/530 (38.68%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYL---WNENP--TNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH 2082
            C+ C+  F    T  KH  IH  ++ +KC  C  ++N   NL +H   IHT E            YKC  C   F+   +   H  IH  ++   C+ C   F     L +H   H  GE+           KC+ C   F     + KH             I  G      +      +      K K      +  K    G++         ++ I  + +P K++            C KAF     L  H+  HT  K ++C  C K F+Q S +  H  +H   K + C+ CGKAF+    + TH K+IH        +       +S+   E   K  +  +K     E  ++ S  + +T++      E P    E   ++  + +  T   I + E   K +  +  +  + S  +       G  ++H       T  + ++C  C K + +S  LTRH R+HT +KP++C  C K+F+  S L  H   H   K + CE C K FN    L  H+++H
Sbjct:  688 CKECDKTFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIH-KFIHTGE----------KPYKCEECGKAFNWSSSLTKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIH-TGEK---------PYKCEECGKAFSRSSTLTKHKT-----------IHTGEKPYKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEE-----------CDKAFIWSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTH-KIIHTGEKPYKCEECGKAFRKSSTLTE--HKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIHTGEKPYKCE--ECGKAFISSSTL------NGHKRIH-------TREKPYKCEECGKAFSQSSTLTRHKRLHTGEKPYKCGECGKAFKESSALTKHKIIHTGEKPYKCEKCGKAFNQSSILTNHKKIH 1156          

HSP 6 Score: 104.76 bits (260), Expect = 4.949e-21
Identity = 82/308 (26.62%), Postives = 131/308 (42.53%), Query Frame = 1
Query: 1762 EDVERIDKETGQIQLHEMI--KDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            E+  +  K+   +  H++I  K+++     ++C  C K +  S  LTRH RIHT +KP++C  C K+F   S L  H + H   K + CE C K F+   TL  H+++H  +K  + CK C + F+    L  H  T                                          + KP    E       ++ + K K+  +  +L+KC  CGK++     L  H   H +      C+ C K+F    S+ +H R  H   + F C +C   FI  ++L RH  +H+  KPY C  C + F+
Sbjct:  241 EECGKAFKQLSTLTTHKIICAKEKI-----YKCEECGKAFLWSSTLTRHKRIHTGEKPYKCEECGKAFSHSSTLAKHKRIHTGEKPYKCEECGKAFSRSSTLAKHKRIHTGEKP-YKCKECGKAFSNSSTLANHKITH----------------------------------------TEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIH-TGEKPYKCEECGKAFNWSSSLTKHKRF-HTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFR 500          

HSP 7 Score: 99.3673 bits (246), Expect = 2.276e-19
Identity = 76/281 (27.05%), Postives = 123/281 (43.77%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            TG + ++C  C K + +S  L +H RIHT +KP++C  C K+F   S L NH  +H + K + C+ C+K F    TL  H+ +H  +KL + C+ C + FN   +L        H+ I   +                      KP          K   W+  L +        KR  +  + FKC  CGK++ +   L  H + H +      C+ C K+F    ++ +H +  H   + +   +C   F    +L +H ++HS  KPY C  C + FK
Sbjct:  317 TGEKPYKCEECGKAFSRSSTLAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKL-YKCEECGKAFNRSSNLTI------HKFIHTGE----------------------KPYKCEECG---KAFNWSSSLTK-------HKRFHTREKPFKCKECGKAFIWSSTLTRHKRIH-TGEKPYKCEECGKAFRQSSTLTKH-KIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHSREKPYKCKECGKAFK 556          

HSP 8 Score: 92.0485 bits (227), Expect = 3.359e-17
Identity = 76/321 (23.68%), Postives = 133/321 (41.43%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGT-------EVLSQSQE---HLLNESNXXXXXXQKDPNRFKKIASLA-----ETNQSPSDDAEITQYLWNENPTNEN---HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFN 2133
            C  CGKAFK    L +H++ H G K ++C  C K F Q S++  H ++H   K    + C KAF +   +  H ++  +  T       +  SQ      H    + +   + ++    F + ++L       T + P    E  +     +   E+   H   +P            +    +     + +     E+  +    + ++  H++I    TG + ++C  C K +  S  L  H RIHT++KP++C  C K+F   S L  H + H   K + C  C K F     L  H+ +H  +K  + C+ C + FN
Sbjct:  828 CKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIH---TGEKPYKCEECGKAFISSSTLNGHKRIHTREKPYKCEECGKAFSQSSTLTRHKRLHTGEKPYKCGECGKAFKESSALTKHKIIHTGEKP-YKCEKCGKAFN 1144          

HSP 9 Score: 70.8626 bits (172), Expect = 1.120e-10
Identity = 65/271 (23.99%), Postives = 114/271 (42.07%), Query Frame = 1
Query: 1858 FCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            FC +L++     T+H  ++  +K  +C  C K+F   S L NH + H + K + CE C K F    TL  H+ +   +K+ + C+ C + F     L     T H R      P  ++               K+K       P   +     +  ++   +A+  KR  +  + +KC  CGK++     L  H   H +      C+ C+K+F    ++ +H +  H   + + C +C   F   ++L  H  +H+  KPY C  C + F
Sbjct:  191 FCIRLHK-----TQHKCVYITEKSCKCKECEKTFHWSSTLTNHKEIHTEDKPYKCEECGKAFKQLSTLTTHKIICAKEKI-YKCEECGKAF-----LWSSTLTRHKRIHTGEKP--YKCEECGKAFSHSSTLAKHKRIHTGEKPYKCEEC--GKAFSRSSTLAK-HKRIHTGEKPYKCKECGKAFSNSSTLANHKITH-TEEKPYKCKECDKAFKRLSTLTKH-KIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAF 443          

HSP 10 Score: 68.9366 bits (167), Expect = 4.367e-10
Identity = 66/246 (26.83%), Postives = 95/246 (38.62%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQV---ALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            Y C  C K FNR+SNL  H  +HT  +PY+C +C K F    SL     TKH  +    +   C +  ++ +    L  H ++H  E    C+ C K F     L++    H  EK      C +        A                      K  I    +KL KC  C   FN  +    H  +  K EK   +  CDK F  +S    H + +H +   Y C +C   F+Q S    H++
Sbjct:  714 YKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSL-----TKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALA----------------------KHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTK-EKPSKSEECDKAFIWSSTLTEH-KRIHTREKTYKCEECGKAFSQPSHLTTHKR 930          

HSP 11 Score: 62.003 bits (149), Expect = 5.301e-8
Identity = 72/304 (23.68%), Postives = 110/304 (36.18%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEAT-----------------KHSSVTXXXXXXXXXXXXXSQ---------VALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPE------------GRKP------AGELSSTPTXXXXXXXXXXXKPIK----------------EVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY C  C K F+R+S L +H ++HT  +PY+C +C K F+H  +L  H+                   + S++T     H   K  +S+           L  H ++H RE +  C+ C K F     L+     H  EK      C +   +            G KP            + T   H      +KP K                       +K  KC  C   FN  +K   H  +    EK +    C K F S+S    H + +H +   Y C +C   F+Q S+   H++
Sbjct:  797 PYKCEECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIHT-GEKPYKCEECGKAFISSSTLNGH-KRIHTREKPYKCEECGKAFSQSSTLTRHKR 1098          

HSP 12 Score: 60.4622 bits (145), Expect = 1.498e-7
Identity = 68/264 (25.76%), Postives = 100/264 (37.88%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQV---ALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP------AGELSSTPTXXXXXXXXXXXKPIK----------------EVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            Y C  C K FNR+SNL  H  +HT  +PY+C +C K F    SL     TKH       +   C +  ++ +    L  H ++H  E    C+ C K F     L++H            + +  G KP            + T + H     ++KP K                  I    KKL KC  C   FN  +    H  +    EKS+    C K F  +S    H + +H     Y C +C   F+  S+   H++
Sbjct:  406 YKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSL-----TKHKRFHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLTKH------------KIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHSREKPYKCKECGKAFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTHKIIHT-GEKSYKCEECGKAFLWSSTLRRH-KRIHTGEKPYKCEECGKAFSHSSALAKHKR 650          

HSP 13 Score: 60.077 bits (144), Expect = 2.286e-7
Identity = 49/218 (22.48%), Postives = 82/218 (37.61%), Query Frame = 1
Query: 2020 CEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            C+ C K F+   TL  H+++H  DK  + C+ C + F     L  H        I   +                                  K  +W+  L +        KR  +  + +KC  CGK++     L +H + H +      C+ C K+F    ++ +H R  H   + + C +C   F   ++L  H + H+  KPY C  C + FK
Sbjct:  212 CKECEKTFHWSSTLTNHKEIHTEDKP-YKCEECGKAFKQLSTLTTHKIICAKEKIYKCEECG-------------------------------KAFLWSSTLTR-------HKRIHTGEKPYKCEECGKAFSHSSTLAKHKRIH-TGEKPYKCEECGKAFSRSSTLAKHKRI-HTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKAFK 388          

HSP 14 Score: 59.3066 bits (142), Expect = 3.826e-7
Identity = 65/262 (24.81%), Postives = 97/262 (37.02%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP------AGELSSTPTXXXXXXXXXXXKP----------------IKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY C  C K F + S L  H  +H   + Y+C +C K F H  SL TH+   H+              L S   LR H ++H  E    C+ C K F     L++H            + +  G KP          S++ T  +H     ++KP                 K  I    +KL KC  C   FN  +    H  +    EK +    C K F  +S    H + +H +   + C +C   F   S+   H++
Sbjct:  545 PYKCKECGKAFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTHKII-HTGEKSYKCEECGKAFLWSST-LRRHKRIHTGEKPYKCEECGKAFSHSSALAKH------------KRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHT-GEKPYKCEECGKAFNWSSSLTKH-KRIHTREKPFKCKECGKAFIWSSTLTRHKR 790          

HSP 15 Score: 58.5362 bits (140), Expect = 5.502e-7
Identity = 62/244 (25.41%), Postives = 93/244 (38.11%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY C  C K F+++S L  H  +HT  +PY+C +C K FR   +L  H+   H+               +S    R H ++H  E    C+ C K F+    L+     H  EK      C +             S+ T + H     ++KP             KC  C   F+  +    H  +    EK +    C K F+ +S    H + +H     Y C +C   F Q S   NH+K
Sbjct:  937 PYKCEECGKAFSQSSTLTTHKIIHTGEKPYKCEECGKAFRKSSTLTEHKII-HTGEKPYKCEECGKAFSQSSTLTR-HTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIHTGEKPYKCEECGKAFI----------SSSTLNGHKRIHTREKP------------YKCEECGKAFSQSSTLTRHKRLHT-GEKPYKCGECGKAFKESSALTKH-KIIHTGEKPYKCEKCGKAFNQSSILTNHKK 1154          

HSP 16 Score: 57.3806 bits (137), Expect = 1.466e-6
Identity = 62/254 (24.41%), Postives = 89/254 (35.04%), Query Frame = 1
Query: 4207 TPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLS----RHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            T  I C     Y C  C K F  +S L +H  +HT  +PY+C +C K F H  +L  H+                     S +A   H ++H  E    CK C K F     L+     H +EK      C +           LS+                 K  I    +KL KC  C   FN  +    H  +    EK +    C K F  +S    H +  H +   + C +C   F   S+   H++
Sbjct:  255 THKIICAKEKIYKCEECGKAFLWSSTLTRHKRIHTGEKPYKCEECGKAFSHSSTLAKHKRIHTGEKPYKCEECGKAFSRSSTLA--KHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKAFK-------RLSTL---------------TKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHT-GEKPYKCEECGKAFNWSSSLTKH-KRFHTREKPFKCKECGKAFIWSSTLTRHKR 482          
BLAST of Zinc finger, C2H2 type vs. UniProt/SwissProt
Match: sp|Q9Y3M9|ZN337_HUMAN (Zinc finger protein 337 OS=Homo sapiens OX=9606 GN=ZNF337 PE=1 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 1.005e-37
Identity = 134/520 (25.77%), Postives = 222/520 (42.69%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVER---------------------IDKETGQ--IQLHEMIKDQVTGF--RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHL-RYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C+VCG+ F     L RH+ TH+G K F C +C +G+T KS + +H   H   K + CQ CG+ F  + + N H+K        V  +      N+S        K  +  +K     E  +  S+ + +  +      + E  F+ +   QS          + ++     S +   + +D ER                     + +E GQ  IQ   ++K Q+T    + F C+ C + + +    T H R H+++KP+ C  C + FR KS    H ++H   K F C  C + F LK  L +H++ H  +K  F+CK C++ F+   +L R+ ++ S  R     D               +   LK+    +       KP I +E     I  + + K +L  S  + F C  CG+ + +K  L  H + H S     VC  C + F   RS+ +H    H   + F C +C   + +K+ L  H  +H+  +PY C  C R+F  K Y  +H+
Sbjct:  238 CSVCGRGFSLKANLLRHQRTHSGEKPFLCKVCGRGYTSKSYLTVHERTHTGEKPYECQECGRRFNDKSSYNKHLKAHSGEKPFVCKECGRGYTNKS---YFVVHKRIHSGEKPYRCQECGRGFSNKSHLITH--QRTHSGEKPFACRQCKQS-----FSVKGSLLRHQRTHSGEKPFVCKDCERSFSQKSTLVYHQRTHSGEKPFVCRECGQGFIQKSTLVKHQITHSEEKPFVCKDCGRGFIQKSTFTLHQRTHSEEKPYGCRECGRRFRDKSSYNKHLRAHLGEKRFFCRDCGRGFTLKPNLTIHQRTHSGEKP-FMCKQCEKSFSLKANLLRHQWTHSGERPFNCKD-------------CGRGFILKSTLLFHQKTHSGEKPFICSECGQGFIWKSNLVKHQLAHSGKQPFVCKECGRGFNWKGNLLTHQRTH-SGEKPFVCNVCGQGFSWKRSLTRHHWRIHSKEKPFVCQECKRGYTSKSDLTVHERIHTGERPYECQECGRKFSNKSYYSKHL 732          

HSP 2 Score: 125.176 bits (313), Expect = 1.286e-27
Identity = 126/491 (25.66%), Postives = 197/491 (40.12%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVT--GFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDV--KPLIWNELLNQPI--PIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAK 2679
            C  C + F+    L  H+ THTG K + C +C +GF+ K+++  H   H   K FLC+ CG+ +T +  +  H +                    + +   E Q+   RF   +S  +  ++ S +            TN+++F       S    Y    +   +   +KSH                       +I  Q T  G + F CR C + +     L RH R H+ +KPF C  C +SF  KS L  H ++H   K F C  C + F  K TL  H+  H  +K  FVCK C R F     ++    T H R+ +   P         +   +     ++K + N +    +  K     +        P   I +R  S  + F C  C KS+  K  L  H   H      N C+ C + F+   ++  H +T H   + F C +C   FI K++L++H L HS  +P+ C  C R F  K
Sbjct:  210 CRECHQGFRDESALLLHQNTHTGEKSYVCSVCGRGFSLKANLLRHQRTHSGEKPFLCKVCGRGYTSKSYLTVHERT------------------HTGEKPYECQECGRRFNDKSSYNKHLKAHSGEKPFVCKECGRGYTNKSYFVVHKRIHSGEKPY--RCQECGRGFSNKSH-----------------------LITHQRTHSGEKPFACRQCKQSFSVKGSLLRHQRTHSGEKPFVCKDCERSFSQKSTLVYHQRTHSGEKPFVCRECGQGFIQKSTLVKHQITHSEEKP-FVCKDCGRGF-----IQKSTFTLHQRTHSEEKP---------YGCRECGRRFRDKSSYNKHLRAHLGEKRFFCRDCGRGFTLKPNLTIHQRTHSGEKPFMCKQCEKSFSLKANLLRHQWTHSGERPFN-CKDCGRGFILKSTLLFHQKT-HSGEKPFICSECGQGFIWKSNLVKHQLAHSGKQPFVCKECGRGFNWK 640          

HSP 3 Score: 99.3673 bits (246), Expect = 1.477e-19
Identity = 78/275 (28.36%), Postives = 123/275 (44.73%), Query Frame = 1
Query: 1846 FRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            F CR C++ +R    L  H   HT +K + C +C + F LK+ L  H ++H   K F C++C + +  K  L VH + H  +K  + C+ C RRFN     +  Y+  H ++ +   P   +     + +       K     +S   P           N+   I    +R  S  + F C  C +S+  K  L  H + H S     VC+ C +SF    ++  H RT H   + F C +C   FI K++L++H + HS  KP+ C  C R F
Sbjct:  208 FTCRECHQGFRDESALLLHQNTHTGEKSYVCSVCGRGFSLKANLLRHQRTHSGEKPFLCKVCGRGYTSKSYLTVHERTHTGEKP-YECQECGRRFND----KSSYN-KHLKAHSGEKPFVCKECGRGYTNKSYFVVHKR---IHSGEKPYRCQECGRGFSNKSHLITH--QRTHSGEKPFACRQCKQSFSVKGSLLRHQRTH-SGEKPFVCKDCERSFSQKSTLVYHQRT-HSGEKPFVCRECGQGFIQKSTLVKHQITHSEEKPFVCKDCGRGF 469          

HSP 4 Score: 98.9821 bits (245), Expect = 1.694e-19
Identity = 74/257 (28.79%), Postives = 115/257 (44.75%), Query Frame = 1
Query: 1900 HIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            H + H++QK F C  CH+ FR +S L  H  +H   K + C +C + F+LK  L  H++ H  +K  F+CK+C R + +  +L     T H R+     P   Q           +        A+S   P V         N+   +  + KR  S  + ++C  CG+ +  K +L  H + H S      C+ C +SF    S+ +H RT H   + F C  C   F  K++L+ H   HS  KP+ C  C + F
Sbjct:  198 HKKAHSRQKLFTCRECHQGFRDESALLLHQNTHTGEKSYVCSVCGRGFSLKANLLRHQRTHSGEKP-FLCKVCGRGYTSKSYL-----TVHERTHTGEKPYECQECGRRFNDKSSYNKHLK---AHSGEKPFVCKECGRGYTNKSYFV--VHKRIHSGEKPYRCQECGRGFSNKSHLITHQRTH-SGEKPFACRQCKQSFSVKGSLLRHQRT-HSGEKPFVCKDCERSFSQKSTLVYHQRTHSGEKPFVCRECGQGF 441          

HSP 5 Score: 98.2117 bits (243), Expect = 3.221e-19
Identity = 81/294 (27.55%), Postives = 124/294 (42.18%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEI--DKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA 2706
            TG + + C  C + +    +L RH R H+ +KPF C +C + +  KS L  H ++H   K + C+ C + FN K +   H + H  +K  FVCK C R +         Y   H R  +   P          Q   +  S K+    +       KP    +          +   +R  S  + F C  C +S+  K  L  H + H S     VC+ C + F+   ++ +H  T H   + F C  C   FI K++   H   HS  KPY C  C RRF+ K   ++H+ A
Sbjct:  231 TGEKSYVCSVCGRGFSLKANLLRHQRTHSGEKPFLCKVCGRGYTSKSYLTVHERTHTGEKPYECQECGRRFNDKSSYNKHLKAHSGEKP-FVCKECGRGYTN-----KSYFVVHKRIHSGEKP-------YRCQECGRGFSNKSHLITHQRTHSGEKPFACRQCKQSFSVKGSLLRHQRTHSGEKPFVCKDCERSFSQKSTLVYHQRTH-SGEKPFVCRECGQGFIQKSTLVKHQIT-HSEEKPFVCKDCGRGFIQKSTFTLHQRTHSEEKPYGCRECGRRFRDKSSYNKHLRA 509          

HSP 6 Score: 68.5514 bits (166), Expect = 4.148e-10
Identity = 66/267 (24.72%), Postives = 101/267 (37.83%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQ-YLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIK--LDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEF 2016
            C  CG+ F     L  H+ TH+G K F C  C+K F+ K+++  H   H   + F C+ CG+ F  +  +  H K        + S+  +  + +SN  +               LA + + P    E  + + W  N            HQ       P   N       W +S     L+    RI  +                 + F C+ C + Y    DLT H RIHT ++P++C  C + F  KS    H K H + K F
Sbjct:  518 CRDCGRGFTLKPNLTIHQRTHSGEKPFMCKQCEKSFSLKANLLRHQWTHSGERPFNCKDCGRGFILKSTLLFHQKTHSGEKPFICSECGQGFIWKSNLVKH-------------QLAHSGKQPFVCKECGRGFNWKGNLLT---------HQRTHSGEKPFVCNVCGQGFSWKRS-----LTRHHWRIHSKE----------------KPFVCQECKRGYTSKSDLTVHERIHTGERPYECQECGRKFSNKSYYSKHLKRHLREKRF 741          

HSP 7 Score: 59.3066 bits (142), Expect = 2.753e-7
Identity = 36/119 (30.25%), Postives = 56/119 (47.06%), Query Frame = 1
Query: 2350 IDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA 2706
            I K+  S  +LF C  C + ++ +  L  H   H +   + VC  C + F    ++ +H RT H   + F C  C   + +K+ L  H   H+  KPY C  C RRF  K   ++H+ A
Sbjct:  197 IHKKAHSRQKLFTCRECHQGFRDESALLLHQNTH-TGEKSYVCSVCGRGFSLKANLLRHQRT-HSGEKPFLCKVCGRGYTSKSYLTVHERTHTGEKPYECQECGRRFNDKSSYNKHLKA 313          
BLAST of Zinc finger, C2H2 type vs. UniProt/SwissProt
Match: sp|P08045|XFIN_XENLA (Zinc finger protein Xfin OS=Xenopus laevis OX=8355 PE=1 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.366e-34
Identity = 195/840 (23.21%), Postives = 301/840 (35.83%), Query Frame = 1
Query:  193 SFINNSNVFQTVEDDCGEIYYACIGANDNDINHQDQVLQLIPQNQISNYIIS--DKDYSNVTYVNESVINGTNYYDSQNTTYNQNKYQYDNLDPTVYKTINGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKP--------VERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDP----XXXXXXXXXXXXXXXXXXXKNKPTANSN----------NPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKP 2640
             FI NS++ +      GE  Y C   +   I   D V  L        +  S  DK ++  + +                     K+Q  +     YK         C  C  EF  +   + H  IH  +R +KC+ C  ++    +L+ H   +H N   + +       +KC  C   FS       H  +H  +++  C  C   F  K  L KH+  H  GE+           KC +C   F    ++ KH           W I  G    P         ER          + +R      CQ      +G  Q   +         ++  P             C  CGK+F     L +H+  HTG K + C  C K FT+ SS+  H   H   K + C  C K F    ++  H+ V +       +   E L+   N                  L  +   P    E  + ++++ P    H          T+   P  E       DKS      + D+ +       ++ H       TG R + C  C K + ++ DL +H R HT ++P+ C  C K F  +S L  H ++H   K + CE C K F     L  H+++H  +K  + C  CD+RF  G  L  H       S   P P        S         +  S +N P A S+          +P  V  +++ +  +   P A       +  R FKCN CGK +  +  L +H++ H +      C  C +SF+    + +H RT H   R + C  C   F+ K++L RH  VH N  P
Sbjct:  362 GFIQNSDLVKHFRTHTGERPYQCAECHKGFIQKSDLVKHLRTHTGEKPFKCSHCDKKFTERSALA--------------------KHQRTHTGEKPYK---------CSDCGKEFTQRSNLILHQRIHTGERPYKCTLCDRTFIQNSDLVKH-QKVHAN-LPLSDPHTANSPHKCSKCDLTFSHWSTFMKHSKLHSGEKKFQCAECKKGFTQKSDLVKHIRVH-TGEK---------PFKCLLCKKSFSQNSDLHKH-----------WRIHTGEKPFPCYTCDKSFTERSALIKHHRTHTGERPHKCSVCQ------KGFIQKSALTKHSRTHTGEKPYP-------------CTQCGKSFIQNSDLVKHQRIHTGEKPYHCTECNKRFTEGSSLVKHRRTHSGEKPYRCPQCEKTFIQSSDLVKHLVVHNGENPPAATAFHEILIRREN------------------LTRSEPDPYPCTECGK-VFHQRPALLKHLRTH-----KTEKRYPCNE------CDKS---FFQTSDLVK------HLRTH-------TGERPYHCPECNKGFIQNSDLVKHQRTHTGERPYTCSQCDKGFIQRSALTKHMRTHTGEKPYKCEQCQKCFIQNSDLVKHQRIHTGEKP-YHCPDCDKRFTEGSSLIKHQRI---HSRIKPYPCGVCGKSFSQSSNLLKHLKCHSEQNPPVALSSELGFVAETQTHPDPVDHIVYGDTASYISPEA-------AGERSFKCNDCGKCFAHRSVLIKHVRIH-TGERPYKCSQCTRSFIQKSDLVKHYRT-HTGERPYKCGLCERSFVEKSALSRHQRVHKNESP 1071          

HSP 2 Score: 144.821 bits (364), Expect = 3.235e-33
Identity = 142/531 (26.74%), Postives = 212/531 (39.92%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQV--TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDK---------------------------LRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKP----LIWNELLNQ----PIPIAEIDK------------RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C+ C K F     L +H  THTG + ++C  C KGF QKS +  H+  H   K F C  C K FT    +  H +          S   +     SN    +      R  K  +L +     + D    Q +    P ++ H +  P+  S  D        F+K    K H G    +  +  + + G  Q  +++K     TG + F+C  C K + ++ DL +H RIHT +KPF CY C KSF  +S L  H ++H   +   C +C K F  K  L  H + H  +K                             + C  C++RF  G  L       H R+ +   P  ++    E   +Q  + +K+    N  NPP        LI  E L +    P P  E  K            R     + + CN C KS+     L +HL+ H +      C  CNK F+    + +H RT H   R ++C QC   FI +++L +H   H+  KPY C  C + F
Sbjct:  356 CSHCNKGFIQNSDLVKHFRTHTGERPYQCAECHKGFIQKSDLVKHLRTHTGEKPFKCSHCDKKFTERSALAKHQRTHTGEKPYKCSDCGKEFTQRSNLILHQRIHTGERPYK-CTLCDRTFIQNSDLVKHQKVHANLPLSDPHTANSPHKCSKCDLTFSHWSTFMK--HSKLHSG---EKKFQCAECKKGFTQKSDLVKHIRVHTGEKPFKCLLCKKSFSQNSDLHKHWRIHTGEKPFPCYTCDKSFTERSALIKHHRTHTGERPHKCSVCQKGFIQKSALTKHSRTHTGEKPYPCTQCGKSFIQNSDLVKHQRIHTGEKPYHCTECNKRFTEGSSL-----VKHRRTHSGEKP--YRCPQCEKTFIQSSDLVKHLVVHNGENPPAATAFHEILIRRENLTRSEPDPYPCTECGKVFHQRPALLKHLRTHKTEKRYPCNECDKSFFQTSDLVKHLRTH-TGERPYHCPECNKGFIQNSDLVKHQRT-HTGERPYTCSQCDKGFIQRSALTKHMRTHTGEKPYKCEQCQKCF 871          

HSP 3 Score: 130.183 bits (326), Expect = 9.305e-29
Identity = 117/496 (23.59%), Postives = 197/496 (39.72%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIK--DQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSN---NPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            C  C K F     L +H  THTG + + C +C K F Q S +  H+  H   K + C  C K F     +  H +    +     S+      + S+      +     F+ + +L         D+ +       +P +  + +  P   S         ++F+      S +   L     +     G IQ  +++K     TG R ++C  C+K + +  DL +H+R HT +KPF+C  C K F  +S L  H ++H   K + C  C K F  +  L +H+++H  ++  + C +CDR F     L  H     H ++   DP                       TANS    +  D+    W+  +           +  S  + F+C  C K +  K  L +H++ H +      C  C KSF     + +H R  H   + F C  C   F  +++LI+H   H+  +P+ C +C + F  K    +H
Sbjct:  194 CLDCQKTFNQRSALTKHRRTHTGERPYRCSVCSKSFIQNSDLVKHLRTHTGEKPYECPLCVKRFAESSALMKHKRTHSTHRPFRCSECSRSFTHNSDLTAHMRKH--TEFRNVLNL---------DSVV-----GTDPLSSQNVASSPYSCSKCRKTFKRWKSFLNHQQTHSREKPYLCSHCNK-----GFIQNSDLVKHFRTHTGERPYQCAECHKGFIQKSDLVKHLRTHTGEKPFKCSHCDKKFTERSALAKHQRTHTGEKPYKCSDCGKEFTQRSNLILHQRIHTGERP-YKCTLCDRTFIQNSDLVKHQKV--HANLPLSDPH----------------------TANSPHKCSKCDLTFSHWSTFMKH--------SKLHSGEKKFQCAECKKGFTQKSDLVKHIRVH-TGEKPFKCLLCKKSFSQNSDLHKHWRI-HTGEKPFPCYTCDKSFTERSALIKHHRTHTGERPHKCSVCQKGFIQKSALTKH 633          

HSP 4 Score: 119.398 bits (298), Expect = 1.703e-25
Identity = 128/534 (23.97%), Postives = 225/534 (42.13%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIK--DQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLR--------FVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAK------KCSKKKRNRFQQNDLMTGIINRN 2778
            C+VC K+F     L +H  THTG K +ECP+C K F + S++  H   H   + F C  C ++FT+  ++  H+    +  TE       ++LN  +        DP   + +AS   +        +  +   N   T+     Y  +H +    +I   +N   +   ++H G       +  +   G IQ  +++K     TG + F+C  C K + +   L +H R HT +KP++C  C K F  +S L  H + H   + + C +C++ F     L  H+++H    L           C  CD  F+       H+ST    S  +      Q    +    Q+ + +K+        P   K L+  +  +Q   + +   R  +  + F C  C KS+  +  L +H + H +    + C  C K F+   ++ +H RT H   + + C QC   FI  + L++H  +H+  KPY C  C +RF       +H          +C + ++   Q +DL+  ++  N
Sbjct:  222 CSVCSKSFIQNSDLVKHLRTHTGEKPYECPLCVKRFAESSALMKHKRTHSTHRPFRCSECSRSFTHNSDLTAHM----RKHTEF-----RNVLNLDSVVGT----DPLSSQNVASSPYSCSKCRKTFKRWKSFLNHQQTHSREKPYLCSHCNK--GFI---QNSDLVKHFRTHTG---ERPYQCAECHKGFIQKSDLVKHLRTHTGEKPFKCSHCDKKFTERSALAKHQRTHTGEKPYKCSDCGKEFTQRSNLILHQRIHTGERPYKCTLCDRTFIQNSDLVKHQKVHANLPLSDPHTANSPHKCSKCDLTFS-------HWSTFMKHSKLHSGEKKFQCAECKKGFTQKSDLVKHIRVHTGEKP--FKCLLCKKSFSQNSDLHK-HWRIHTGEKPFPCYTCDKSFTERSALIKHHRTH-TGERPHKCSVCQKGFIQKSALTKHSRT-HTGEKPYPCTQCGKSFIQNSDLVKHQRIHTGEKPYHCTECNKRFTEGSSLVKHRRTHSGEKPYRCPQCEKTFIQSSDLVKHLVVHN 722          

HSP 5 Score: 102.834 bits (255), Expect = 1.971e-20
Identity = 136/584 (23.29%), Postives = 218/584 (37.33%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNE----CTVVNDS--------------NQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGE------ECDDRKLTTNYL-------------KCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMP-VKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERID-KETGQIQLHEMI----KDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRF 2130
            C  C   F  +   LKH+  H+ ++ + C+ C  S+    +L+ H+   HT E    C   N                  E  Y C  C   F ++ A   H   H  ++   CE C   F     L KH   H  GE      +CD R    + L              C +C   F    N+ KH ++CH + +    +   +  V   +  P P++                   +Y    S +    P+     S +                C  CGK F    +L +H   HTG + ++C  C + F QKS +  H   H   + + C  C ++F  +  ++ H +V HKN + VL+ + E    +      E + DPN       + +  +SP        ++ N         +Y P   S   SY P                IL  +   R    E G+   H  +        TG + + C+ C K + +S  L +H+RIHT +KP+ C  C KSF  KS L  H + H   K ++C +C K F  + ++  H + H  ++  + C  C + F
Sbjct:  752 CTECGKVFHQRPALLKHLRTHKTEKRYPCNECDKSFFQTSDLVKHLRT-HTGERPYHCPECNKGFIQNSDLVKHQRTHTGERPYTCSQCDKGFIQRSALTKHMRTHTGEKPYKCEQCQKCFIQNSDLVKHQRIH-TGEKPYHCPDCDKRFTEGSSLIKHQRIHSRIKPYPCGVCGKSFSQSSNLLKH-LKCHSEQNPPVALSSELGFVAETQTHPDPVDHI-----------------VYGDTASYIS---PEAAGERSFK----------------CNDCGKCFAHRSVLIKHVRIHTGERPYKCSQCTRSFIQKSDLVKHYRTHTGERPYKCGLCERSFVEKSALSRHQRV-HKNESPVLNSAME---QQQVTYWGESKDDPNSLVPQLHVIKEEESP--------HIVN---------AYSP--LSILQSYFPP---------------ILEPKGTPRYSCSECGKCFTHRSVFLKHWRMHTGEQPYTCKECGKSFSQSSALVKHVRIHTGEKPYPCSTCGKSFIQKSDLAKHQRIHTGEKPYTCTVCGKKFIDRSSVVKHSRTHTGERP-YKCNECTKGF 1257          

HSP 6 Score: 99.3673 bits (246), Expect = 2.139e-19
Identity = 81/304 (26.64%), Postives = 134/304 (44.08%), Query Frame = 1
Query: 1798 IQLHEMIKDQVT--GFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST-SHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYK-FKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            +Q  + IK Q T  G R ++C  C K + +   L  H R HT ++P+ C  C K+F  +S L  H ++H   + + C +C+K F     L  H + H  +K  + C +C +RF     L  H  T S HR     +       H    +    +  + +   N ++     PL    + + P                + C+ C K++K +K +LN H + H S     +C  CNK F+    + +H RT H   R + C +C   FI K+ L++H   H+  KP+ C  C ++F  +    +H
Sbjct:  146 VQRSDFIKHQRTHTGERPYQCVECQKKFTERSALVNHQRTHTGERPYTCLDCQKTFNQRSALTKHRRTHTGERPYRCSVCSKSFIQNSDLVKHLRTHTGEKP-YECPLCVKRFAESSALMKHKRTHSTHRPFRCSE-CSRSFTHNSDLTAHMRKHTEFRNVLNLDSVVGTDPLSSQNVASSP----------------YSCSKCRKTFKRWKSFLN-HQQTH-SREKPYLCSHCNKGFIQNSDLVKHFRT-HTGERPYQCAECHKGFIQKSDLVKHLRTHTGEKPFKCSHCDKKFTERSALAKH 428          

HSP 7 Score: 99.3673 bits (246), Expect = 2.270e-19
Identity = 77/284 (27.11%), Postives = 124/284 (43.66%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRF----NTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            TG R + C  C K + +   LT+H R HT ++P++C +C KSF   S L  H ++H   K + C +C K F     L  H++ H   +  F C  C R F    +   H+R H   +  R++ N D        +        +++ + P + S      K   W   LN         ++  S  + + C+HC K +     L +H + H +      C  C+K F+    + +HLRT H   + F C  C   F  +++L +H   H+  KPY C  C + F
Sbjct:  187 TGERPYTCLDCQKTFNQRSALTKHRRTHTGERPYRCSVCSKSFIQNSDLVKHLRTHTGEKPYECPLCVKRFAESSALMKHKRTHSTHRP-FRCSECSRSFTHNSDLTAHMRKH---TEFRNVLNLD-------SVVGTDPLSSQNVASSPYSCSKCRKTFK--RWKSFLNH--------QQTHSREKPYLCSHCNKGFIQNSDLVKHFRTH-TGERPYQCAECHKGFIQKSDLVKHLRT-HTGEKPFKCSHCDKKFTERSALAKHQRTHTGEKPYKCSDCGKEF 447          

HSP 8 Score: 95.9005 bits (237), Expect = 2.819e-18
Identity = 116/520 (22.31%), Postives = 191/520 (36.73%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQ-YLWNENPTNEN--HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKD-----QVTGF-----RR----------FRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRL--FKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVT-------------YRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            CA C K F     L +H   HTG K F+C +CKK F+Q S +  H  +H   K F C  C K+FT    +  H +          S  Q+  + +S   +              S   T + P    +  + ++ N +       H   +P H +  +       + +K     S +        E+   ++  +  H ++ +       T F     RR          + C  C K++ +   L +H+R H  +K + C  C KSF   S L  H ++H   + + C  CNK F     L  H++ H  ++  + C  CD+ F     ++    T H R+     P   +               +   T         KP    +   +    + + K +  ++R+  + C  CGKS+     L +HLK H S  N  V       FV              Y     ++  +    R F C  C   F  ++ LI+H  +H+  +PY C  C R F
Sbjct:  533 CAECKKGFTQKSDLVKHIRVHTGEKPFKCLLCKKSFSQNSDLHKHWRIHTGEKPFPCYTCDKSFTERSALIKHHRTHTGERPHKCSVCQKGFIQKSALTKH-------------SRTHTGEKPYPCTQCGKSFIQNSDLVKHQRIHTGEKPYHCTECNKRFTEGSSLVKHRRTHSGEKPYRCPQCEKTFIQSSDLVKHLVVHNGENPPAATAFHEILIRRENLTRSEPDPYPCTECGKVFHQRPALLKHLRTHKTEKRYPCNECDKSFFQTSDLVKHLRTHTGERPYHCPECNKGFIQNSDLVKHQRTHTGERP-YTCSQCDKGF-----IQRSALTKHMRTHTGEKPYKCEQCQKCFIQNSDLVKHQRIHTGE-------KPYHCPDCDKRFTEGSSLIKHQRIHSRIKPYPCGVCGKSFSQSSNLLKHLKCH-SEQNPPVALSSELGFVAETQTHPDPVDHIVYGDTASYISPEAAGERSFKCNDCGKCFAHRSVLIKHVRIHTGERPYKCSQCTRSF 1025          

HSP 9 Score: 88.5817 bits (218), Expect = 4.377e-16
Identity = 125/575 (21.74%), Postives = 205/575 (35.65%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVH---------DNVKG-------------FLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIH---------TQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDV----KPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVH-----------------------SNSKPYACPLCLRRFKAKIYCDRHISAKK------CSKKKRNRFQQNDLM 2757
            C +C K F     L +H+ TH+  + F C  C + FT  S +  HM  H         D+V G             + C  C K F    +   H +   +    + S   +  +  S+  +        R       AE ++     +++ ++L         H   +P   S+ D          K     + +      D  +   +   + LH+ I    TG R ++C  C + + ++ DL +H ++H         T   P +C  C  +F   S    H K H   K+F C  C K F  K  L  H ++H  +K  F C +C + F+    L  H+      +   P P          +S       K+  T     P       K  I    L +         R  +  + + C  CGKS+     L +H + H +      C  CNK F    S+ +H RT H   + + C QC   FI  + L++H +VH                       S   PY C  C + F  +    +H+   K      C++  ++ FQ +DL+
Sbjct:  250 CPLCVKRFAESSALMKHKRTHSTHRPFRCSECSRSFTHNSDLTAHMRKHTEFRNVLNLDSVVGTDPLSSQNVASSPYSCSKCRKTFKRWKSFLNHQQTHSREKPYLCSHCNKGFIQNSDLVKHFRTHTGER---PYQCAECHKGFIQKSDLVKHL-------RTHTGEKPFKCSHCDKKFTERSALAKHQRTHTGEKPYKCSDCGKEFTQRSNLILHQRIH---TGERPYKCTLCDRTFIQNSDLVKHQKVHANLPLSDPHTANSPHKCSKCDLTFSHWSTFMKHSKLHSGEKKFQCAECKKGFTQKSDLVKHIRVHTGEKP-FKCLLCKKSFSQNSDLHKHWRI---HTGEKPFPCYTCDKSFTERSALI----KHHRTHTGERPHKCSVCQKGFIQKSALTK-------HSRTHTGEKPYPCTQCGKSFIQNSDLVKHQRIH-TGEKPYHCTECNKRFTEGSSLVKHRRT-HSGEKPYRCPQCEKTFIQSSDLVKHLVVHNGENPPAATAFHEILIRRENLTRSEPDPYPCTECGKVFHQRPALLKHLRTHKTEKRYPCNECDKSFFQTSDLV 794          

HSP 10 Score: 82.0333 bits (201), Expect = 5.133e-14
Identity = 65/290 (22.41%), Postives = 118/290 (40.69%), Query Frame = 1
Query: 1816 IKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKR-----KLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            I  +  G R F+C  C K +     L +H+RIHT ++P++C  C +SF  KS L  H+++H   + +                              C +C+R F     L     + H R   N  P  + ++  +  +       K+ P +       +K      ++N   P++ +        +      + C+ CGK +  +    +H + H +      C+ C KSF    ++ +H+R  H   + + C  C   FI K+ L +H  +H+  KPY C +C ++F
Sbjct:  978 ISPEAAGERSFKCNDCGKCFAHRSVLIKHVRIHTGERPYKCSQCTRSFIQKSDLVKHYRTHTGERPYK-----------------------------CGLCERSFVEKSAL-----SRHQRVHKNESPVLNSAMEQQQVTYWGES--KDDPNSLVPQLHVIKEEESPHIVNAYSPLSILQSYFPPILEPKGTPRYSCSECGKCFTHRSVFLKHWRMH-TGEQPYTCKECGKSFSQSSALVKHVRI-HTGEKPYPCSTCGKSFIQKSDLAKHQRIHTGEKPYTCTVCGKKF 1229          

HSP 11 Score: 63.929 bits (154), Expect = 1.348e-8
Identity = 65/261 (24.90%), Postives = 104/261 (39.85%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH--------VDEKHAASS--SCIEG----------LPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            PY C+ CHKGF + S+L +HL  HT  +P++C  C K+F  R +L  H+ T                  RS + L  H ++H  E    C +C + F    DL +H        + + H A+S   C +           +   +  +GE              Q+   +K +     +K  KCL C   F+  +    H+ +    EK      CDK+F   S  + H    H     + C+ C   F Q+S+   H ++
Sbjct:  381 PYQCAECHKGFIQKSDLVKHLRTHTGEKPFKCSHCDKKFTERSALAKHQRTHTGEKPYKCSDCGKEFTQRSNLIL--HQRIHTGERPYKCTLCDRTFIQNSDLVKHQKVHANLPLSDPHTANSPHKCSKCDLTFSHWSTFMKHSKLHSGE-KKFQCAECKKGFTQKSDLVKHIRVHTGEKPFKCLLCKKSFSQNSDLHKHWRIHT-GEKPFPCYTCDKSFTERSALIKH-HRTHTGERPHKCSVCQKGFIQKSALTKHSRT 636          

HSP 12 Score: 63.929 bits (154), Expect = 1.454e-8
Identity = 35/110 (31.82%), Postives = 53/110 (48.18%), Query Frame = 1
Query: 2368 SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            +  + + C+ CGKS+  K  L +H + H +      C  C K F+   S+ +H RT H   R + C +C   F+ K+ L++H   H+  KPY C  C R F       RH
Sbjct: 1187 TGEKPYPCSTCGKSFIQKSDLAKHQRIH-TGEKPYTCTVCGKKFIDRSSVVKHSRT-HTGERPYKCNECTKGFVQKSDLVKHMRTHTGEKPYGCNCCDRSFSTHSASVRH 1294          

HSP 13 Score: 62.003 bits (149), Expect = 5.113e-8
Identity = 70/260 (26.92%), Postives = 100/260 (38.46%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALR--------NHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPEG-------RKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            PY CS C K F + SNL  H  +HT  RPY+C  C + F     L  H+   H+++              S+  L          H KLH  E    C  C KGF  + DL +H+     EK      C +   +        R   GE    P +       ++   IK       ++  KC  C   F  K+    H       EK +    C K+F   S  + H Q +H     Y+C +CN  F + SS V H+++
Sbjct:  437 PYKCSDCGKEFTQRSNLILHQRIHTGERPYKCTLCDRTFIQNSDLVKHQKV-HANLPLSDPHTANSPHKCSKCDLTFSHWSTFMKHSKLHSGEKKFQCAECKKGFTQKSDLVKHIRVHTGEKPFKCLLCKKSFSQNSDLHKHWRIHTGE-KPFPCYTCDKSFTERSALIKHHRTHTGERPHKCSVCQKGFIQKSALTKHSRTHT-GEKPYPCTQCGKSFIQNSDLVKH-QRIHTGEKPYHCTECNKRFTEGSSLVKHRRT 692          

HSP 14 Score: 60.8474 bits (146), Expect = 1.349e-7
Identity = 61/241 (25.31%), Postives = 91/241 (37.76%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            P+ CS+C KGF + S L +H   HT  +PY C +C K F     L  H+                     S  +L  H + H  E    C  C K F    DL +H+             +  G  P       P     +    +++ +    P+       C  C  +F+ +     H     K EK +    CDK+F  TS  + H++  H     Y+C +CN  F Q S  V HQ++
Sbjct:  614 PHKCSVCQKGFIQKSALTKHSRTHTGEKPYPCTQCGKSFIQNSDLVKHQRIHTGEKPYHCTECNKRFTEGS--SLVKHRRTHSGEKPYRCPQCEKTFIQSSDLVKHLV------------VHNGENP-------PAATAFHEILIRRENLTRSEPDP----YPCTECGKVFHQRPALLKHL-RTHKTEKRYPCNECDKSFFQTSDLVKHLR-THTGERPYHCPECNKGFIQNSDLVKHQRT 827          

HSP 15 Score: 58.5362 bits (140), Expect = 6.058e-7
Identity = 30/107 (28.04%), Postives = 52/107 (48.60%), Query Frame = 1
Query: 2359 RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAK 2679
            R  +  + + C  CGKS+     L +H++ H +      C  C KSF+    + +H R  H   + ++C  C   FI ++S+++H   H+  +PY C  C + F  K
Sbjct: 1156 RMHTGEQPYTCKECGKSFSQSSALVKHVRIH-TGEKPYPCSTCGKSFIQKSDLAKHQRI-HTGEKPYTCTVCGKKFIDRSSVVKHSRTHTGERPYKCNECTKGFVQK 1260          

HSP 16 Score: 57.7658 bits (138), Expect = 1.252e-6
Identity = 69/267 (25.84%), Postives = 96/267 (35.96%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVH-----------------------TKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH----VDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY C  C K F ++S+L +HL VH                       ++  PY C +C K F  R +L  H  T  +                S   L  HL+ H  E   HC  C KGF    DL +H      E+    S C +G  +                        K ++    E P K  +C  C FI N+          G   EK +    CDK F   S  + H Q +H+++  Y C  C   F+Q S+ + H K
Sbjct:  698 PYRCPQCEKTFIQSSDLVKHLVVHNGENPPAATAFHEILIRRENLTRSEPDPYPCTECGKVFHQRPALLKHLRTHKTEKRYPCNECDKSFFQTSD--LVKHLRTHTGERPYHCPECNKGFIQNSDLVKHQRTHTGERPYTCSQCDKGFIQ-------------------RSALTKHMRTHTGEKPYKCEQCQKC-FIQNSDLVKHQRIHTG---EKPYHCPDCDKRFTEGSSLIKH-QRIHSRIKPYPCGVCGKSFSQSSNLLKHLK 938          

HSP 17 Score: 56.6102 bits (135), Expect = 2.630e-6
Identity = 34/109 (31.19%), Postives = 51/109 (46.79%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  CD  F +  +L++H ++ H   R   C+VC K F  K +L  HS+TH   +    + C  C + FI    L +H R+   +    Y CT CNK +     L  H +
Sbjct:  589 CYTCDKSFTERSALIKHHRT-HTGERPHKCSVCQKGFIQKSALTKHSRTHTGEKP---YPCTQCGKSFIQNSDLVKHQRIHTGE--KPYHCTECNKRFTEGSSLVKHRR 691          

HSP 18 Score: 56.225 bits (134), Expect = 3.139e-6
Identity = 70/263 (26.62%), Postives = 99/263 (37.64%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEG------RKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSC--SFIFNTKAKYD--NHFCVGLKA---------EKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            Y C+ C K F + S+L +HL  HT  RPY CP+C K F     L  H+ T                + RS  AL  H++ H  E    C+ C K F    DL +    H  EK      C +   EG      ++    +   P         Q    +K +     +     LS    F+  T+   D  +H   G  A         E+S     C K F   S  + HV+ +H     Y C+QC   F Q+S  V H ++
Sbjct:  778 YPCNECDKSFFQTSDLVKHLRTHTGERPYHCPECNKGFIQNSDLVKHQRTHTGERPYTCSQCDKGFIQRS--ALTKHMRTHTGEKPYKCEQCQKCFIQNSDLVKHQRIHTGEKPYHCPDCDKRFTEGSSLIKHQRIHSRIKPYPCGVCGKSFSQSSNLLKHLKCHSEQNPPVALSSELGFVAETQTHPDPVDHIVYGDTASYISPEAAGERSFKCNDCGKCFAHRSVLIKHVR-IHTGERPYKCSQCTRSFIQKSDLVKHYRT 1037          

HSP 19 Score: 55.4546 bits (132), Expect = 5.860e-6
Identity = 67/260 (25.77%), Postives = 88/260 (33.85%), Query Frame = 1
Query: 4246 CSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGF----DLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHF--------------CVGLK-------AEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 4950
            C  C K F + S+  +H   HT  RPYQC +C K+F  R +L  H+ T                  RS  AL  H + H  E    C VC K F    DL + L  H  EK      C++   E                          +K        +  +C  CS  F   +    H                VG         A   +    C KTF+    FL H Q+ H++   Y C+ CN  F Q S  V H
Sbjct:  138 CPHCKKSFVQRSDFIKHQRTHTGERPYQCVECQKKFTERSALVNHQRTHTGERPYTCLDCQKTFNQRS--ALTKHRRTHTGERPYRCSVCSKSFIQNSDLVKHLRTHTGEKPYECPLCVKRFAES----------------------SALMKHKRTHSTHRPFRCSECSRSFTHNSDLTAHMRKHTEFRNVLNLDSVVGTDPLSSQNVASSPYSCSKCRKTFKRWKSFLNH-QQTHSREKPYLCSHCNKGFIQNSDLVKH 372          

HSP 20 Score: 54.6842 bits (130), Expect = 9.887e-6
Identity = 26/65 (40.00%), Postives = 36/65 (55.38%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFT 1419
            C VCGK F     + +H  THTG + ++C  C KGF QKS +  HM  H   K + C  C ++F+
Sbjct: 1222 CTVCGKKFIDRSSVVKHSRTHTGERPYKCNECTKGFVQKSDLVKHMRTHTGEKPYGCNCCDRSFS 1286          
BLAST of Zinc finger, C2H2 type vs. UniProt/SwissProt
Match: sp|A6NN14|ZN729_HUMAN (Zinc finger protein 729 OS=Homo sapiens OX=9606 GN=ZNF729 PE=2 SV=4)

HSP 1 Score: 149.058 bits (375), Expect = 1.444e-34
Identity = 173/726 (23.83%), Postives = 278/726 (38.29%), Query Frame = 1
Query:  517 CEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGR--SQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQ-YLWNENPTNEN--HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            C   F    T+ KH  IH  +  F+C  C  ++N   NL  H   IHT E T          YKC  C   F       AH +IH  ++   CE C   F     L KH   H  G++   R+          C   F     ++KH +           I  G      E      +   K    K      +  K    G+  SQ   +K   ++ I    +P             C  CGKAF +   L +H++ HTG K ++C  C K F Q S +  H  +H   K + C+ CGKAF +  ++  H K+IH        +      ++S+                  +  T + P    E  + + W+   T     H   +P                 K     + + +   E+  +    +  +  H++I    TG + ++C  C K +R+S  LTRH  IHT +KP++C  C K+F   S L+ H   H   K + CE C K F+    L+ H+ +H  +K  + C+ C + F     L  H        + +    P +               K+K           K     E +      + + K K+  +  + +KC  CGK++K+   L  H   H +      C+ C K+F  + ++++H +  H  ++ + C +C   F   +SL +H ++HS  KPY C  C + FK
Sbjct:  241 CGNAFKFSSTFTKHKRIHTGETPFRCEECGKAFNQSSNLTDH-KRIHTGEKT----------YKCEECGKAFKGSSNFNAHKVIHTAEKPYKCEDCGKTFNHFSALRKHKIIH-TGKKPYKREE---------CGKAFSQSSTLRKHEI-----------IHTGEKPYKCEECGKAFKWSSKLTVHKVVHTGEKPYKCEECGKAFSQFSTLKK--HKIIHTGKKP-----------YKCEECGKAFNSSSTLMKHKIIHTGEKPYKCEECGKAFRQSSHLTRHKAIHTGEKPYKCEECGKAFNHFSDLRRH-KIIHTGKKPYKCEECGKAFSQSSTLRNH------------QIIHTGEKPYKCEECGKAFKWSSKLTVHKVIHTGEKPCKCEECGKAFKHFSALRKHKVIHTREKLYKCEECGKAFNNSSILAKHKIIH---TGKKPYKCEECGKAFRQSSHLTRHKAIHTGEKPYKCEECGKAFSHFSALRRHKIIHTGKKPYKCEECGKAFSHFSALRRHKIIHTGEKP-YKCEECGKAFKWSSKLTVH-------KVIHTAEKPCKCEECGKSFKHFSALRKHKVIHTRE-----KLYKCEECVKAFNSFSALMKHKVIHTGEKPYKCEECGKAFKWSSKLTVHKVIH-TGEKPCKCEECGKAFKHFSALRKH-KVIHTGKKPYKCEECGKAFSQSSSLRKHEIIHSGEKPYKCEECGKAFK 890          

HSP 2 Score: 145.976 bits (367), Expect = 1.316e-33
Identity = 185/761 (24.31%), Postives = 291/761 (38.24%), Query Frame = 1
Query:  493 TGKQ--TCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIG-----EECDDRKLTTNYL-------------KCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKN----GTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            TGK+   CE C   F    T   H  IH  ++ +KC  C  ++ +   L VH  +IHT E             KC  C   F    A + H +IH  ++   CE C   F    +L KH   H        EEC      +++L             KC+ C   F +   +++H +           I  G      E             + K      +  K    G++     K  V++ I    +P K           C  CGK+FK    LR+H+V HT  K ++C  C K F   S++  H V+H   K + C+ CGKAF +   +  H KVIH        E   ++ +H             K P + ++    A +  S     EI           E   +++   +      I +AE   K             E+  +  K    ++ H++I    TG + ++C  C K +  S  L +H  IHT +KP++C  C K+F+  S L  H   H   K + CE C K FN   TLK H+ +H  +KL + C+ C + FN    L  H        I +    P++            +  ++K           KP    E        + + K K+  +  + ++C+ CGK++     L +H   H +      C+ C K+F     + +H +  H   + + C +C   F   + L RH  +H+  KPY C  C + F    Y  RH
Sbjct:  511 TGKKPYKCEECGKAFSQSSTLRNHQIIHTGEKPYKCEECGKAFKWSSKLTVH-KVIHTGE----------KPCKCEECGKAFKHFSALRKHKVIHTREKLYKCEECGKAFNNSSILAKHKIIHTGKKPYKCEECGKAFRQSSHLTRHKAIHTGEKPYKCEECGKAFSHFSALRRHKI-----------IHTGKKPYKCEECGKAFSHFSALRRHKIIHTGEKPYKCEECGKAFKWSSKLTVHKVIHTAEKPCK-----------CEECGKSFKHFSALRKHKVIHTREKLYKCEECVKAFNSFSALMKHKVIHTGEKPYKCEECGKAFKWSSKLTVH-KVIHTGEKPCKCEECGKAFKHFSALRKHKVIHTGKKPYKCEECGK-AFSQSSSLRKHEIIHSGEKPYKCEECGKAFKWLSKLTVHKVIHTAEKPCKC------------EECGKAFKHFSALRKHKIIH---TGKKPYKCEECGKAFNDSSTLMKHKIIHTGKKPYKCAECGKAFKQSSHLTRHKAIHTGEKPYKCEECGKDFNNSSTLKKHKLIHTREKL-YKCEECVKAFNNFSALMKH-------KIIHTGEKPYKCEECGKAFKWSSKLTEHKVIHTGE-----KPCKCEECDKAFKHFSALRKHKVIHTGKKPYQCDECGKAFNNSSTLTKHKIIH-TGEKPYKCEECGKAFSQSSILTKH-KIIHSVEKPYKCEECGKAFNQSSHLTRHKTIHTGEKPYKCEECGKAFIQCSYLIRH 1206          

HSP 3 Score: 140.969 bits (354), Expect = 4.744e-32
Identity = 181/781 (23.18%), Postives = 302/781 (38.67%), Query Frame = 1
Query:  448 QYDNLDPTVYKTINGTGKQT--CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHL---------------------------SANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            Q  NL  T +K I+ TG++T  CE C   F     +  H  IH  ++ +KC  C  ++N+   L  H  IIHT +            YK   C   FS+    + H +IH  ++   CE C   FK    L  H   H  GE+           KC+ C   F     +KKH +           I  G      E             K K      +  K    G++         +++I    +P K           C  CGKAF     LRRH++ HTG K ++C  C K F+Q S+++ H ++H   K + C+ CGKAF +   +  H KVIH    E   + +E      +       K  +  +K+    E  ++ ++ + + ++          H   +P            + +  +     + +     E+  +       ++ H++I    TG + ++C  C K +     L RH  IHT +KP++C  C K+F+  S L  H   H   K   CE C K F     L+ H+ +H  +KL + C+ C + FN+   L        H+ I   +         +           +K T +       KP    E        + + K K+  +  + +KC  CGK++     L +H   H                            +A     C+ C K+F  + ++++H +  H  ++ + C +C   F   ++L++H ++H+  KPY C  C + FK   +  RH
Sbjct:  275 QSSNL--TDHKRIH-TGEKTYKCEECGKAFKGSSNFNAHKVIHTAEKPYKCEDCGKTFNHFSALRKH-KIIHTGK----------KPYKREECGKAFSQSSTLRKHEIIHTGEKPYKCEECGKAFKWSSKLTVHKVVH-TGEK---------PYKCEECGKAFSQFSTLKKHKI-----------IHTGKKPYKCEECGKAFNSSSTLMKHKIIHTGEKPYKCEECGKAFRQSSHLTRHKAIHTGEKPYK-----------CEECGKAFNHFSDLRRHKIIHTGKKPYKCEECGKAFSQSSTLRNHQIIHTGEKPYKCEECGKAFKWSSKLTVH-KVIHTG--EKPCKCEECGKAFKHFSALRKHKVIHTREKLYKCEECGKAFNNSSILAKH-------KIIHTGKKPYKCEECGKAFRQSSHLTRHKAIHTGEKPYKCEECGKAFSHFSALRRHKIIH---TGKKPYKCEECGKAFSHFSALRRHKIIHTGEKPYKCEECGKAFKWSSKLTVHKVIHTAEKPCKCEECGKSFKHFSALRKHKVIHTREKL-YKCEECVKAFNSFSAL------MKHKVIHTGEKPYKCEECGKAFKWS------SKLTVHKVIHTGEKPCKCEECGKAFKHFSALRKHKVIHTGKKPYKCEECGKAFSQSSSLRKHEIIHSGEKPYKCEECGKAFKWLSKLTVHKVIHTAEKPCKCEECGKAFKHFSALRKH-KIIHTGKKPYKCEECGKAFNDSSTLMKHKIIHTGKKPYKCAECGKAFKQSSHLTRH 982          

HSP 4 Score: 116.701 bits (291), Expect = 1.126e-24
Identity = 117/490 (23.88%), Postives = 193/490 (39.39%), Query Frame = 1
Query: 1237 GKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSI-ANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            GKAFK+   L +H++ HT  K ++   C   F   S+   H  +H     F C+ CGKAF    N+  H ++     T    +  +     SN +            K+   AE      D  +             NHFS    H+       P                    E+  +   ++  ++ HE+I    TG + ++C  C K ++ S  LT H  +HT +KP++C  C K+F   S LK H   H   K + CE C K FN   TL  H+ +H  +K  + C+ C + F    HL      + H++I     P   +               K   T         KP    E        + +   ++  +  + +KC  CGK++K+   L  H   H +      C+ C K+F  + ++++H +  H   + + C +C   F   + L +H ++H+  KPY C  C + F+   +  RH
Sbjct:  214 GKAFKSFSTLTKHKIIHTEDKPYKYKKCGNAFKFSSTFTKHKRIHTGETPFRCEECGKAFNQSSNLTDHKRIHTGEKTYKCEECGKAFKGSSNFNAH----------KVIHTAEKPYKCEDCGKTF-----------NHFSALRKHKIIHTGKKP-----------------YKREECGKAFSQSSTLRKHEIIH---TGEKPYKCEECGKAFKWSSKLTVHKVVHTGEKPYKCEECGKAFSQFSTLKKHKIIHTGKKPYKCEECGKAFNSSSTLMKHKIIHTGEKP-YKCEECGKAFRQSSHL------TRHKAIHTGEKPYKCEECGKAFNHFSDLRRHKIIHTGK-------KPYKCEECGKAFSQSSTLRNHQIIHTGEKPYKCEECGKAFKWSSKLTVHKVIH-TGEKPCKCEECGKAFKHFSALRKH-KVIHTREKLYKCEECGKAFNNSSILAKHKIIHTGKKPYKCEECGKAFRQSSHLTRH 646          

HSP 5 Score: 113.62 bits (283), Expect = 1.090e-23
Identity = 160/668 (23.95%), Postives = 256/668 (38.32%), Query Frame = 1
Query:  469 TVYKTIN-GTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXX----XQKDPNR-------FKKIASLAE-----TNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDK---SHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSY 2412
            T +K I+ G     CE C   F       +H  IH   + +KC  C  ++++   L  H  IIHT E            YKC  C   F        H +IH  ++   CE C   FK    L KH   H                KC+ C   F +   + KH V           I  G      E      +   K    K      +  K    G++         ++ I    +P K           C  CGKAF     LR+HE+ H+G K ++C  C K F   S + +H V+H   K   C+ CGKAF +   +  H K+IH        +      N+S+   +       K P +       FK+ + L       T + P    E  +   N +   ++   +        +  + +  NF  L   K   + +     E+  +  K + ++  H++I    TG +  +C  C K ++    L +H  IHT +KP+QC  C K+F   S L  H   H   K + CE C K F+    L  H+ +H  +K  + C+ C + FN   HL      + H++I   +  P++        +Q    +++K       P +VK +   +LL+ P  +  +DK   +  + +KC  C K++
Sbjct:  644 TRHKAIHTGEKPYKCEECGKAFSHFSALRRHKIIHTGKKPYKCEECGKAFSHFSALRRH-KIIHTGE----------KPYKCEECGKAFKWSSKLTVHKVIHTAEKPCKCEECGKSFKHFSALRKHKVIH----------TREKLYKCEECVKAFNSFSALMKHKV-----------IHTGEKPYKCEECGKAFKWSSKLTVHKVIHTGEKPCKCEECGKAFKHFSALRKHKVIHTGKKPYK-----------CEECGKAFSQSSSLRKHEIIHSGEKPYKCEECGKAFKWLSKLTVHKVIHTAEKPCKCEECGKAFKHFSALRKH-KIIHTGKKPYKCEECGKAFNDSSTLMKHKIIHTGKKPYKCAECGKAFKQSSHLTRHKAIHTGEKPYKCEECGKDFNNSSTLKKHKLIHTREKLYKCEECVKAFNNFSALMKHKIIHTGEKPYKCEECGKAFKWSSKLTEHKVIH---TGEKPCKCEECDKAFKHFSALRKHKVIHTGKKPYQCDECGKAFNNSSTLTKHKIIHTGEKPYKCEECGKAFSQSSILTKHKIIHSVEKP-YKCEECGKAFNQSSHL------TRHKTIHTGE-KPYKCEECGKAFIQCSYLIRHKTIHTREKPTNVKKV--PKLLSNPHTL--LDKTIHTGEKPYKCEECAKAF 1252          

HSP 6 Score: 88.1965 bits (217), Expect = 5.421e-16
Identity = 76/313 (24.28%), Postives = 128/313 (40.89%), Query Frame = 1
Query: 1744 QGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDV----KPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            Q I   E+  +  K    +  H++I  +   ++  +C   +K    S   T+H RIHT + PF+C  C K+F   S L +H + H   K + CE C K F        H+ +H  +K  + C+ C + FN       H+S      I +    P++         Q     K++       P       K   W+  L        + K   +  + +KC  CGK++     L +H   H +      C+ C K+F +  ++ +H +  H   + + C +C   F   + L RH  +H+  KPY C  C + F
Sbjct:  205 QNIYKCEERGKAFKSFSTLTKHKIIHTEDKPYKYKKCGNAFKF---SSTFTKHKRIHTGETPFRCEECGKAFNQSSNLTDHKRIHTGEKTYKCEECGKAFKGSSNFNAHKVIHTAEKP-YKCEDCGKTFN-------HFSALRKHKIIHTGKKPYKREECGKAFSQSSTLRKHEIIHTGEKPYKCEECGKAFKWSSKLT-------VHKVVHTGEKPYKCEECGKAFSQFSTLKKHKIIH-TGKKPYKCEECGKAFNSSSTLMKH-KIIHTGEKPYKCEECGKAFRQSSHLTRHKAIHTGEKPYKCEECGKAF 497          

HSP 7 Score: 59.3066 bits (142), Expect = 3.530e-7
Identity = 66/260 (25.38%), Postives = 93/260 (35.77%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLS----RHVDEKHAASSSCIEGLPE------------GRKP------AGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQ 4953
            Y C  C K F  +SN   H  +HT  +PY+C  C K F H  +L+ H+   H+      R        +S   LR H  +H  E    C+ C K F     L+     H  EK      C +   +            G+KP          +S+ T             +K  I    +K  KC  C   F   +    H  +    EK +    C K F   S    H + +H     Y C +C   F+Q S+  NHQ
Sbjct:  292 YKCEECGKAFKGSSNFNAHKVIHTAEKPYKCEDCGKTFNHFSALRKHKII-HTGKKPYKREECGKAFSQSST-LRKHEIIHTGEKPYKCEECGKAFKWSSKLTVHKVVHTGEKPYKCEECGKAFSQFSTLKKHKIIHTGKKPYKCEECGKAFNSSSTL------------MKHKIIHTGEKPYKCEECGKAFRQSSHLTRHKAIHT-GEKPYKCEECGKAFNHFSDLRRH-KIIHTGKKPYKCEECGKAFSQSSTLRNHQ 535          

HSP 8 Score: 58.5362 bits (140), Expect = 5.760e-7
Identity = 61/239 (25.52%), Postives = 91/239 (38.08%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQ 4953
            PY C  C K F ++S+L +H ++HT  +PY+C +C K F H  +L+ H+                     S  ALR H  +H  E    C+ C K F     L+ H    H A   C     E  K     S+                 K  +    +KL KC  C   FN+ +    H  +    EK +    C K F+ +S+   H + +H       C +C   F   S+   H+
Sbjct:  627 PYKCEECGKAFRQSSHLTRHKAIHTGEKPYKCEECGKAFSHFSALRRHKIIHTGKKPYKCEECGKAFSHFS--ALRRHKIIHTGEKPYKCEECGKAFKWSSKLTVH-KVIHTAEKPC--KCEECGKSFKHFSALR---------------KHKVIHTREKLYKCEECVKAFNSFSALMKHKVIHT-GEKPYKCEECGKAFKWSSKLTVH-KVIHTGEKPCKCEECGKAFKHFSALRKHK 843          

HSP 9 Score: 57.7658 bits (138), Expect = 9.887e-7
Identity = 66/254 (25.98%), Postives = 97/254 (38.19%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEV-------IPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVH 4965
            PY C  C K FN +S L +H  +HT  +PY+C +C K F+    L  H+A  H+                S   L+ H  +H RE    C+ C K F+    L +    H  EK      C +      K   E     T       ++  K  K         +    KK  +C  C   FN  +    H  +    EK +    C K F  +S    H + +H+    Y C +C   F Q SS++   K++H
Sbjct:  935 PYKCEECGKAFNDSSTLMKHKIIHTGKKPYKCAECGKAFKQSSHLTRHKAI-HTGEKPYKCEECGKDFNNSST-LKKHKLIHTREKLYKCEECVKAFNNFSALMKHKIIHTGEKPYKCEECGKAFKWSSKLT-EHKVIHTGEKPCKCEECDKAFKHFSALRKHKVIHTGKKPYQCDECGKAFNNSSTLTKHKIIHT-GEKPYKCEECGKAFSQSSILTKH-KIIHSVEKPYKCEECGKAFNQ-SSHLTRHKTIH 1182          

HSP 10 Score: 55.0694 bits (131), Expect = 6.550e-6
Identity = 64/249 (25.70%), Postives = 93/249 (37.35%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRC--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVH 4965
            PY C  C K FN +S L +H  +HT  +PY+C +C K FR    L  H+A                    S   LR H  +H  +    C+ C K F     L      H  EK      C +          + SS  T             + +VI    +K  KC  C   F   +    H  +  + +   L +C  C K F ++S    H + +H     Y C +C   F Q SS++   K++H
Sbjct:  431 PYKCEECGKAFNSSSTLMKHKIIHTGEKPYKCEECGKAFRQSSHLTRHKAIHTGEKPYKCEECGKAFNHFSD--LRRHKIIHTGKKPYKCEECGKAFSQSSTLRNHQIIHTGEKPYKCEECGKAF--------KWSSKLT-------------VHKVI-HTGEKPCKCEECGKAFKHFSALRKHKVIHTREK---LYKCEECGKAFNNSSILAKH-KIIHTGKKPYKCEECGKAFRQ-SSHLTRHKAIH 650          
BLAST of Zinc finger, C2H2 type vs. TrEMBL
Match: A0A5N4CBV0 (Zinc finger protein 236 OS=Camelus dromedarius OX=9838 GN=Cadr_000027516 PE=4 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 8.195e-63
Identity = 223/865 (25.78%), Postives = 346/865 (40.00%), Query Frame = 1
Query:  391 INGTNYYDSQNTTYNQNKYQYDNLDPTVYKTINGTGKQTCEICEVEFPSKRTYLKHMSIHE-NDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH---KNG-------------------------------TEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQV-----------TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST----------SHHR----------SIANPD---------------PXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLI---WNELLNQPIPIAEIDKRKLSNN------RLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKC 2715
            I+G    +++NT Y    +Q  N                CEIC + FP +  + +HM  HE ND+  +C  C  ++N E NL +H       +CT     N E +  C +C+  FSR  + +AH ++H+ +E L C  C   F  +  L  H+ +H+  +E   R+  T    CK C   FE    +K+     H KT  H+ I                                           ++   +P  NR+I + G              +C  CGK F+ P  L RH   HTG + F+C  C K F QK +++ HM+ H   K   C FC  AF+ + N+ +H++ +H   KNG                               +   +    H+L  +       Q+   +     + A + Q      ++ Q L   +       S  P         +  +++ ++     S    LL+  V+ I  E  Q      +  +V            G R   C +C K +RK  DL RHIRIHT +KPF+C  C ++F +KS L  H K+H  +K F C+ C K F+   +LKVH +LH   +  F C  CD++F T  H + H ++           H R          S+  PD               P+           L+     K     N + P D    +   W   L QPIP  +  +   SNN      R +KC +C ++YK   +L +H++ H +      C  C + FV+   ++ H+RT H   + F CL C   F T  SL RH  +HS+ +PY CP C + FK  + C +H+   +C
Sbjct:   16 IDGVLTLNAENTNY---AFQVPNF-------------HKCEICLLSFPKESQFQRHMRDHERNDKPHRCDQCPQTFNVEFNLTLH-------KCT----HNGE-DPTCPVCNKKFSRVASLKAHVMLHEKEENLICAECGDEFALQSQLAVHMEEHR--QELAGRRART----CKACGKDFETSSQLKE-----HMKT--HYKI-------------------------------------------RVSGTRP-YNRNIDRSG-----------FTYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPHACAFCPAAFSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKMHMGGPQSAAGAAEAAHVLTATLFQALPLQQTDVQ----VTSASSQQGSQAVTDVIQQLLELSEPGPGEASQPPQAGQQLSITVGISQDILQ----HSRASHLLAFAVQSIIAELTQSNRKRFVGYRVLLSSDGSIREENGVRWHVCPYCAKEFRKPSDLVRHIRIHTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCMKSFSTSGSLKVHIRLHTGVR-PFACPHCDKKFRTSGHRKTHIASHFKHTELRKMRHQRKPAKVRVGKASVPVPDIPLQEPILITDVDSMPANAHIGRKCRNPLKIGSRAKKSNCDNRDFPIDSDLFLIFFWFIGLIQPIPRNQFFQSYFSNNFVNEADRPYKCFYCHRAYKKSCHLKQHIRSH-TGEKPFKCSQCGRGFVSAGVLKAHVRT-HSGLKSFKCLVCNGAFSTGGSLRRHMGIHSDLRPYMCPYCQKTFKTALNCKKHMKTHRC 773          

HSP 2 Score: 90.5077 bits (223), Expect = 2.540e-14
Identity = 43/116 (37.07%), Postives = 66/116 (56.90%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIA 2187
            R ++C +C++ Y+KSC L +HIR HT +KPF+C  C + F    VLK H ++H  LK F C +CN  F+   +L+ H  +H  D   ++C  C + F T  + + H  T  HR + 
Sbjct:  663 RPYKCFYCHRAYKKSCHLKQHIRSHTGEKPFKCSQCGRGFVSAGVLKAHVRTHSGLKSFKCLVCNGAFSTGGSLRRHMGIHS-DLRPYMCPYCQKTFKTALNCKKHMKT--HRCVG 775          

HSP 3 Score: 63.1586 bits (152), Expect = 5.906e-6
Identity = 34/111 (30.63%), Postives = 59/111 (53.15%), Query Frame = 1
Query: 3553 YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            +H C  C  +F+    LV H++  H   + F C  C +AF+ K +L AH KTH   ++F C  C+   + F +  SL  H+R+  +  +  + C HC+K ++T+    +H+
Sbjct:  442 WHVCPYCAKEFRKPSDLVRHIRI-HTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCM---KSFSTSGSLKVHIRL--HTGVRPFACPHCDKKFRTSGHRKTHI 546          
BLAST of Zinc finger, C2H2 type vs. TrEMBL
Match: A0A5G3JRB9 (G protein-coupled receptor 89B OS=Xenopus tropicalis OX=8364 GN=gpr89b PE=4 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 2.218e-62
Identity = 205/772 (26.55%), Postives = 328/772 (42.49%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHE-NDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGT---EVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSD-------------DAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWD--------KSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKP----TANSNNP----PDVKPLIWNEL-LNQPIPIAE-------IDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C+IC + FP +  Y +HM  HE ND+  +C  C +S+N + NL +H A  + ++ T            C  C   FSR  + +AH ++H+ +E L C  C   F     L  H+ +H+         + +    CK C   F++   +K+     H KT  H+ I          RV                          A  RS         NR+I + G            + +C  CGK F+ P  L RH   HTG + F+C IC K F QK ++  HMV H   K   C FC  AF+ + N+ +HI+ +H   T    V +Q+     + S     +     +  +++  L+E   +P +             + +I Q     +  +    +  P+  S   + +   E       D        +  +     +  +RI K+        + ++  +G R   C +C K ++K  DL RHIRIHT +KPF+C  C ++F +KS L  H K+H  +K F C+ C K F+   +LKVH +LH   +  F C  CD++F T  H + H + SH +                     +    + KP       SN P    P  +P++  +L L QPIP          I+      +R +KC +C ++YK   +L +H++ H +      C  C + F +   ++ H+RT H   R + CL C   F T  SL RH  +H++ +PY CP C + FK  + C +H+
Sbjct:   33 CDICLLSFPKETQYQRHMRDHERNDKAHRCDQCPMSFNIDFNLTLHKATHNVDDPT------------CPACRKKFSRVASLKAHIMLHEKEETLICSECGDEFTLPNNLSLHMEEHR------QELVGSKTYSCKSCKKTFDSTPQLKE-----HMKT--HFKI----------RV--------------------------ANTRS--------YNRNIDRSG-----------FSYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCNICGKAFNQKGALATHMVKHTGEKPHACAFCPAAFSQKGNLQSHIQRVHSEVTVFQAVPAQTDSTDCSASEQQGPQQPAVTDVIQQLLELSEPVDNPQNSQSEQQLNISVGINRDILQQALENSGLSSIPVAALPSDTSQAKATVQEIECLSTQQMDCNDQEHEVEHEEQDKADKTEKRIIKKKSAFSAGSVREE--SGIRWHICTYCNKEFKKPSDLVRHIRIHTHEKPFKCLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKCFSTSGSLKVHIRLHTGVR-PFACPHCDKKFRTSGHRKTHIA-SHFKQC-----------------ELRKLRQQRKPGKVRVGKSNVPVSEIPLQEPILITDLGLIQPIPRNSQFFQNYFINSYTHEVDRPYKCYYCHRAYKKSCHLKQHIRSH-TGEKPFKCTQCGRGFASSGVLKAHIRT-HTGLRDYKCLVCNGAFTTGGSLRRHMCIHNDLRPYMCPYCQKTFKTSLNCKKHM 701          

HSP 2 Score: 136.732 bits (343), Expect = 2.981e-28
Identity = 103/327 (31.50%), Postives = 149/327 (45.57%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFR---RFR--CRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTG----FHLRYHYSTSHHR 2178
            C +CG+ F +  +L+ HE THTG+K + C IC   FT   S+  HM  H ++K + C FC + F    +   H+K  H+N    L     H +  +N                              +I +    E+ + E   S +  H   T +   +AE    L   +  +G  +SE V  + +   +      IKD+        +F   C FC K ++K  DL RHIRIHT +KPF+C  C KSF +KS L +H K+H   K FSC +C+  F+ K +LKVH +LH   K  F C  CD RF T      H++ HY     R
Sbjct:  934 CTMCGRGFVSSGVLKSHEKTHTGVKAYSCTICNAAFTTNGSLTRHMSTHISMKPYKCPFCDETFRTTVHCKKHMKK-HQNIGPAL-----HAMVLAN----------------------------GGDICK---TEDESAERSASRKSRHGVITFTEEETAE----LAKIRPREGATISEKV--LVQSAAEKDRISEIKDKQAEMETEPKFANCCSFCPKSFKKPSDLIRHIRIHTGEKPFKCDECGKSFTVKSTLDSHVKTHAGQKLFSCHVCSNSFSTKGSLKVHMRLHTGAK-PFKCPHCDMRFRTSGRRKTHIQCHYKADAKR 1216          

HSP 3 Score: 124.79 bits (312), Expect = 1.437e-24
Identity = 98/343 (28.57%), Postives = 146/343 (42.57%), Query Frame = 1
Query: 1771 ERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYS-------TSHHRSIAN------PDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIP----IAEIDKRKLSNNRLFK----CNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNR 2736
            E I+ +T      E  +D+    R +RC +C K ++KS  L +HIR HT +KP++C MC + F    VLK+H K+H  +K +SC ICN  F    +L  H   H   K  + C  CD  F T  H + H           H   +AN       +    +               + +    +   P     I  ++L Q       I+EI  ++       K    C+ C KS+K    L  H++ H +      C  C KSF    ++  H++T H  ++ FSC  C   F TK SL  H  +H+ +KP+ CP C  RF+       HI     +  KR R
Sbjct:  881 EEIELQTQSAPFLESTEDR--SRRAYRCDYCNKGFKKSSHLKQHIRSHTGEKPYKCTMCGRGFVSSGVLKSHEKTHTGVKAYSCTICNAAFTTNGSLTRHMSTHISMK-PYKCPFCDETFRTTVHCKKHMKKHQNIGPALHAMVLANGGDICKTEDESAERSASRKSRHGVITFTEEETAELAKIRPREGATISEKVLVQSAAEKDRISEIKDKQAEMETEPKFANCCSFCPKSFKKPSDLIRHIRIH-TGEKPFKCDECGKSFTVKSTLDSHVKT-HAGQKLFSCHVCSNSFSTKGSLKVHMRLHTGAKPFKCPHCDMRFRTSGRRKTHIQCHYKADAKRIR 1218          

HSP 4 Score: 94.7449 bits (234), Expect = 2.197e-15
Identity = 83/355 (23.38%), Postives = 150/355 (42.25%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV--------IHKNGTEVLSQSQEHLLNESNXXXXXXQKD-----PNRFKKIASLAETNQSPSDDA---EITQYLWNEN-PTNENHF-SYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETG--QIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLT---------RHIRIHTQQKPF------------QCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            C  CG+ F +  +L+ H  THTG+++++C +C   FT   S++ HM +H++++ ++C +C K F    N   H+K         +H++   V  ++    ++ SN  + E   D      +  ++  ++ + +  P  D     + Q L  +N  T+E+ F + Q   Q N + Y  +       D     QG  +++   +  + +   Q+Q    ++ Q       +          + ++T           I + TQ  PF            +C  C+K F+  S LK H +SH   K + C +C + F     LK H + H   K  + C IC+  F T   L  H ST
Sbjct:  628 CTQCGRGFASSGVLKAHIRTHTGLRDYKCLVCNGAFTTGGSLRRHMCIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHRYEVASQLHQHQPAVSEETPADQIHVSNQIQVEIAGDGLHQSSSVARQPEAILQLSPQPVLDTVSPALGQTLTEQNLETDEDRFVTSQHALQENINQYETTELPTQSYDQQGLSQGFTVTDSFSQQAQFSAVQQLQDSSTLESQALSTSYQQPTLLEVPTADTINVTARLIQEGTHEEIELQTQSAPFLESTEDRSRRAYRCDYCNKGFKKSSHLKQHIRSHTGEKPYKCTMCGRGFVSSGVLKSHEKTHTGVKA-YSCTICNAAFTTNGSLTRHMST 981          

HSP 5 Score: 91.6633 bits (226), Expect = 1.840e-14
Identity = 39/109 (35.78%), Postives = 63/109 (57.80%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            R ++C +C++ Y+KSC L +HIR HT +KPF+C  C + F    VLK H ++H  L+++ C +CN  F    +L+ H  +H  D   ++C  C + F T  + + H  T
Sbjct:  596 RPYKCYYCHRAYKKSCHLKQHIRSHTGEKPFKCTQCGRGFASSGVLKAHIRTHTGLRDYKCLVCNGAFTTGGSLRRHMCIHN-DLRPYMCPYCQKTFKTSLNCKKHMKT 703          

HSP 6 Score: 74.7146 bits (182), Expect = 2.296e-9
Identity = 34/86 (39.53%), Postives = 48/86 (55.81%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLS 1482
            C  C KAF  P  L RH   HTG + F+C +C+K F QKS++++HM  H   K + C +C   FT + NM  H+K  H    E ++
Sbjct: 1652 CDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHMKKHTGEKPYKCDYCSMTFTQKCNMKLHMKRTHAYPGEYVA 1737          

HSP 7 Score: 72.7886 bits (177), Expect = 1.003e-8
Identity = 35/93 (37.63%), Postives = 50/93 (53.76%), Query Frame = 1
Query: 1846 FRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDR 2124
            F+C  C K + K   L RH RIHT ++PFQC +C K+F  KS L+ H K H   K + C+ C+  F  K  +K+H +        +V  I +R
Sbjct: 1650 FKCDTCDKAFAKPSQLERHSRIHTGERPFQCTLCEKAFNQKSALQVHMKKHTGEKPYKCDYCSMTFTQKCNMKLHMKRTHAYPGEYVAMIVNR 1742          

HSP 8 Score: 68.1662 bits (165), Expect = 2.638e-7
Identity = 36/111 (32.43%), Postives = 60/111 (54.05%), Query Frame = 1
Query: 3553 YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            +H C  C+ +FK    LV H++  H   + F C  C +AF+ K +L AH KTH   ++F C  C+ C   F +  SL  H+R+  +  +  + C HC+K ++T+    +H+
Sbjct:  421 WHICTYCNKEFKKPSDLVRHIRI-HTHEKPFKCLQCFRAFAVKSTLTAHIKTHSGIKAFKCDFCMKC---FSTSGSLKVHIRL--HTGVRPFACPHCDKKFRTSGHRKTHI 525          

HSP 9 Score: 63.5438 bits (153), Expect = 5.810e-6
Identity = 37/123 (30.08%), Postives = 64/123 (52.03%), Query Frame = 1
Query: 3520 QSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            Q+  E  P KF + C+ C   FK    L+ H++  H   + F C+ C K+F+ K +L +H KTH   + F C V   C+  F +  SL  H+R+  +     ++C HC+  ++T+    +H++
Sbjct: 1092 QAEMETEP-KFANCCSFCPKSFKKPSDLIRHIRI-HTGEKPFKCDECGKSFTVKSTLDSHVKTHAGQKLFSCHV---CSNSFSTKGSLKVHMRL--HTGAKPFKCPHCDMRFRTSGRRKTHIQ 1207          
BLAST of Zinc finger, C2H2 type vs. TrEMBL
Match: K1PSS5 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10008505 PE=4 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 8.738e-60
Identity = 204/777 (26.25%), Postives = 324/777 (41.70%), Query Frame = 1
Query:  490 GTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSV-----KIHMVVHDNVKG--FLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNE-SNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWN--ENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSN---------NRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLMTG 2763
            G G   CE CE  FP    Y +HM  H+ D+ F+C  C +S+N   NL +H+A        V  D        C  C   FSR  + +AH ++H+ +E L C  C   F  +  LDKH+ +H+  +E            C+ C   F     +K+H  +       H+ I+  +  +P +R          +  R +    CQ      Q  SQL       +  I    RP             C  C +AF     LR H   HTG+K   C  C   F Q+ ++     ++H +  D   G  + C+ C   F    ++N HI   H++   + +Q +        N       +D      I   A  N      +E+   + N   + T         +  S TD    + +N ++      H  +     +   D  TG ++ H + K  V G R  +C +C K ++K  DL RHIRIHT +KP++C  C ++F +KS L  H K+H  +K++ C  C+K+F+ + +LKVH ++H   K  F C  CD+ F T  H + H   SH + +                     +    + +  S + PD+ PL    L+     I +  +  L N         +R +KC  C + +K   +L +H++ H +      C  C +SFV+   ++ H+RT H   + + CL C + F T  SL RH   HS  +P+ CP C + FK  + C +H+      K  R+      L TG
Sbjct:  117 GKGPFKCETCEKVFPKWPQYQRHMKAHDEDKPFRCPHCAMSFNVVDNLKLHVAT------HVPADGEP----TCPECGKKFSRIASLKAHIMLHEKEENLMCTECGDEFSLQSQLDKHMQEHRQEQE------GMKTYPCRQCTQEFTKPIFLKEHMKQ-------HYRIKSSLAHRPYKR----------NVDRSAFHYKCQHCGKTFQKPSQLQR-----HNLIHTGERP-----------FKCIECDRAFNQKGALRIHMSKHTGLKPHPCDFCPMSFAQRGNLRAHIQRVHTLGRDGEDGPTYQCEECSCVFKKLGSLNAHISRAHQDCGALPTQVEIKPSGPLGNIVNINSVEDMATSDDILRQALENSGLPSGSEVVSGVENVAASGTTTVPVITATSSSSATDPTPIAPDNVVRPPPQYPHNNL---STMTVHDTATGMVKRHVIRK--VNGVRWHQCTYCSKEFKKPSDLVRHIRIHTHEKPYKCTQCFRAFAVKSTLTAHIKTHTGVKDYKCSSCDKLFSTQGSLKVHLRMHTGAK-PFECPQCDKLFRTSAHRKSHIQ-SHFKELQE------------DADGTSKKRAFKRISHKSGDLPDI-PLQEPILITDTGLIQQPSRHNLFNQYLGEAGSVDRPYKCGFCQRGFKKSSHLKQHIRSH-TGEKPFKCLQCTRSFVSSGVLKAHIRT-HTGLKAYKCLICDSTFTTNGSLKRHMSTHSEVRPFMCPYCQKTFKTSVNCKKHM------KTHRHELAIQALQTG 816          

HSP 2 Score: 204.142 bits (518), Expect = 7.789e-49
Identity = 253/1129 (22.41%), Postives = 426/1129 (37.73%), Query Frame = 1
Query:  703 YKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVK-----------------------------------GFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNE-SNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWN--ENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDK-RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLMTGIINRNPIGSLTNQIGQSDLEANDQSETFTAFRLEDLDMNSAQSSNILVTNYVNEFSSFPSTEKYMIVSLDNPNSKDQSGSSQQNYYASNIXXXXXXXXXXARNQIESQTDQSENIMSLLDSGQMGVTPV------------DIGSLFAVQGFNGN--------IATQLVDHGNIQSNDIDYSQPQENIYYYQALNEIPTVECPIECPSKSSLADKFPILKASLFSDDELTSNPKESNPFTNSSMVTNSNGSQFXXXXXXXXXXXXXXXXXXLQSHPEISPI-KFYHGCANCDHQ-FKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSDY 3906
            +KC  C  +F +   +Q H   H  D+   C HC   F     L  H+  H   +             C  C   F  + ++K H +  H K       E G       ++   ++E  +  +   +    Q  + + +     + MK       S   RP K +   +  +  C  CGK F+ P  L+RH + HTG + F+C  C + F QK +++IHM  H  +K                                    + C+ C   F    ++N HI   H++   + +Q +        N       +D      I   A  N      +E+   + N   + T         +  S TD    + +N ++      H  +     +   D  TG ++ H + K  V G R  +C +C K ++K  DL RHIRIHT +KP++C  C ++F +KS L  H K+H  +K++ C  C+K+F+ + +LKVH ++H   K  F C  CD+ F T  H + H   SH + +                     +    + +  S + PD+        L +PI I +    ++ S + LF               N++L E  S +    C FC + F     ++QH+R+ H   + F CLQC   F++   L  H   H+  K Y C +C   F       RH+S     +     + Q    T +  +  + +  +++    L+  DQ +         ++    Q  N+++ N + E      T++ + V    P S  Q    QQ   A++      +       QI  Q  Q     SLL SGQ   + +            DI +  + Q  NGN        +A+Q+    N Q    + +Q        Q   +I  ++        +SL    P             S P+   P + S     S                        Q +  +S   +  H C  C ++ FK    L +H ++ H   + + C  C K F +   L AH KTH+ ++ F C +C   N  F +  SL+RH+ +        ++C+ C++ ++T  +   H KQ   DY
Sbjct:  121 FKCETCEKVFPKWPQYQRHMKAHDEDKPFRCPHCAMSFNVVDNLKLHVATHVPAD---------GEPTCPECGKKFSRIASLKAH-IMLHEKEENLMCTECGDEFSLQSQLDKHMQEHRQEQEGMKTYPCRQCTQEFTKPIFLKEHMKQHYRIKSSLAHRPYKRNVDRSAFHYKCQHCGKTFQKPSQLQRHNLIHTGERPFKCIECDRAFNQKGALRIHMSKHTGLKPHPCDFCPMSFAQRGNLRAHIQRVHTLGRDGEDGPTYQCEECSCVFKKLGSLNAHISRAHQDCGALPTQVEIKPSGPLGNIVNINSVEDMATSDDILRQALENSGLPSGSEVVSGVENVAASGTTTVPVITATSSSSATDPTPIAPDNVVRPPPQYPHNNL---STMTVHDTATGMVKRHVIRK--VNGVRWHQCTYCSKEFKKPSDLVRHIRIHTHEKPYKCTQCFRAFAVKSTLTAHIKTHTGVKDYKCSSCDKLFSTQGSLKVHLRMHTGAK-PFECPQCDKLFRTSAHRKSHIQ-SHFKELQE------------DADGTSKKRAFKRISHKSGDLPDIP-------LQEPILITDTGLIQQPSRHNLF---------------NQYLGEAGSVDRPYKCGFCQRGFKKSSHLKQHIRS-HTGEKPFKCLQCTRSFVSSGVLKAHIRTHTGLKAYKCLICDSTFTTNGSLKRHMSTHSEVRPFMCPYCQKTFKTSVNCKKHMKTHRHELAIQALQTGDQDDNSL------IEHKKEQDQNLVIENQMVELGL---TQQELSV----PTSGAQGDLGQQAILAAD---SLDNFQQALNQQIFGQ--QQTFTQSLLGSGQQNFSQLNSQMHAQASDSNDINAASSNQLTNGNQFNPLNNQVASQVATQLNTQIGGFNQNQFSMQNQSIQGNLDINNLQATFSSQGVTSLTTSLPSTSMQNILPTSELSLPEAEEPESVSETEQPS-------------AVIHRQRIEPEQPYESMSGYGRKSHRCDVCVNKVFKKLSHLKQHYRT-HTGEKPYKCITCEKEFVSSGVLKAHMKTHMGTKDFRCEIC---NAAFTTNGSLTRHMNVHITYTKRPFKCSECDQSFRTASQCKRHEKQHRPDY 1162          

HSP 3 Score: 137.887 bits (346), Expect = 1.506e-28
Identity = 91/319 (28.53%), Postives = 142/319 (44.51%), Query Frame = 1
Query: 1834 GFRRFRCRFCY-KLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEP-DKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL-------SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA---KKCSKKKRNRFQQNDL 2754
            G +  RC  C  K+++K   L +H R HT +KP++C  C K F    VLK H K+H   K+F CEICN  F    +L  H  +H    K  F C  CD+ F T    + H     HR     +P        +       +  +   + NS   P++   +  ++L +       +++               +C HC KS+K    L  H++ H +      C  C++SF    ++  H++T   N +KFSC  C + F TK SL  H  +H+ +KP+ CP C  RF+   +   HI         KK+R+  Q +D+
Sbjct: 1045 GRKSHRCDVCVNKVFKKLSHLKQHYRTHTGEKPYKCITCEKEFVSSGVLKAHMKTHMGTKDFRCEICNAAFTTNGSLTRHMNVHITYTKRPFKCSECDQSFRTASQCKRH--EKQHRPDYGEEPQLPTRTRNKAVIQVSEDPGE---SLNSGQEPEINLSLSEKILMESAKKETPEEKTPEEPDEPSGGKHAHQCPHCPKSFKKPSDLVRHIRIH-TGEKPFACDICSRSFTVKSTLDSHMKTHGANMKKFSCHICGSRFSTKGSLKVHMRLHTGAKPFKCPHCDLRFRTSGHRKSHIVGHLKPDLPKKRRSLLQDDDM 1357          

HSP 4 Score: 78.9518 bits (193), Expect = 1.380e-10
Identity = 46/147 (31.29%), Postives = 75/147 (51.02%), Query Frame = 1
Query: 1786 ETGQIQLHEMIKD----QVTGFRRFRCRFCYKLYRKSCDLTRHIRIHT-------QQKP--FQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIA 2187
            E+  + L + ++     Q +  R++ C  C+K ++++C L  H+ IHT       Q KP   +C  C KSF+  S L+ HF+ H   + F C+ICNK FN K  L +H + H  +K    C  C+  F+   +L+ H   +HH  + 
Sbjct: 1659 ESANVSLSDAVQGEETKQFSSDRQYICGVCHKGFKRACHLKEHMSIHTTPSGGSKQAKPSVHKCTECEKSFQKPSQLERHFRIHTGERPFVCQICNKAFNQKNALNIHIKKHTGEK-PHKCDYCELSFSQKGNLKTHIKRAHHMDMV 1804          

HSP 5 Score: 76.6406 bits (187), Expect = 6.560e-10
Identity = 68/268 (25.37%), Postives = 102/268 (38.06%), Query Frame = 1
Query:  694 EMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKR--------------GRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHD-NVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            E  YKC+ C   F      +AH   H   ++  CE C A F     L +H+N H           T    KC  C   F      K+H  +  P     +  E  +P +   +    + E+                     G S     +P++N S+S++                 +  +    K    C  C K+FK P  L RH   HTG K F C IC + FT KS++  HM  H  N+K F C  CG  F+ + ++  H+++
Sbjct: 1075 EKPYKCITCEKEFVSSGVLKAHMKTHMGTKDFRCEICNAAFTTNGSLTRHMNVHIT--------YTKRPFKCSECDQSFRTASQCKRHEKQHRPD----YGEEPQLPTRTRNKAVIQVSEDP--------------------GESLNSGQEPEINLSLSEKILMESAKKETPEEKTPEEPDEPSGGKHAHQCPHCPKSFKKPSDLVRHIRIHTGEKPFACDICSRSFTVKSTLDSHMKTHGANMKKFSCHICGSRFSTKGSLKVHMRL 1310          

HSP 6 Score: 72.4034 bits (176), Expect = 1.328e-8
Identity = 98/431 (22.74%), Postives = 165/431 (38.28%), Query Frame = 1
Query: 1750 ILLSEDVERIDKETGQIQLHEMIKDQV---TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKL-KEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEID-----KRKLSNNRL-FKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRH-------GLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLMTGIINRNPIGSLTNQIGQSDLEANDQSETFTAFRLEDLDMNSAQSSNILVTNYVNEFSSFPSTEKYMIVSLDNPNSKD 2991
            I+ ++ V+  ++   +++  E  +  +    G   F+C  C K++ K     RH++ H + KPF+C  C  SF +   LK H  +H     E +C  C K F+   +LK H  LHE ++   +C  C   F+    L  H     HR                    Q+ E +K  P          KP+   E + Q   I         KR +  +   +KC HCGK+++    L  H   H +      C  C+++F    +++ H+ ++H   +   C  CP  F  + +L  H       G    +   Y C  C   FK     + HIS            Q    +   +   P G L N +  + +E    S+      LE    NS   S   V + V   ++  +T   +I +  + ++ D
Sbjct:   86 IITTDQVQEAEQAKVKVKTKEPRQPSIKPPVGKGPFKCETCEKVFPKWPQYQRHMKAHDEDKPFRCPHCAMSFNVVDNLKLHVATHVPADGEPTCPECGKKFSRIASLKAHIMLHEKEE-NLMCTECGDEFSLQSQLDKHM--QEHR--------------------QEQEGMKTYPCRQCTQ-EFTKPIFLKEHMKQHYRIKSSLAHRPYKRNVDRSAFHYKCQHCGKTFQKPSQLQRHNLIH-TGERPFKCIECDRAFNQKGALRIHM-SKHTGLKPHPCDFCPMSFAQRGNLRAHIQRVHTLGRDGEDGPTYQCEECSCVFKKLGSLNAHIS---------RAHQDCGALPTQVEIKPSGPLGNIVNINSVEDMATSDDILRQALE----NSGLPSGSEVVSGVENVAASGTTTVPVITATSSSSATD 477          

HSP 7 Score: 67.0106 bits (162), Expect = 5.638e-7
Identity = 38/124 (30.65%), Postives = 63/124 (50.81%), Query Frame = 1
Query: 3553 YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTT----RELDSHVKQLVSDYDA 3912
            +H C  C  +FK    LV H++  H   + + C  C +AF+ K +L AH KTH   + + C    +C++ F +  SL  H+RM  +     + C  C+K+++T+      + SH K+L  D D 
Sbjct:  524 WHQCTYCSKEFKKPSDLVRHIRI-HTHEKPYKCTQCFRAFAVKSTLTAHIKTHTGVKDYKCS---SCDKLFSTQGSLKVHLRM--HTGAKPFECPQCDKLFRTSAHRKSHIQSHFKELQEDADG 641          

HSP 8 Score: 65.855 bits (159), Expect = 1.069e-6
Identity = 32/78 (41.03%), Postives = 44/78 (56.41%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH 1458
            C  C K+F+ P  L RH   HTG + F C IC K F QK+++ IH+  H   K   C +C  +F+ + N+ THIK  H
Sbjct: 1722 CTECEKSFQKPSQLERHFRIHTGERPFVCQICNKAFNQKNALNIHIKKHTGEKPHKCDYCELSFSQKGNLKTHIKRAH 1799          

HSP 9 Score: 64.6994 bits (156), Expect = 2.938e-6
Identity = 35/113 (30.97%), Postives = 58/113 (51.33%), Query Frame = 1
Query: 3547 KFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            K  H C +C   FK    LV H++  H   + F C++C ++F+ K +L +H KTH    +   F C  C  RF +  SL  H+R+  +     ++C HC+  ++T+    SH+
Sbjct: 1229 KHAHQCPHCPKSFKKPSDLVRHIRI-HTGEKPFACDICSRSFTVKSTLDSHMKTH--GANMKKFSCHICGSRFSTKGSLKVHMRL--HTGAKPFKCPHCDLRFRTSGHRKSHI 1336          
BLAST of Zinc finger, C2H2 type vs. TrEMBL
Match: A0A433UDX6 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_000181 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.171e-57
Identity = 212/861 (24.62%), Postives = 351/861 (40.77%), Query Frame = 1
Query:  295 DQVLQLIPQNQISNYIISDKDYSNVTYVNESVINGTNYYDSQN------TTYNQNKYQYDNLDPTVYKTIN---------------GTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMV-VHDNVKG-----FLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHL----LNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTN------ENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGIL----LSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVK--PLIWNELLNQPIPIAE--IDKRKLSNNRLF--------------KCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            +QV  L    Q  + + S  D + V  ++ S+ + +   D         T  NQ   Q   L+P     I                G G   C +C+  F       +H+  H+ D+ ++CS C  S+N E NLL+H+A               + + +C  C   FSR  + +AH ++H+ +E L C  C   F  +  LDKH+  H        R        C+ C+  F  +  +K+H          H+ +   +  +  +R          +  R      C+      Q  SQL+      +  I    RP +           C +C + F     L+ H   HTG +  +C  C + F+QK +++ H+  VH   K      + C+ C   F    ++N HI   H +  +    S + +    L   +  +     D      + S  +       + ++     ++  ++      EN  S  P+   +      SA +    +  KS  GI+        V  +   T Q  L       V G R  +C +C K ++K  DL RHIRIHT +KP++C+ C  +F +KS L  H K+H  +KEF CE+C+K+F+ + +LKVH +LH   K  F C  CD++F T  H + H   SH +   +PD                     +KP +      D +   L+    L +PI I +  + +++  NN +F              +C HC + +K   +L +H++ H +      C  C++SFV+   ++ H RT H   + F C+ C   F T  SL RH   HS  +P+ CP C + FK  + C +H+
Sbjct:   24 NQVAGLDTGIQGLHSLQSLPDGTTVALIDASIFDASQILDHGAIEVQTLTDANQELQQQVVLEPATLHQITLQNPPPEPQDVKPPIGKGPFNCTLCDKVFTKWNQLQRHLKTHDEDKPYRCSQCSQSFNIESNLLLHLA----------THVGPDQDPRCPECGKKFSRVASLKAHIMLHEKEESLMCPECGDEFTVQHQLDKHMEIH--------RSDVVRVHVCRQCNQEFTKMSALKEHMKE-------HYKVRASLSHRSYKR----------NLDRSGFCHKCKHCTKTFQKPSQLER-----HERIHTGERPFE-----------CNICQRTFNQKGALQMHMAKHTGSRPHKCSFCPQSFSQKGNLRAHIKRVHTLNKAECDVVYKCEECSCMFRRLGSLNAHISRAHADQGDSAQASVQDIKTSALPLGDLTDSSILPDMMGLDHVGSGTDLVDPSLGEGQVLHGSLDQVASDILQQALEN--SGLPSTVDDDQDGDVSATSDTGNNISKSGDGIISVSSGGPTVVTVTSRTNQPSLSRQGTMAVNGIRWHQCTYCSKEFKKPSDLVRHIRIHTHEKPYKCHQCFSAFAVKSTLTAHVKTHTGVKEFRCEVCSKMFSTQGSLKVHLRLHTGAK-PFSCTHCDKKFRTSAHCKSHI-MSHFK---DPD---------------------SKPRSRRPFKRDQQQSSLLAEIPLQEPILITDSGLIQQQPKNNGMFPPYTNESGNSERPYRCQHCRRGFKKSSHLKQHIRSH-TGEKPFRCNLCHRSFVSSGVLKAHART-HSGLKSFKCVVCDTMFTTSGSLKRHMSTHSEVRPFMCPYCQKTFKTSVNCKKHM 803          

HSP 2 Score: 162.54 bits (410), Expect = 4.087e-36
Identity = 138/558 (24.73%), Postives = 239/558 (42.83%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRF-------------KKIASLAETNQ-------SPSDDAEITQYLWNENPTNENHFSY-QPNHQSNTDSYIPSAENFIKLDWDKSHQGI-LLSEDVE--------RIDKETG-QIQL--------HEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKL--------------------RFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTAN---SNNPPDVKPLIWNELLNQPIPIA---EIDKRKLSNNRLFK-CNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C +C ++F +  +L+ H  TH+G+K F+C +C   FT   S+K HM  H  V+ F+C +C K F    N   H+K  H++    L+      +N+  +  EE +++                 + IA L    Q       +PSD       L++ N +    F + Q   Q+   + I         + D+ + GI  L ED E         I  E+G Q++          ++      G R FRC+ C K++++S  L++H+R+HT  K  +C  C KSF   +VL+ H + H  L+   C ICN  F+    L+ H   H    +                     + C +C+++F     LR H   S   + + P+ +       +     +  + + +P      S     +   I  E  ++   I+   E++ + +   R    C HC KS+K    L  H++ H +      C+ CN+SF    ++  HL+T   +++ F+C  C + F TK SL  H  +H+ +KP+ C  C +RF+   +   H+
Sbjct:  730 CNLCHRSFVSSGVLKAHARTHSGLKSFKCVVCDTMFTTSGSLKRHMSTHSEVRPFMCPYCQKTFKTSVNCKKHMKT-HRH---ELAMQHYRAVNDPQEGGEEVEEENREDEEVEVVEDVSFQPQTIADLRAVQQLELRHPGTPSDLQVCWYSLYSLNISLRTSFFFAQSFAQAEVGTSIQEENEHEPAEGDEENNGIDQLREDGEIEDSGLLGAIGVESGAQVEAPASLLSGPQQIGAAPTVGRRGFRCQICNKMFKRSGHLSQHMRLHTGTKYLRCPECPKSFSSAAVLRGHLRVHQGLQAHMCSICNAAFSTPGHLRKHMLQHNSQSMLSGSVMLDANSVAAEVMTSEDYTCVLCNQQFRNAAQLRRHVKDS---NASVPETTVIAVRPNDENRAPKRATQRRRPLVQQIVSEEQVSISEKILIESTSEKDRISMPKEVENQSIKRGRFANMCAHCPKSFKKPSDLQRHMRIH-TGEKPFTCKICNRSFTVKSTLDSHLKTHGSSKKTFACHVCQSLFSTKGSLKVHMRLHTGAKPFKCIHCDQRFRTSGHRKSHM 1279          

HSP 3 Score: 93.9745 bits (232), Expect = 3.165e-15
Identity = 45/125 (36.00%), Postives = 70/125 (56.00%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST-------SHHRSIANP 2193
            R +RC+ C + ++KS  L +HIR HT +KPF+C +CH+SF    VLK H ++H  LK F C +C+ +F    +LK H   H   +  F+C  C + F T  + + H  T        H+R++ +P
Sbjct:  698 RPYRCQHCRRGFKKSSHLKQHIRSHTGEKPFRCNLCHRSFVSSGVLKAHARTHSGLKSFKCVVCDTMFTTSGSLKRHMSTHSEVR-PFMCPYCQKTFKTSVNCKKHMKTHRHELAMQHYRAVNDP 821          

HSP 4 Score: 80.1073 bits (196), Expect = 5.416e-11
Identity = 73/322 (22.67%), Postives = 128/322 (39.75%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTI----KLYAQGRSQLDE--MKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNV-KGFLCQFCGKAFTYEHNMNTHIKV 1452
            C+IC   F       +HM +H   +  +C  C  S++    L  H+ +    +            + C IC+  FS     + H L H            ++    V+LD     + +  E     +T+    C +C+  F N   +++H       ++   P    + V+P +    P    ++        ++ + +    K+  +  S+ D   M  +V     KRGR            + CA C K+FK P  L+RH   HTG K F C IC + FT KS++  H+  H +  K F C  C   F+ + ++  H+++
Sbjct:  974 CQICNKMFKRSGHLSQHMRLHTGTKYLRCPECPKSFSSAAVLRGHLRVHQGLQA-----------HMCSICNAAFSTPGHLRKHMLQHNSQ---------SMLSGSVMLDA----NSVAAEV----MTSEDYTCVLCNQQFRNAAQLRRHV----KDSNASVPETTVIAVRPNDENRAPKRATQRRRPLVQQIVSEEQVSISEKILIESTSEKDRISMPKEVENQSIKRGR----------FANMCAHCPKSFKKPSDLQRHMRIHTGEKPFTCKICNRSFTVKSTLDSHLKTHGSSKKTFACHVCQSLFSTKGSLKVHMRL 1253          

HSP 5 Score: 72.7886 bits (177), Expect = 8.407e-9
Identity = 33/78 (42.31%), Postives = 45/78 (57.69%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH 1458
            C VC KAF+ P  L RH   HTG + F C IC K F QK+++++H+  H   K  +C +C  +F    N+ THIK  H
Sbjct: 1827 CMVCFKAFQKPSQLERHMRIHTGERPFTCEICSKSFNQKNALQVHLRKHSGEKPHVCPYCSASFVQSGNLKTHIKRAH 1904          

HSP 6 Score: 70.0922 bits (170), Expect = 6.185e-8
Identity = 60/241 (24.90%), Postives = 97/241 (40.25%), Query Frame = 1
Query: 1576 ETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDS----YIPSAENFIKLDWDKSHQGILLSEDVER---IDKETGQIQLHEMIKD--------QVTGFRRFR--------CRFCYKLYRKSCDLTRHIRIH-------------TQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIAN 2190
            + ++S +DD   + Y+      N+ H     N  S  D      +P  +  +       HQ   +  D E    ++    Q Q HE   D        QV G  + +        C  CYK ++++  L  H+  H              +  P  C +C K+F+  S L+ H + H   + F+CEIC+K FN K  L+VH + H  +K   VC  C   F    +L+ H   +HH  + +
Sbjct: 1672 QLSKSEADDMASSSYMAQPGGQNQQH-DLGLNKISEVDEEDKYMLPGDDQRMVAISALEHQAPGIDHDEEEGTGVESNQDQPQHHEDQVDTAALIPTAQVVGLEKQQDGAERNNVCGICYKGFKRAAHLRDHMATHGSAVGQVGVMGKKMRTTPHTCMVCFKAFQKPSQLERHMRIHTGERPFTCEICSKSFNQKNALQVHLRKHSGEK-PHVCPYCSASFVQSGNLKTHIKRAHHTDMVS 1910          

HSP 7 Score: 68.9366 bits (167), Expect = 1.485e-7
Identity = 38/109 (34.86%), Postives = 59/109 (54.13%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C +C   FK S  L +H++S H   + F CN+CH++F +   L AH++TH   +SF C V   C+  F +  SL RH  M  +  +  + C +C K +KT+     H+K
Sbjct:  702 CQHCRRGFKKSSHLKQHIRS-HTGEKPFRCNLCHRSFVSSGVLKAHARTHSGLKSFKCVV---CDTMFTTSGSLKRH--MSTHSEVRPFMCPYCQKTFKTSVNCKKHMK 804          

HSP 8 Score: 68.5514 bits (166), Expect = 1.912e-7
Identity = 39/120 (32.50%), Postives = 62/120 (51.67%), Query Frame = 1
Query: 3553 YHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSDYDA 3912
            +H C  C  +FK    LV H++  H   + + C+ C  AF+ K +L AH KTH   + F C V   C++ F +  SL  H+R+  +     + CTHC+K ++T+    SH+     D D+
Sbjct:  528 WHQCTYCSKEFKKPSDLVRHIRI-HTHEKPYKCHQCFSAFAVKSTLTAHVKTHTGVKEFRCEV---CSKMFSTQGSLKVHLRL--HTGAKPFSCTHCDKKFRTSAHCKSHIMSHFKDPDS 641          

HSP 9 Score: 63.929 bits (154), Expect = 4.166e-6
Identity = 35/113 (30.97%), Postives = 61/113 (53.98%), Query Frame = 1
Query: 3547 KFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            +F + CA+C   FK    L  H++  H   + FTC +C+++F+ K +L +H KTH  S+    F C  C   F +  SL  H+R+  +     ++C HC++ ++T+    SH+
Sbjct: 1172 RFANMCAHCPKSFKKPSDLQRHMRI-HTGEKPFTCKICNRSFTVKSTLDSHLKTHGSSKK--TFACHVCQSLFSTKGSLKVHMRL--HTGAKPFKCIHCDQRFRTSGHRKSHM 1279          

HSP 10 Score: 63.5438 bits (153), Expect = 5.500e-6
Identity = 44/161 (27.33%), Postives = 76/161 (47.20%), Query Frame = 1
Query: 2326 NQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA--KKCSKKKRNRF------QQNDLMTGIINRNPI 2784
            NQP  ++      ++  R  +C +C K +K    L  H++ H +      C  C  +F    ++  H++T H   ++F C  C   F T+ SL  H  +H+ +KP++C  C ++F+   +C  HI +  K    K R+R       QQ+ L+  I  + PI
Sbjct:  511 NQP-SLSRQGTMAVNGIRWHQCTYCSKEFKKPSDLVRHIRIH-THEKPYKCHQCFSAFAVKSTLTAHVKT-HTGVKEFRCEVCSKMFSTQGSLKVHLRLHTGAKPFSCTHCDKKFRTSAHCKSHIMSHFKDPDSKPRSRRPFKRDQQQSSLLAEIPLQEPI 668          
BLAST of Zinc finger, C2H2 type vs. TrEMBL
Match: A0A3L8DHJ1 (Uncharacterized protein OS=Ooceraea biroi OX=2015173 GN=DMN91_008446 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.370e-57
Identity = 281/1119 (25.11%), Postives = 468/1119 (41.82%), Query Frame = 1
Query:  298 QVLQLIPQNQISNYIISDKDYSNVTYVNESVI--------NGTNYYDSQNTTYNQNKYQYDNLDPTVYKTI----NGTGKQT-----------CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMV-VHDNVKG---FLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLS-QSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETG-QIQLHEMIKDQVTG-FRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH-EPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPT--ANSNNPPDV--KPLIWNELLNQPIPIAEIDKRK------LSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRN-----RFQQNDLMTGIINRNPIGSLTNQIGQS-DLEANDQSET---FT-AFRLEDLDMNSAQSSNILVTNYVNEFSSFPSTEKYMIVSLDNPNSKDQSGSSQQNYYASNIXXXXXXXXXXARNQIESQTDQSENIMSLLDSGQMGVTPVDI--------GSLFAVQ---GFNGNIATQLVDHGNIQSNDIDYSQPQENIYYY-----QALNEIPTVECPIECPSKSSLADKFPILKASLFSDDELTSNPKESNPFTNSSMVTNSNG 3453
            Q   L+P  Q  N  +       V  +NES+         N  N    +     ++ Y  D L P   + +     G  K+T           C+IC  EF  +  Y +HM  H  ++  +C  C  S+N   N  +H+A  +T +             KC  C   ++R  + ++H L+H+ +E L C  C   F  K  LD HL  H  GE    +  + +  KCK+C+  F     V+    R H              ++   R+ T I ++ K   +  +   C       Q  SQL  M+   +  +    +P             C VC +AF     L+ H   H GI+   C +C   F+QK ++K H++ VH+  +G   + C +C   F    ++N HIK +H N  E L+ +S E   N S++ +     D +   ++ASL     S +++ + T  L   N    N        Q+  +S +P+       +  +  +    +  V  +DK  G   + +  IK +  G  R + C FC K ++K  DL RH+R+HTQ+KPF+C  C +SF LKS ++ H ++H   K+++C  C+K F    +L  H +LH +P K    C ICD+ F+    L+ H   SH R                          K+K T  A S  P  V  +PLI ++  N  I +A++  ++      +  +R  +C  C  +++   +L +HL+ H +      C  C+++F +   ++ HL T H + R +SC  C   F T++S+ RH + HSN +P+ CP C + FK  + C +H+   K    +R        +QN   +   ++ P  +L+  I  + D+E + Q +    FT AF  +  ++++ +  + L+T+         S      +S+D  N     G+SQ  +                        D++  I     SG   +TP  I          LF +    G   N+  Q+ D  N+ S D    QP  NIY +      + N I T           S  D F + + +L +D+E+      SN  + SS++  S G
Sbjct:   95 QQTNLLPVQQFDNASVIVDQMKVVQNMNESITAEPLLSVNNTDNMLSDKREQETEDNYAKDELAPVSIQNLCKRSPGRPKKTGVTSQNTRPLKCDICRQEFTKQTLYRRHMENHAEEKPHRCPKCPASFNIPTNFTLHMATHNTGD------------PKCPECGRKYARMASLKSHMLLHEKEENLFCTECEDAFSTKAQLDAHLKLH--GE----KWASEDVRKCKLCNKQF-----VQPALYRLH--------------IREHYRLQTKIVKQTKRGTKHKTMYKCTICLKSFQKPSQL--MR---HIRVHTGEKP-----------FKCTVCNRAFTQKSSLQIHMWQHNGIRPHTCSLCNAKFSQKGNLKAHILRVHNAPEGEPTYACSYCSCIFKKLGSLNGHIKRMHSNSQEELAIKSSEVNSNISSEADMRATVD-SVISQLASLESAVGSVNNNTDSTAVL-TMNVEQNNIL-----QQALKNSGLPNKNEVTSKESAEIKKTDSPTTYVTLLDKTAGVTARKYLTIKQRCIGNIRWYACSFCPKEFKKPSDLIRHLRVHTQEKPFKCMYCVRSFALKSTMRAHERTHTGTKKYACSSCDKTFACHSSLTAHMRLHTKPHK----CNICDKSFSASTILKNHMK-SHTRE-------------------------KSKITLEAESLVPQVVLQEPLIISDTGN-IISVAQVQSKQKQLYDNVGVSRPHECLFCHAAFRKVSHLKQHLRRH-TGERPYKCAKCDRTFTSNSVLKSHLHT-HDDARPYSCSVCNTKFSTQSSMKRHLVTHSNKRPFMCPYCHKTFKTYVNCRKHMKIHKHELAQRQLEEQKTQEQNRQQSLSQDKEPTATLSEGIALAEDMEVSFQPQMAPDFTQAFSDQFQNISAEKEKSFLLTDTTT------SAIANQNLSVDTTN----LGTSQTLH-----------------------ADETGTITLPHYSGDQTLTPESIREIEETLNQQLFNIGVNLGLGNNLPRQM-DETNVSSLDSSREQPVLNIYEHNKSLDSSGNTIFT-----------SQFDSFDMSQITLQTDNEIDIGLNPSNTTSMSSILPRSLG 1075          

HSP 2 Score: 112.464 bits (280), Expect = 7.297e-21
Identity = 90/313 (28.75%), Postives = 129/313 (41.21%), Query Frame = 1
Query: 1225 CAVCG-KAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKS-HQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYH 2157
            C +CG + F T  L + H  +H G KE++C  C   F     +  HM +H N + + C  C K       +  H K +H     + S   +                       +S  E   S SD + IT                                  ++LD D S  Q +L+    ER         + +  K + T     +C++C K +RK  DL RHIR HT ++P++C  C+KSF +K  L +H K H   K F C +CN +F  K +LKVH +LH   K  F C ICD RF T  H + H
Sbjct: 1203 CHMCGDQGFMTEDL-KEHLKSHRGDKEYQCSECSLRFCTNGGLSRHMKMHTNKQQWKCMTCQKVLDSRLQLKLHSK-VHTEAWNISSMEAD-----------------------SSQKELISSNSDLSSITTL-------------------------------DVQLDPDSSVSQKVLMDAVAEREIMGYPDENMKKKEKREYTN----KCKYCPKTFRKPSDLIRHIRTHTGERPYKCDHCNKSFAVKCTLDSHMKVHTGKKTFCCHVCNSMFATKGSLKVHMRLHTGSK-PFKCPICDLRFRTSGHKKVH 1454          

HSP 3 Score: 94.7449 bits (234), Expect = 2.222e-15
Identity = 70/276 (25.36%), Postives = 122/276 (44.20%), Query Frame = 1
Query: 1930 FQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVC----KICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIP-IAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKA----KIYCDRHISAKKCSKKKR 2730
             QC+MC     +   LK H KSH   KE+ C  C+  F     L  H ++H  +K ++ C    K+ D R     H + H    +  S+                S      ++  P ++ +    +  +   E++  P   + + +KR+ +N    KC +C K+++    L  H++ H +      C  CNKSF    ++  H++  H  ++ F C  C + F TK SL  H  +H+ SKP+ CP+C  RF+     K++  +H+   K   K++
Sbjct: 1201 LQCHMCGDQGFMTEDLKEHLKSHRGDKEYQCSECSLRFCTNGGLSRHMKMHT-NKQQWKCMTCQKVLDSRLQLKLHSKVHTEAWNISSMEADSSQKELISSNSDLSSITTLDVQLDPDSSVSQKVLMDAVAEREIMGYPDENMKKKEKREYTN----KCKYCPKTFRKPSDLIRHIRTH-TGERPYKCDHCNKSFAVKCTLDSHMKV-HTGKKTFCCHVCNSMFATKGSLKVHMRLHTGSKPFKCPICDLRFRTSGHKKVHLLKHVREHKGGAKRK 1469          

HSP 4 Score: 66.6254 bits (161), Expect = 7.942e-7
Identity = 28/79 (35.44%), Postives = 46/79 (58.23%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHK 1461
            C VCGK F  P  + RH+  HTG + ++C +C K F QK ++ +H   H   + + C  C  +FT + N+ TH++ +H+
Sbjct: 1704 CDVCGKTFTKPYQMERHKRIHTGERPYKCELCGKSFAQKFTLHLHQKHHTGDRPYPCPHCKHSFTQKCNLQTHLRRVHQ 1782          

HSP 5 Score: 65.0846 bits (157), Expect = 1.907e-6
Identity = 69/243 (28.40%), Postives = 107/243 (44.03%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGEL------SSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 4950
            Y+CS C K F + S+L +HL VHT+ +P++C  C + F  + +++ HE T H+  TK   C  C K      +L  H++LH + +   C +C K F     L  H+ + H    S I    E   P   L      S T         Q +QK + + +     +  +CL C   F   +    H       E+ +    CD+TF S S    H+   H+    Y+C+ CN  F+ +SS   H
Sbjct:  581 YACSFCPKEFKKPSDLIRHLRVHTQEKPFKCMYCVRSFALKSTMRAHERT-HTG-TKKYACSSCDKTFACHSSLTAHMRLHTKPHK--CNICDKSFSASTILKNHM-KSHTREKSKITLEAESLVPQVVLQEPLIISDTGNIISVAQVQSKQKQLYDNVG--VSRPHECLFCHAAFRKVSHLKQHL-RRHTGERPYKCAKCDRTFTSNSVLKSHLH-THDDARPYSCSVCNTKFSTQSSMKRH 814          
BLAST of Zinc finger, C2H2 type vs. Ensembl Cavefish
Match: ENSAMXT00000032021.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001278.1:8613:15541:1 gene:ENSAMXG00000037885.1 transcript:ENSAMXT00000032021.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.91 bits (385), Expect = 8.173e-37
Identity = 180/759 (23.72%), Postives = 291/759 (38.34%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNE----CTVVNDS-NQ-------------EMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTN----ENHFSYQPN---HQSNTDSYIP-----SAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDK--RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C  C   F ++    KH  IH  ++ + CS C  S+N + +L  H   IHT E    C+    S NQ             E  Y C  C   F+ +   + H  IH  ++   C  C   F  +  L  H   H  GE+            C  C   F    N+K H             I  G  +            +    K +      +       G+S   +    +++ I    +P             C+ CGK+F T   L++H+  HTG K + C  C K FT++S++KIH  +H   K + C  CG++FT + N+  H ++         S   +    +S+  + +      +    +   ++  + SD  +  +    E P +       F+ Q N   HQ       P       ++F      K HQ I   E      D  +   +   +++H+ I    TG + + C  C K + K  +L  H RIHT +KP+ C  C KSF  +S LK H + H   K + C  C K F  +  LK H+++H  +K  + C  C + F T   L+      H R      P                +S +   T         KP   ++        +++ K  R  +  + + C+ CGKS+  +  L +H + H +      C  C KSF T   +++H R  H   + + C  C   F T++ L +H  +H+  KPY C  C + F
Sbjct:   32 CSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFNQQSHLKSH-QRIHTGEKPYHCSDCGRSFNQQSHLKSHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFNQQSNLKSHQRIH-TGEK---------LHHCSDCGKSFTKQSNLKIH-----------QRIHTGEKLHHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYH-----------CSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGRSFTKQSNLKIHQRIHTGEKLHHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIH---TGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKP-YHCSDCGKSFTTQSDLK-----KHQRIHTGEKPYHCSDCGKSFTKQSNLKSHQRIHTGE-------KPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIH-TGEKPYHCSDCGKSFTTQSDLKKHQRI-HTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSF 739          

HSP 2 Score: 151.369 bits (381), Expect = 2.551e-36
Identity = 179/760 (23.55%), Postives = 290/760 (38.16%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNE----CTVVNDS--------------NQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTN----ENHFSYQPN---HQSNTDSYIP-----SAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNEL---LNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C  C   F ++    KH  IH  ++ + CS C  S+  + NL +H   IHT E    C+    S                E  Y C  C   F+++   + H  IH  ++   C  C   F  +  L  H   H  GE+            C  C   F    ++KKH             I  G               +    K +      +       G+S   +    +++ I    +P             C+ CGK+F T   L++H+  HTG K + C  C K FT++S++KIH  +H   K + C  CGK+FT + N+  H ++         S   +    +S+  + +      +    +   ++  + SD  +  +    E P +       F+ Q +   HQ       P       ++F K    KSHQ I   E      D  +       ++ H+ I    TG + + C  C K +    DL +H RIHT +KP+ C  C KSF  +S LK H + H   K + C  C K F  +  LK H+++H  +K  + C  C + F T   L+      H R      P           +    +  +   T         KP   ++     NQ   +    +R  +  + + C+ CGKS+  +  L +H + H +    + C  C KSF    +++ H R  H   + + C  C   F T++ L +H  +H+  KPY C  C + F
Sbjct:  200 CSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKIH-QRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGRSFTKQSNLKIHQRIH-TGEK---------LHHCSDCGKSFTTQSDLKKH-----------QRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYH-----------CSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKSHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIH---TGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKP-YHCSDCGKSFTTQSDLK-----KHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGE-------KPYHCSDCGKSFNQQSHLKS-HQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIH-TGEKLHHCSDCGKSFTKQSNLKIHQRI-HTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSF 907          

HSP 3 Score: 142.895 bits (359), Expect = 8.991e-34
Identity = 129/509 (25.34%), Postives = 212/509 (41.65%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNEN---HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSN------NPPDVKPLIWNELLNQPIPIAE------------IDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C+ CGK+F T   L++H+  HTG K + C  C K FT +S +K H  +H   K + C  CGK+FT + N+ +H ++         S   +    +S         D  + ++I     T + P   ++  +    ++   ++   H   +P H S+        ++F      K HQ I   E      D  +       ++ H+ I    TG + + C  C K +    DL +H RIHT +KP+ C  C KSF  +S LK H + H   K + C  C K FN +  LK H+++H  +K  + C  C + F T   L+ H        + +            +  + Q      KP   S+         D+K         +P   ++            I +R  +  +L  C+ CGKS+  +  L +H + H +      C  C KSF     +++H R  H   + + C  C   F T++ L +H  +H+  KPY C  C + F
Sbjct:  536 CSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKSHQRIHTGEKPYHCSDCGKSFTTQS---------DLKKHQRI----HTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDC------GKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIH---TGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFNQQSHLKSHQRIHTGEKP-YHCSDCGKSFTTQSDLKKHQRIHTGEKLHHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKLHHCSDCGKSFTTQSDLKKHQRIH-TGEKPYHCSDCGKSFTKQSDLKKHQRI-HTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSF 1019          

HSP 4 Score: 140.584 bits (353), Expect = 5.784e-33
Identity = 125/491 (25.46%), Postives = 203/491 (41.34%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNEN---HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C+ CGK+F T   L++H+  HTG K + C  C K FT +S +K H  +H   K + C  CGK+FT + ++  H ++         S   +    +SN              K      T + P   ++  +    ++   ++   H   +P H S+        ++F      K HQ I   E      D  +       ++ H+ I    TG + + C  C K +    DL +H RIHT +KP+ C  C KSF  +S LK H + H   K + C  C K F  +  LK H+++H  +K  + C  C + FN   HL+     SH R      P           +    +  +   T    +        + +  N      +I +R  +  + + C+ CGKS+  +  L +H + H +      C  C KSF    +++ H R  H   +   C  C   F T++ L +H  +H+  KPY C  C + F
Sbjct:  508 CSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNL-------------KSHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDC------GKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIH---TGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKP-YHCSDCGKSFNQQSHLK-----SHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKLHHCSDCGKSFTKQSN-----LKIHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIH-TGEKPYHCSDCGKSFTKQSNLKIHQRI-HTGEKLHHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSF 963          

HSP 5 Score: 107.842 bits (268), Expect = 6.523e-23
Identity = 116/486 (23.87%), Postives = 183/486 (37.65%), Query Frame = 1
Query: 1240 KAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNEN---HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            K+F     L++H+  HTG K + C  C K FT +S +K H  +H   K + C  CGK+F    N  +H+                                     K      T + P   ++  +    ++    +   H   +P H S+        ++F      K HQ I   E      D  +   +   ++ H+ I    TG +   C  C K + K  +L  H RIHT +K   C  C KSF  +S LK H + H   K + C  C K F  +  LK+H+++H  +K  + C  C + F T   L+      H R      P                       T  SN                     +I +R  +  + + C+ CG+S+  +  L  H + H +    + C  C KSF T   +++H R  H   + + C  C   F T++ L +H  +H+  KPY C  C + F
Sbjct:    9 KSFTKQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSF----NQQSHL-------------------------------------KSHQRIHTGEKPYHCSDCGRSFNQQSHLKSHQRIHTGEKPYHCSDC------GKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFNQQSNLKSHQRIH---TGEKLHHCSDCGKSFTKQSNLKIHQRIHTGEKLHHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKP-YHCSDCGKSFTTQSDLK-----KHQRIHTGEKPYHCSDCGKSF-------------TKQSN--------------------LKIHQRIHTGEKPYHCSDCGRSFTKQSNLKIHQRIH-TGEKLHHCSDCGKSFTTQSDLKKHQRI-HTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSF 403          

HSP 6 Score: 70.4774 bits (171), Expect = 1.511e-11
Identity = 68/245 (27.76%), Postives = 99/245 (40.41%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP-----AGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F + SNL+ H  +HT  +PY C  C K F  +  LK H+     +  K   C  C K   +Q  L+ H ++H  E   HC  C K F  Q DL +H            + +  G KP      G+  +T +              K       +K   C  C   F T++    H  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F Q+S   +HQ+
Sbjct:  589 PYHCSDCGKSFTKQSNLKSHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRI--HTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKH------------QRIHTGEKPYHCSDCGKSFTTQSDLK-----------KHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSD-CGKSFTTQSDLKKH-QRIHTGEKPYHCSDCGKSFNQQSHLKSHQR 806          

HSP 7 Score: 68.5514 bits (166), Expect = 5.563e-11
Identity = 70/251 (27.89%), Postives = 102/251 (40.64%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPE-------GRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   S+L++H  +HT  +PY C  C K F  +  LK+H+     +  K   C  C +    Q  L++H ++H  E   HC  C K F  Q DL +    H  EK    S C +   +        R   GE     +       +Q    I + I    +KL  C  C   F T++    H  +    +  H +  C K+F   S    H Q +H     Y+C+ C   F  +S    HQ+
Sbjct:   29 PYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFNQQSHLKSHQRI--HTGEKPYHCSDCGRSFNQQSHLKSHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFNQQSNLKSHQRIHTGEKLHHCSDCGKSFTKQSNLKIHQRI-HTGEKLHHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSD-CGKSFTKQSNLKIH-QRIHTGEKPYHCSDCGKSFTTQSDLKKHQR 274          

HSP 8 Score: 67.781 bits (164), Expect = 9.011e-11
Identity = 66/245 (26.94%), Postives = 99/245 (40.41%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP-----AGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   S+L++H  +HT  +PY C  C K F  + +LK+H+     +  K   C  C K   +Q  L+ H ++H  E   HC  C K F  Q DL +H            + +  G KP      G+  +T +              K       +K   C  C   F T++    H  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F  +S    HQ+
Sbjct:  561 PYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKSHQRI--HTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKH------------QRIHTGEKPYHCSDCGKSFTTQSDLK-----------KHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSD-CGKSFTTQSDLKKH-QRIHTGEKPYHCSDCGKSFTTQSDLKKHQR 778          

HSP 9 Score: 67.3958 bits (163), Expect = 1.222e-10
Identity = 69/242 (28.51%), Postives = 99/242 (40.91%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP--AGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K FN+ S+L+ H  +HT  +PY C  C K F  +  LK H+     +  KL  C  C K    Q  L+ H ++H  E   HC  C K F  Q DL +H            + +  G KP    +   + T   +         I + I    +KL  C  C   F T++    H  +    +  H +  C K+F   S    H Q +H     Y+C+ C   F  +S    HQ+
Sbjct:  785 PYHCSDCGKSFNQQSHLKSHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRI--HTGEKLHHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTTQSDLKKH------------QRIHTGEKPYHCSDCGKSFTKQSNLK-------IHQRI-HTGEKLHHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSD-CGKSFTKQSDLKKH-QRIHTGEKPYHCSDCGKSFTTQSDLKKHQR 1002          

HSP 10 Score: 66.2402 bits (160), Expect = 3.206e-10
Identity = 66/245 (26.94%), Postives = 98/245 (40.00%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP-----AGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F + SNL+ H  +HT  +PY C  C K F  + +LK H+     +  K   C  C K   +Q  L+ H ++H  E   HC  C K F  Q DL +H            + +  G KP      G+  +T +              K       +K   C  C   F  ++   +H  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F  +S    HQ+
Sbjct:  449 PYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRI--HTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKH------------QRIHTGEKPYHCSDCGKSFTTQSDLK-----------KHQRIHTGEKPYHCSDCGKSFTKQSNLKSHQRIHTGEKPYHCSD-CGKSFTTQSDLKKH-QRIHTGEKPYHCSDCGKSFTTQSDLKKHQR 666          

HSP 11 Score: 65.4698 bits (158), Expect = 4.853e-10
Identity = 67/242 (27.69%), Postives = 101/242 (41.74%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP--AGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F + SNL+ H  +HT  +PY C  C + F  + +LK H+     +  KL  C  C K   +Q  L+ H ++H  E   HC  C K F  Q DL +H            + +  G KP    +   + T   +         I + I    +K   C  C   F T++    H  +    +  H +  C K+F   S    H Q +H     Y+C+ C   F ++S+   HQ+
Sbjct:  281 PYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGRSFTKQSNLKIHQRI--HTGEKLHHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKH------------QRIHTGEKPYHCSDCGKSFTKQSNLK-------IHQRI-HTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSD-CGKSFTKQSNLKIH-QRIHTGEKPYHCSDCGKSFTKQSNLKIHQR 498          

HSP 12 Score: 65.0846 bits (157), Expect = 7.728e-10
Identity = 72/256 (28.12%), Postives = 99/256 (38.67%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLP------------EGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   S+L++H  +HT  +PY C  C K F  +  LK H+     +  K   C  C K   +Q  L+ H ++H  E   HC  C K F  Q DL +    H  EK    S C +                G KP    S      +   H +  + I        +K   C  C   F T++    H  +    EK H    C K+F   S    H Q +H     Y+C+ C   F  +S    HQ+
Sbjct:  645 PYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRI--HTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPY-HCSDCGKSFNQQSHLKSHQRI-----HTGEKPYHCSDCGKSFTTQSDLKKHQRIHT-GEKLHHCSDCGKSFTKQSNLKIH-QRIHTGEKPYHCSDCGKSFTTQSDLKKHQR 890          

HSP 13 Score: 63.1586 bits (152), Expect = 2.657e-9
Identity = 67/242 (27.69%), Postives = 101/242 (41.74%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP--AGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   S+L++H  +HT  +PY C  C K F  + +LK+H+     +  KL  C  C K    Q  L+ H ++H  E   HC  C K F  Q DL +H            + +  G KP    +   + T   +         I + I    +K   C  C   F T++    H  +    +  H +  C K+F   S    H Q +H     Y+C+ C   F ++S+   HQ+
Sbjct:  113 PYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFNQQSNLKSHQRI--HTGEKLHHCSDCGKSFTKQSNLKIHQRIHTGEKLHHCSDCGKSFTTQSDLKKH------------QRIHTGEKPYHCSDCGKSFTKQSNLK-------IHQRI-HTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSD-CGKSFTKQSNLKIH-QRIHTGEKPYHCSDCGRSFTKQSNLKIHQR 330          

HSP 14 Score: 62.7734 bits (151), Expect = 3.454e-9
Identity = 65/245 (26.53%), Postives = 96/245 (39.18%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP-----AGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   S+L++H  +HT  +PY C  C K F  +  LK H+     +  K   C  C K   +Q  L+ H ++H  E   HC  C K F  Q +L  H            + +  G KP      G+  +T +              K       +K   C  C   F T++    H  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F  +S    HQ+
Sbjct:  505 PYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRI--HTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKSH------------QRIHTGEKPYHCSDCGKSFTTQSDLK-----------KHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSD-CGKSFTTQSDLKKH-QRIHTGEKPYHCSDCGKSFTTQSDLKKHQR 722          

HSP 15 Score: 62.003 bits (149), Expect = 5.738e-9
Identity = 69/261 (26.44%), Postives = 104/261 (39.85%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLS----RHVDEKHAASSSCIEGLPE------------GRKP-----AGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   S+L++H  +HT  +PY C  C K F  + +LK H+     +  K   C  C K   +Q  L+ H ++H  E   HC  C K F  Q +L      H  EK    S C +   +            G KP      G+  +T +              K       +K   C  C   F T++    H  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F ++S+  +HQ+
Sbjct:  365 PYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRI--HTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTTQSDLK-----------KHQRIHTGEKPYHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSD-CGKSFTTQSDLKKH-QRIHTGEKPYHCSDCGKSFTKQSNLKSHQR 610          

HSP 16 Score: 58.151 bits (139), Expect = 9.920e-8
Identity = 60/242 (24.79%), Postives = 90/242 (37.19%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP--AGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F + SNL+ H  +HT  +PY C  C K F                               +Q  L+ H ++H  E   HC  C K F  Q +L  H            + +  G KP    +   + T   +         I + I    +KL  C  C   F T++    H  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F ++S+   HQ+
Sbjct:  225 PYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSF------------------------------TTQSDLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKIH------------QRIHTGEKPYHCSDCGRSFTKQSNLK-------IHQRI-HTGEKLHHCSDCGKSFTTQSDLKKHQRIHTGEKPYHCSD-CGKSFTTQSDLKKH-QRIHTGEKPYHCSDCGKSFTKQSNLKIHQR 414          
BLAST of Zinc finger, C2H2 type vs. Ensembl Cavefish
Match: ENSAMXT00000049921.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000553.1:32346:35546:-1 gene:ENSAMXG00000035437.1 transcript:ENSAMXT00000049921.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 2.818e-35
Identity = 144/557 (25.85%), Postives = 221/557 (39.68%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKN---------GTEVLSQS--QEHLLNESNXXXXXXQKDPNRFKKIASLAE-----TNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTD-SYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQV-------------------------TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHY-----STSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRL------------FKCNHCGKSYKFKKY-LNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            C+VCGK+F  P  L+RH+  HTG K + C +C   F QKSS++ H  +H   K + C  CGK+F  + ++  H + IH           G   + QS  Q+H    + +           F K + L       T + P   ++  +    ++   +    +Q  H   T        +NF K    + HQ I   E      D  +     G +Q H+ I                             TG + + C  C   + +   L RH  IHT +KP+ C  C  +F  K  L+ H + H   K + C +C K F  +  LK H+++H  +K  + C +C +RF T  HL+ H         HH S+                              +   P D++   +     +P   ++  K  +  + L            F+C  CGK++ +K+Y L +H   H      + C  C KSF T   +QQH R  H   R + CL C   F  K+SL RH  +H+  KPY C  C   F+ KI  +RH
Sbjct:  173 CSVCGKSFTKPSDLQRHKYIHTGEKPYCCSVCGMNFHQKSSLERHQGIHTGEKPYHCSVCGKSFIKQSDLQQHQR-IHTGEKPYHCSVCGKSFIKQSDLQQHQRIHTGEKPHHCSVCGKSFTKPSDLQRHKYIHTGEKPYHCSDCGKGFIKQSDLQQ----HQRIHTGETPFQCTECGKNFYKQYNLQQHQLIHTGEKPFHCLDCGKSFTTQGNLQQHKRIHTGEKPYCCSVCGMNFHQKSSLERHQGIHTGEKPYYCSACGMNFHQKSSLERHQGIHTGEKPYYCSACGMNFHQKITLERHQRIHTGEKPYHCSVCGKRFTTQSHLKTHQRVHTGEKP-YHCSVCGKRFTTQSHLKIHQRIHTGEKPHHCSVCG---------------------------KSFTKPSDLQRHKYIHTGEKPYHCSDCGKSFIKQSDLQQHQRIHTGETPFQCTECGKNF-YKQYNLQQHQLIHTGEKPFH-CLDCGKSFTTQGHLQQHKRI-HTGERPYCCLVCGMNFNQKSSLERHQGIHTGEKPYYCSACGMNFRQKITLERH 693          

HSP 2 Score: 139.428 bits (350), Expect = 1.139e-32
Identity = 179/761 (23.52%), Postives = 285/761 (37.45%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEE------CDDRKLTTNYLK-------------CKICHDIFENVGNVKKH-YVRCHPKTSGHWPIE------------DGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCA-VCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQ-------IQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C +C + F  K +  +H  IH  ++ + CS C ++++ + +L  H   IHT           E  Y C  C   F +K   + H  IH  ++   C  C   F  +  L  H   H  GE+      C  R  T ++LK             C +C   F    ++++H Y+      +G  P              D    + +    TP  +  +  K    +   Q  +L   G      +  D  +S + +G  ++     T     C  VCG  F     L RH+  HTG K + C  C   F QK +++ H  +H   K + C  CGK FT + ++ TH +V    G +                               S+   + +   D +  +Y+         H   +P H S         + FIK    + HQ I   E   +   E G+       +Q H++I    TG R + C  C + + +   L RH  IH  +KP+ C  C KSF  +SVL+ H + H   K + C +C K F  +  LK+H+++H  +K    C +C + F     L+      H R      P                      P    N         +N   +Q I   E         + F C  CGKS+  + +L +H + H +      C  C  +F    S+++H    H   + + C  C   F  K +L RH  +H+  KPY C +C +RF
Sbjct:  397 CSVCGMNFHQKSSLERHQGIHTGEKPYYCSACGMNFHQKSSLERHQG-IHTG----------EKPYYCSACGMNFHQKITLERHQRIHTGEKPYHCSVCGKRFTTQSHLKTHQRVH-TGEKPYHCSVCGKRFTTQSHLKIHQRIHTGEKPHHCSVCGKSFTKPSDLQRHKYIH-----TGEKPYHCSDCGKSFIKQSDLQQHQRIHTGETPF-QCTECGKNFYKQYNLQQHQLIHTGEKPFHCL--DCGKSFTTQGHLQQHKRIHTGERPYCCLVCGMNFNQKSSLERHQGIHTGEKPYYCSACGMNFRQKITLERHQRIHTGEKPYHCSVCGKRFTRQGHLKTHQRV--HTGEKTYH---------------------------CSVCGKSFTKPSDLQRHKYI---------HTGEKPYHCSG------CGKGFIKQSDLQQHQRIHTGETPFQCT-ECGKNFYKQYNLQQHQLIH---TGERPYCCSVCGRNFHQKSTLERHQGIHAGEKPYHCSDCGKSFIKQSVLQQHQRIHTGEKPYHCSVCGKRFTTQSHLKIHQRIHTGEKPHH-CSVCGKSFIKQSDLQ-----QHQRIHTGETPFQC-------------------PECGKNFYKQ-----YNLQQHQLIHTGE---------KPFHCLDCGKSFTTQGHLQQHKRIH-TGERPYCCLVCGMNFNQKSSLERHQGI-HTGEKPYYCSACGMNFRQKITLERHQRIHTGEKPYHCSVCGKRF 1048          

HSP 3 Score: 139.428 bits (350), Expect = 1.251e-32
Identity = 148/564 (26.24%), Postives = 219/564 (38.83%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKN---------GTEVLSQS--QEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSY--IPSAENFIKLDWDKSHQGILLSED----------------VERIDK------------------ETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRF--------NTGFHLR---YHYS------------TSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDV--KPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKY-LNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            C+VCGK F T   L+ H+  HTG K + C +C K FT +S +KIH  +H   K   C  CGK+FT   ++  H K IH           G   + QS  Q+H    + +   +  +    F K  +L +     + +         ++ T + H        +    Y  +    NF +    + HQGI   E                 +ER  +                    G ++ H+ +    TG + + C  C K + K  DL RH  IHT +KP+ C  C K F  +S L+ H + H     F C  C K F  +  L+ H+ +H  ++  + C +C R F        + G H     YH S              H R      P           +    +  +   T    +   V  K  I    L Q        +R  +    F+C  CGK++ +K+Y L +H   H      + C  C KSF T   +QQH R  H   R + CL C   F  K+SL RH  +H+  KPY C  C   F+ KI  +RH
Sbjct:  481 CSVCGKRFTTQSHLKTHQRVHTGEKPYHCSVCGKRFTTQSHLKIHQRIHTGEKPHHCSVCGKSFTKPSDLQRH-KYIHTGEKPYHCSDCGKSFIKQSDLQQHQRIHTGETPFQCTECGKNFYKQYNLQQHQLIHTGEKPFHCLDCGKSFTTQGHLQQHKRIHTGERPYCCLVCGMNFNQKSSLERHQGIHTGEKPYYCSACGMNFRQKITLERHQRIHTGEKPYHCSVCGKRFTRQGHLKTHQRVH---TGEKTYHCSVCGKSFTKPSDLQRHKYIHTGEKPYHCSGCGKGFIKQSDLQQHQRIHTGETPFQCTECGKNFYKQYNLQQHQLIHTGERP-YCCSVCGRNFHQKSTLERHQGIHAGEKPYHCSDCGKSFIKQSVLQQHQRIHTGEKPYHCSVCGKRFTTQSHLKIHQRIHTGEKPHHCSVCGKSFIKQSDLQQ-------HQRIHTGETPFQCPECGKNF-YKQYNLQQHQLIHTGEKPFH-CLDCGKSFTTQGHLQQHKRI-HTGERPYCCLVCGMNFNQKSSLERHQGIHTGEKPYYCSACGMNFRQKITLERH 1029          

HSP 4 Score: 132.88 bits (333), Expect = 1.118e-30
Identity = 134/525 (25.52%), Postives = 215/525 (40.95%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQ-------IQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKY-LNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKA----KIYCDRHISAK--KCSKKKRNRFQQNDLM 2757
            C+ CG  F   I L RH+  HTG K + C +C K FT +S +K H  VH   K + C  CGK FT + ++  H ++                            + P+      S+   + +   D +  +Y+         H   +P H S+        ++FIK    + HQ I   E   +   E G+       +Q H++I    TG + F C  C K +     L +H RIHT ++P+ C +C  +F  KS L+ H   H   K + C  C   F  K TL+ H+++H  +K  + C +C +RF    HL+ H          +                 ++     KP   S      K  I    L Q        +R  +    F+C  CGK++ +K+Y L +H   H +      C  C ++F    ++++H    H   + + C  C   FI ++ L +H  +H+  KPY C +C +RF      KI+   H   K   CS   ++  +Q+DL 
Sbjct:  453 CSACGMNFHQKITLERHQRIHTGEKPYHCSVCGKRFTTQSHLKTHQRVHTGEKPYHCSVCGKRFTTQSHLKIHQRI-------------------------HTGEKPHH----CSVCGKSFTKPSDLQRHKYI---------HTGEKPYHCSD------CGKSFIKQSDLQQHQRIHTGETPFQCT-ECGKNFYKQYNLQQHQLIH---TGEKPFHCLDCGKSFTTQGHLQQHKRIHTGERPYCCLVCGMNFNQKSSLERHQGIHTGEKPYYCSACGMNFRQKITLERHQRIHTGEKP-YHCSVCGKRFTRQGHLKTHQRVHTGEKTYHCSVCGKSFTKPSDLQRHKYIHTGEKPYHCSGCG---KGFIKQSDLQQ-------HQRIHTGETPFQCTECGKNF-YKQYNLQQHQLIH-TGERPYCCSVCGRNFHQKSTLERHQGI-HAGEKPYHCSDCGKSFIKQSVLQQHQRIHTGEKPYHCSVCGKRFTTQSHLKIHQRIHTGEKPHHCSVCGKSFIKQSDLQ 915          

HSP 5 Score: 117.857 bits (294), Expect = 5.525e-26
Identity = 124/501 (24.75%), Postives = 205/501 (40.92%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKN---------GTEVLSQS--QEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPS--AENFIKLDWDKSHQGILLSED------VERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C+ CGK+F  P  L+RH+  HTG K + C  C K F ++S ++ H  +H     F C  CGK F  ++N+  H ++IH           G    +Q   Q+H    + +   +  +    F K  +L +  +  + +      +  ++ T  +         +    Y  S    NF +    + HQGI   E         +   +   +Q H+ I    TG + + C  C K + K  DL +H RIHT +KP  C +C KSF   S L+ H   H   K + C  C K F  +  L+ H+++H  +   F C  C + F   ++L+ H        + +    P   L        Q    ++K       P        N   +Q   + E  +   +  + + C+ CG ++  K  L  H   H +      C  C  +F    ++++H R  H   + + C  C   F T++ L  H  VH+  KPY C +C +RF
Sbjct:   33 CSDCGKSFTKPSDLQRHKYIHTGEKPYHCSDCGKSFIKQSDLQQHQRIHTGETPFQCTECGKNFYKQYNLQQH-QLIHTGEKPFHCLDCGKSFTTQGNLQQHQRIHTGETPFQCTECGKNFYKQYNLQQHQRIHTGEKPYHCSVCGKSFTKPSDLQRHKYIHTGEKPYCCSVCGMNFHQKSSLERHQGIHTGEKPYHCSVCGKSFIKQSDLQQHQRIH---TGEKPYHCSVCGKSFIKQSDLQQHQRIHTGEKPHHCSVCGKSFTKPSDLQRHKYIHTGEKPYHCSDCGKGFIKQSDLQQHQRIHTGE-TPFQCTECGKNFYKQYNLQQH-------QLIHTGEKPFHCLDCGKSFTTQGNLQQHKRIHTGEKPYCCSVCGMN--FHQKSSL-ERHQGIHTGEKPYYCSACGMNFHQKSSLERHQGIH-TGEKPYYCSACGMNFHQKITLERHQRI-HTGEKPYHCSVCGKRFTTQSHLKTHQRVHTGEKPYHCSVCGKRF 516          

HSP 6 Score: 114.005 bits (284), Expect = 6.954e-25
Identity = 145/598 (24.25%), Postives = 239/598 (39.97%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNE----CTVVNDS--------------NQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIAC-----QTIKLYAQGRSQLDEMKPD----VNRSISKRGR-PXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKN---------GTEVLSQS--QEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFS-YQPNHQSNTDSYIP-SAENFIKLDWDKSHQGILLSEDVERIDKETGQ-------IQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYH 2157
            C +C   F ++     H  +H  ++ + CS C   +  + +L +H   IHT E    C+V   S                E  Y C  C   F ++   Q H  IH  +    C  C   F  +  L +H   H  GE+            C  C   F   G++++H  R H     +  +  GM     ++      +   + ++     AC     Q I L    R    E KP       +  +++G         + +   +C+VCGK+F  P  L+RH+  HTG K + C  C KGF ++S ++ H  +H     F C  CGK F  ++N+  H ++IH           G     +S  + H    + +           F K + L +  +  + +      +  +  T ++H   +Q  H      +     ++FIK    + HQ I   E   +   E G+       +Q H++I    TG + F C  C K +     L +H RIHT ++P+ C +C  +F  KS L+ H   H   K + C  C   F  K TL+ H+++H  +K  + C +C +RF    HL+ H
Sbjct:  481 CSVCGKRFTTQSHLKTHQRVHTGEKPYHCSVCGKRFTTQSHLKIH-QRIHTGEKPHHCSVCGKSFTKPSDLQRHKYIHTGEKPYHCSDCGKSFIKQSDLQQHQRIHTGETPFQCTECGKNFYKQYNLQQHQLIH-TGEK---------PFHCLDCGKSFTTQGHLQQH-KRIHTGERPYCCLVCGMNFN--QKSSLERHQGIHTGEKPYYCSACGMNFRQKITLERHQRIHTGE-KPYHCSVCGKRFTRQGHLKTHQRVHTGEKTYHCSVCGKSFTKPSDLQRHKYIHTGEKPYHCSGCGKGFIKQSDLQQHQRIHTGETPFQCTECGKNFYKQYNLQQH-QLIHTGERPYCCSVCGRNFHQKSTLERHQGIHAGEKPYHCSDCGKSFIKQSVLQQHQRIHTGEKPYHCSVCGKRFTTQSHLKIHQRIHTGEKPHHCSVCGKSFIKQSDLQQHQRIHTGETPFQCP-ECGKNFYKQYNLQQHQLIH---TGEKPFHCLDCGKSFTTQGHLQQHKRIHTGERPYCCLVCGMNFNQKSSLERHQGIHTGEKPYYCSACGMNFRQKITLERHQRIHTGEKP-YHCSVCGKRFTRQGHLKTH 1057          

HSP 7 Score: 100.138 bits (248), Expect = 1.189e-20
Identity = 99/356 (27.81%), Postives = 151/356 (42.42%), Query Frame = 1
Query: 1705 AENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRF----NTGFHLRYHYSTS-HHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANS-NNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRL------------FKCNHCGKSYKFKKY-LNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
             +NF K    + HQ I   E      D  +     G +Q H+ I    TG   F+C  C K + K  +L +H RIHT +KP+ C +C KSF   S L+ H   H   K + C +C   F+ K +L+ H+ +H  +K  + C +C + F    +   H R H     +H S+          L    +     +         S   P D++   +     +P   ++  K  +  + L            F+C  CGK++ +K+Y L +H   H      + C  C KSF T  ++QQH R  H   + + C  C   F  K+SL RH  +H+  KPY C  C   F  K   +RH
Sbjct:   93 GKNFYKQYNLQQHQLIHTGEKPFHCLDCGKSFTTQGNLQQHQRIH---TGETPFQCTECGKNFYKQYNLQQHQRIHTGEKPYHCSVCGKSFTKPSDLQRHKYIHTGEKPYCCSVCGMNFHQKSSLERHQGIHTGEKP-YHCSVCGKSFIKQSDLQQHQRIHTGEKPYHCSVCGKSFIKQSDLQQHQRIHTGEKPHHCSVCGKSFTKPSDLQRHKYIHTGEKPYHCSDCGKGFIKQSDLQQHQRIHTGETPFQCTECGKNF-YKQYNLQQHQLIHTGEKPFH-CLDCGKSFTTQGNLQQHKRI-HTGEKPYCCSVCGMNFHQKSSLERHQGIHTGEKPYYCSACGMNFHQKSSLERH 441          

HSP 8 Score: 95.1301 bits (235), Expect = 4.758e-19
Identity = 78/297 (26.26%), Postives = 126/297 (42.42%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPS-AENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDK 2094
            C  CGK F     L++H++ HTG + + C +C + F QKS+++ H  +H   K + C  CGK+F  +  +  H ++         S   +    +S+              KI     T + P   +   +    ++   +    +Q  H   T    P   +NF K    + HQ I   E      D  +     G +Q H+ I    TG R + C  C   + +   L RH  IHT +KP+ C  C  +FR K  L+ H + H   K + C +C K F  +  LK H+++H  +K
Sbjct:  789 CTECGKNFYKQYNLQQHQLIHTGERPYCCSVCGRNFHQKSTLERHQGIHAGEKPYHCSDCGKSFIKQSVLQQHQRIHTGEKPYHCSVCGKRFTTQSHL-------------KIHQRIHTGEKPHHCSVCGKSFIKQSDLQQ----HQRIHTGETPFQCPECGKNFYKQYNLQQHQLIHTGEKPFHCLDCGKSFTTQGHLQQHKRIH---TGERPYCCLVCGMNFNQKSSLERHQGIHTGEKPYYCSACGMNFRQKITLERHQRIHTGEKPYHCSVCGKRFTRQGHLKTHQRVHTGEK 1065          

HSP 9 Score: 88.5817 bits (218), Expect = 4.325e-17
Identity = 159/737 (21.57%), Postives = 264/737 (35.82%), Query Frame = 1
Query: 1753 LLSEDVERIDKETGQIQLHEMIKDQVTGFRR-FRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLMTGIINRNPIGSLTNQIGQSDLEANDQSETF-TAFRLEDLDMNSAQSSNILVTNYVNEFSSFPSTEKYMIVSLDNPNSKDQSGSSQQNYYASNIXXXXXXXXXXARNQIESQTDQSENIMSLLDSGQMGVTPVDIGSLFAVQGFNGNIATQLVDHGNIQSNDIDYSQPQENIYYYQAL-----NEIPTVECPIECPSKSSLADKFPILKASLFSDDELTSNPKESNPFTNSSMVTNSNGSQFXXXXXXXXXXXXXXXXXXLQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSD--YDALIINSN 3930
            + S ++  I + +      +M K   TG ++   C  C K + K  DL RH  IHT +KP+ C  C KSF  +S L+ H + H     F C  C K F  +  L+ H+ +H  +K  F C  C + F T  +L+      H R      P                +  +   T         KP   +         +++ + K   +  + + C+ CG ++  K  L  H   H +      C  C KSF+    +QQH R  H   + + C  C   FI ++ L +H  +H+  KP+ C +C + F       RH       K     +  +D   G I             QSDL+ + +  T  T F+  +   N  +  N+     ++       T +     LD   S    G+ QQ+             +       +S  ++ + I +       G  P    +     G N +  + L  H  I + +  Y      + ++Q +       I T E P  C    S+  K    ++ L +   + +  K   P+  S       G +F             T  + L+ H  I   +  H C+ C   F     L  H K  H   + + C+ C K+F  +  L  H + H        F C  C + F    +L +H  +  +     + C  C K + T   L  H +    +  Y  L+   N
Sbjct:    1 MASTEISNIQQTSSPTPERQMQKS--TGKKKPHHCSDCGKSFTKPSDLQRHKYIHTGEKPYHCSDCGKSFIKQSDLQQHQRIHTGETPFQCTECGKNFYKQYNLQQHQLIHTGEKP-FHCLDCGKSFTTQGNLQ-----QHQRIHTGETPFQCTECGKNFYKQYNLQQHQRIHTGE-------KPYHCSVCGKSFTKPSDLQRHKYIHTGEKPYCCSVCGMNFHQKSSLERHQGIH-TGEKPYHCSVCGKSFIKQSDLQQHQRI-HTGEKPYHCSVCGKSFIKQSDLQQHQRIHTGEKPHHCSVCGKSFTKPSDLQRHKYIHTGEKP----YHCSDCGKGFIK------------QSDLQQHQRIHTGETPFQCTECGKNFYKQYNLQQHQLIH-------TGEKPFHCLDCGKSFTTQGNLQQHKRIHTGEKPYCCSVCGMNFHQKSSLERHQGIHT-------GEKPYYCSAC----GMNFHQKSSLERHQGIHTGEKPYYCSACGMNFHQKITLERHQRIHTGEKPYHC----SVCGKRFTTQSHLKTHQRVHTGEK---PYHCSVC-----GKRF-------------TTQSHLKIHQRIHTGEKPHHCSVCGKSFTKPSDLQRH-KYIHTGEKPYHCSDCGKSFIKQSDLQQHQRIHTGETP---FQCTECGKNFYKQYNLQQHQLI--HTGEKPFHCLDCGKSFTTQGHLQQHKRIHTGERPYCCLVCGMN 655          

HSP 10 Score: 69.3218 bits (168), Expect = 3.986e-11
Identity = 70/250 (28.00%), Postives = 91/250 (36.40%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGL-------PEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQ 4953
            PY CS+C K F + S+LQQH  +HT  +PY C  C K F                                Q  L+ H ++H  E   HC VC K F    DL R    H  EK    S C +G           R   GE     T      ++Q      ++I    +K   CL C   F T+     H  +    EK +    C   F   S    H Q +H     Y C+ C + F Q+SS   HQ
Sbjct:  226 PYHCSVCGKSFIKQSDLQQHQRIHTGEKPYHCSVCGKSF------------------------------IKQSDLQQHQRIHTGEKPHHCSVCGKSFTKPSDLQRHKYIHTGEKPYHCSDCGKGFIKQSDLQQHQRIHTGETPFQCTECGKNFYKQYNLQQHQLI-HTGEKPFHCLDCGKSFTTQGNLQQHKRIHT-GEKPYCCSVCGMNFHQKSSLERH-QGIHTGEKPYYCSACGMNFHQKSSLERHQ 442          

HSP 11 Score: 66.6254 bits (161), Expect = 2.093e-10
Identity = 73/258 (28.29%), Postives = 105/258 (40.70%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTH------EATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGL-------PEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKA-EKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY C +C   FN+ S+L++H  +HT  +PY C  C   FR + +L+ H      E   H SV          K    Q  L+ H ++H  E + HC VC K F    DL R    H  EK    S C +G           R   GE     T      ++Q      ++I    ++   C  C   F+ K+  + H   G+ A EK +    C K+F   S    H Q +H     Y+C+ C   F  +S    HQ+
Sbjct:  646 PYCCLVCGMNFNQKSSLERHQGIHTGEKPYYCSACGMNFRQKITLERHQRIHTGEKPYHCSVC--------GKRFTRQGHLKTHQRVHTGEKTYHCSVCGKSFTKPSDLQRHKYIHTGEKPYHCSGCGKGFIKQSDLQQHQRIHTGETPFQCTECGKNFYKQYNLQQHQLI-HTGERPYCCSVCGRNFHQKSTLERH--QGIHAGEKPYHCSDCGKSFIKQSVLQQH-QRIHTGEKPYHCSVCGKRFTTQSHLKIHQR 891          

HSP 12 Score: 65.4698 bits (158), Expect = 5.775e-10
Identity = 72/257 (28.02%), Postives = 99/257 (38.52%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTH------EATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGL-------PEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C   F++   L++H  +HT  +PY C  C KRF  +  LKTH      E   H SV          K   +Q  L+ H ++H  E   HC VC K F    DL R    H  EK    S C +            R   GE     T      ++Q      ++I    +K   CL C   F T+     H  +    E+ +    C   F   S    H Q +H     Y C+ C + F Q+ +   HQ+
Sbjct:  450 PYYCSACGMNFHQKITLERHQRIHTGEKPYHCSVCGKRFTTQSHLKTHQRVHTGEKPYHCSVC--------GKRFTTQSHLKIHQRIHTGEKPHHCSVCGKSFTKPSDLQRHKYIHTGEKPYHCSDCGKSFIKQSDLQQHQRIHTGETPFQCTECGKNFYKQYNLQQHQLI-HTGEKPFHCLDCGKSFTTQGHLQQHKRIHT-GERPYCCLVCGMNFNQKSSLERH-QGIHTGEKPYYCSACGMNFRQKITLERHQR 695          

HSP 13 Score: 61.2326 bits (147), Expect = 1.105e-8
Identity = 70/260 (26.92%), Postives = 105/260 (40.38%), Query Frame = 1
Query: 4189 PPDLNKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVC----YKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            P DL +   I      PY CS C K F + S+LQQH  +HT   P+QC +C K F  + +L+ H+     +  K   C  C K   +Q  L+ H ++H  E    C  C    YK ++LQ+    H  EK    S C           G+  + P+              +       +K   C  C   F+ K+  + H  +    EK +    C K+F   S    H Q +H     Y+C+ C   F ++S    HQ+
Sbjct:   43 PSDLQRHKYIH-TGEKPYHCSDCGKSFIKQSDLQQHQRIHTGETPFQCTECGKNFYKQYNLQQHQLI--HTGEKPFHCLDCGKSFTTQGNLQQHQRIHTGETPFQCTECGKNFYKQYNLQQHQRIHTGEKPYHCSVC-----------GKSFTKPSDLQ-----------RHKYIHTGEKPYCCSVCGMNFHQKSSLERHQGIHT-GEKPYHCSVCGKSFIKQSDLQQH-QRIHTGEKPYHCSVCGKSFIKQSDLQQHQR 275          

HSP 14 Score: 60.8474 bits (146), Expect = 1.499e-8
Identity = 69/246 (28.05%), Postives = 93/246 (37.80%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTH------EATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F + S LQQH  +HT  +PY C  C KRF  +  LK H      E   H SV          K    Q  L+ H ++H  E    C  C K F  Q +L +H            + +  G KP   L    +     H QQ ++      P        CL C   FN K+  + H  +    EK +    C   F        H Q +H     Y+C+ C   F ++     HQ+
Sbjct:  842 PYHCSDCGKSFIKQSVLQQHQRIHTGEKPYHCSVCGKRFTTQSHLKIHQRIHTGEKPHHCSVC--------GKSFIKQSDLQQHQRIHTGETPFQCPECGKNFYKQYNLQQH------------QLIHTGEKPFHCLDCGKSFTTQGHLQQHKRIHTGERPYC------CLVCGMNFNQKSSLERHQGIHT-GEKPYYCSACGMNFRQKITLERH-QRIHTGEKPYHCSVCGKRFTRQGHLKTHQR 1059          

HSP 15 Score: 59.6918 bits (143), Expect = 2.826e-8
Identity = 64/246 (26.02%), Postives = 94/246 (38.21%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTH------EATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS+C + F++ S L++H  +H   +PY C  C K F  +  L+ H      E   H SV          K   +Q  L+ H ++H  E   HC VC K F  Q DL +H                  R   GE            ++Q      ++I    +K   CL C   F T+     H  +    E+ +    C   F   S    H Q +H     Y C+ C + F Q+ +   HQ+
Sbjct:  814 PYCCSVCGRNFHQKSTLERHQGIHAGEKPYHCSDCGKSFIKQSVLQQHQRIHTGEKPYHCSVC--------GKRFTTQSHLKIHQRIHTGEKPHHCSVCGKSFIKQSDLQQHQ-----------------RIHTGETPFQCPECGKNFYKQYNLQQHQLI-HTGEKPFHCLDCGKSFTTQGHLQQHKRIHT-GERPYCCLVCGMNFNQKSSLERH-QGIHTGEKPYYCSACGMNFRQKITLERHQR 1031          

HSP 16 Score: 58.5362 bits (140), Expect = 6.471e-8
Identity = 69/256 (26.95%), Postives = 105/256 (41.02%), Query Frame = 1
Query: 4189 PPDLNKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            P DL +   I      PY CS C K F + S+LQQH  +HT   P+QC +C K F  + +L+ H+     +  K   C  C K   +Q  L+ H ++H  E    C VC   F+ +  L RH            +G+  G KP    S+   +       ++ + I        +K   C  C   F  +     H  V    EK++    C K+F   S    H + +H     Y+C+ C   F ++S    HQ+
Sbjct:  547 PSDLQRHKYIH-TGEKPYHCSDCGKSFIKQSDLQQHQRIHTGETPFQCTECGKNFYKQYNLQQHQLI--HTGEKPFHCLDCGKSFTTQGHLQQHKRIHTGERPYCCLVCGMNFNQKSSLERH------------QGIHTGEKPY-YCSACGMNFRQKITLERHQRI-----HTGEKPYHCSVCGKRFTRQGHLKTHQRVHT-GEKTYHCSVCGKSFTKPSDLQRH-KYIHTGEKPYHCSGCGKGFIKQSDLQQHQR 779          

HSP 17 Score: 57.7658 bits (138), Expect = 1.102e-7
Identity = 59/240 (24.58%), Postives = 88/240 (36.67%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS+C   F++ S+L++H  +HT  +PY C  C   F  + SL+ H+     +  K   C  C      ++ L  H ++H  E   HC VC K F  Q  L  H            + +  G KP                                    C  C   F T++    H  +    EK H    C K+F   S    H + +H     Y+C+ C   F ++S    HQ+
Sbjct:  394 PYCCSVCGMNFHQKSSLERHQGIHTGEKPYYCSACGMNFHQKSSLERHQGI--HTGEKPYYCSACGMNFHQKITLERHQRIHTGEKPYHCSVCGKRFTTQSHLKTH------------QRVHTGEKP----------------------------------YHCSVCGKRFTTQSHLKIHQRIHT-GEKPHHCSVCGKSFTKPSDLQRH-KYIHTGEKPYHCSDCGKSFIKQSDLQQHQR 583          
BLAST of Zinc finger, C2H2 type vs. Ensembl Cavefish
Match: ENSAMXT00000025654.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001876.1:49650:51482:1 gene:ENSAMXG00000024928.2 transcript:ENSAMXT00000025654.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 143.28 bits (360), Expect = 1.112e-34
Identity = 130/499 (26.05%), Postives = 205/499 (41.08%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEID--KRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            C+ CGK+F     LRRH+  HTG K + C  C K FT+KS+++ H  +H   K + C  CGK+FT + N+  H ++           + E   + S+  +   +K   R  +     E     SD  +      N       H   +P H S+         N       + HQ I   E      D  +   E   ++ H+ I    TG + + C  C K + +  +L RH RIHT +KP+ C  C KSF  KS L+ H + H   K + C  C K F  K  L+ H+++H  +K  + C  C + F    +LR      H R      P                   +   T         KP   ++        +++   +R  +  + + C+ CGKS+  + +L  H + H +      C  C K+F    ++++H R  H   + + C  C   F  K++L RH  +H+  KPY C  C + F  K    RH
Sbjct:  116 CSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRI----------HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNL------RRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIH---TGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKP-YHCSDCGKSFTEKSNLR-----RHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGE-------KPYHCSDCGKSFTQKSDLKNHQRIHTGEKPYHCSDCGKSFNQQSHLKNHQRIH-TGEKPYHCSDCGKNFTEQCNLKKHQRI-HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRH 580          

HSP 2 Score: 142.895 bits (359), Expect = 1.381e-34
Identity = 133/491 (27.09%), Postives = 198/491 (40.33%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAK 2679
            C+ CGK+F     LRRH+  HTG K + C  C K FTQKS+++ H  +H   K + C  CGK+FT + N+  H ++           + E   + S+  +   +K   R  +     E     SD  +      N       H   +P H S+         N       + HQ I   E      D  +   E   ++ H+ I    TG + + C  C K + +  +L RH RIHT +KP+ C  C KSF  KS L+ H + H   K + C  C K F  K  L+ H+++H  +K  + C  C + F    +LR H                            Q      KP   S+          N   +Q I   E         + + C+ CGKS+  K  L  H + H +      C  C KSF    ++++H R  H   + + C  C   F  K++L RH  +H+  KPY C  C + F  K
Sbjct:   32 CSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTQKSNLRRHQRIHTGEKPYHCSDCGKSFTQKSNLRRHQRI----------HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNL------RRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIH---TGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKP-YHCSDCGKSFTEKSNLRRH----------------------------QRIHTGEKPYHCSDCGKSFTEKS-NLRRHQRIHTGE---------KPYHCSDCGKSFTEKSNLRRHQRIH-TGEKPYHCSDCGKSFTEKSNLRRHQRI-HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTQK 462          

HSP 3 Score: 140.584 bits (353), Expect = 7.117e-34
Identity = 130/491 (26.48%), Postives = 203/491 (41.34%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAK 2679
            C+ CGK+F     LRRH+  HTG K + C  C K FT+KS+++ H  +H   K + C  CGK+FT + N+  H ++           + E   + S+  +   +K   R  +     E     SD  +      N       H   +P H S+         N       + HQ I   E      D  +   E   ++ H+ I    TG + + C  C K + +  +L RH RIHT +KP+ C  C KSF  KS L+ H + H   K + C  C K F  K  L+ H+++H  +K  + C  C + F    +LR      H R      P                   KN    ++   P        +  NQ   +    +R  +  + + C+ CGK++  +  L +H + H +      C  C KSF    ++++H R  H   + + C  C   F  K++L RH  +H+  KPY C  C + F  K
Sbjct:  144 CSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRI----------HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNL------RRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIH---TGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKP-YHCSDCGKSFTEKSNLR-----RHQRIHTGEKPYHCSDCGKSFTQKSDL---KNHQRIHTGEKP-YHCSDCGKSFNQQSHLKN-HQRIHTGEKPYHCSDCGKNFTEQCNLKKHQRIH-TGEKPYHCSDCGKSFTEKSNLRRHQRI-HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEK 602          

HSP 4 Score: 130.954 bits (328), Expect = 1.130e-30
Identity = 130/492 (26.42%), Postives = 195/492 (39.63%), Query Frame = 1
Query: 1240 KAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            K+F     L+ H+  HTG K + C  C K FT+KS+++ H  +H   K + C  CGK+FT + N+  H ++           + E   + S+  +   QK   R  +     E     SD  +      N       H   +P H S+         N       + HQ I   E      D  +   E   ++ H+ I    TG + + C  C K + +  +L RH RIHT +KP+ C  C KSF  KS L+ H + H   K + C  C K F  K  L+ H+++H  +K  + C  C + F    +LR H                            Q      KP   S+          N   +Q I   E         + + C+ CGKS+  K  L  H + H +      C  C KSF    ++++H R  H   + + C  C   F  K++L RH  +H+  KPY C  C + F  K    RH
Sbjct:    9 KSFTKQSDLKLHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTQKSNLRRHQRI----------HTGEKPYHCSDCGKSFTQKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNL------RRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIH---TGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKP-YHCSDCGKSFTEKSNLRRH----------------------------QRIHTGEKPYHCSDCGKSFTEKS-NLRRHQRIHTGE---------KPYHCSDCGKSFTEKSNLRRHQRIH-TGEKPYHCSDCGKSFTEKSNLRRHQRI-HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRH 440          

HSP 5 Score: 117.857 bits (294), Expect = 1.585e-26
Identity = 92/318 (28.93%), Postives = 145/318 (45.60%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHY 2160
            C+ CGK+F     LRRH+  HTG K + C  C K FT+KS+++ H  +H   K + C  CGK+FT + N+  H ++           + E   + S+  +   +K   R  +     E     SD  +      N       H   +P H S+        ++F +    K+HQ I   E      D  +   +   ++ H+ I    TG + + C  C K + + C+L +H RIHT +KP+ C  C KSF  KS L+ H + H   K + C  C K F  K  L+ H+++H  +K  + C  C + F    +LR H+
Sbjct:  312 CSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRI----------HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDC------GKSFTQKSDLKNHQRIHTGEKPYHCSDCGKSFNQQSHLKNHQRIH---TGEKPYHCSDCGKNFTEQCNLKKHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKP-YHCSDCGKSFTEKSNLRMHW 609          

HSP 6 Score: 102.064 bits (253), Expect = 1.745e-21
Identity = 92/340 (27.06%), Postives = 140/340 (41.18%), Query Frame = 1
Query: 1702 SAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDK--RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            S ++F K    K HQ I   E      D  +   E   ++ H+ I    TG + + C  C K + +  +L RH RIHT +KP+ C  C KSF  KS L+ H + H   K + C  C K F  K  L+ H+++H  +K  + C  C + F    +LR      H R      P                   +   T         KP   ++        + + +  R  +  + + C+ CGKS+  K  L  H + H +      C  C KSF    ++++H R  H   + + C  C   F  K++L RH  +H+  KPY C  C + F  K    RH
Sbjct:    7 SVKSFTKQSDLKLHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIH---TGEKPYHCSDCGKSFTQKSNLRRHQRIHTGEKPYHCSDCGKSFTQKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKP-YHCSDCGKSFTEKSNLR-----RHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGE-------KPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIH-TGEKPYHCSDCGKSFTEKSNLRRHQRI-HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRH 328          

HSP 7 Score: 68.5514 bits (166), Expect = 3.931e-11
Identity = 71/256 (27.73%), Postives = 101/256 (39.45%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPE------------GRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   SNL++H  +HT  +PY C  C K F  + +L+ H+     +  K   C  C K    +  LR H ++H  E   HC  C K F  + +L R    H  EK    S C +   E            G KP    S          + ++ + I        +K   C  C   F  K+    H  +    +  H +  C K+F   S    H Q +H     Y+C+ C   F Q+S   NHQ+
Sbjct:  225 PYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRI--HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPY-HCSDCGKSFTEKSNLRRHQRI-----HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSD-CGKSFTEKSNLRRH-QRIHTGEKPYHCSDCGKSFTQKSDLKNHQR 470          

HSP 8 Score: 65.855 bits (159), Expect = 3.121e-10
Identity = 69/256 (26.95%), Postives = 102/256 (39.84%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPE------------GRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F + SNL++H  +HT  +PY C  C K F  + +L+ H+     +  K   C  C K    +  LR H ++H  E   HC  C K F  + +L R    H  EK    S C +   E            G KP    S          + ++ + I        +K   C  C   F  K+    H  +    +  H +  C K+F   S    H Q +H     Y+C+ C   F ++S+   HQ+
Sbjct:   57 PYHCSDCGKSFTQKSNLRRHQRIHTGEKPYHCSDCGKSFTQKSNLRRHQRI--HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPY-HCSDCGKSFTEKSNLRRHQRI-----HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSD-CGKSFTEKSNLRRH-QRIHTGEKPYHCSDCGKSFTEKSNLRRHQR 302          

HSP 9 Score: 65.4698 bits (158), Expect = 4.211e-10
Identity = 69/256 (26.95%), Postives = 101/256 (39.45%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPE------------GRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   SNL++H  +HT  +PY C  C K F  + +L+ H+     +  K   C  C K    +  LR H ++H  E   HC  C K F  + +L R    H  EK    S C +   E            G KP    S          + ++ + I        +K   C  C   F  K+    H  +    +  H +  C K+F   S    H Q +H     Y+C+ C   F ++S+   HQ+
Sbjct:   29 PYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTQKSNLRRHQRI--HTGEKPYHCSDCGKSFTQKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPY-HCSDCGKSFTEKSNLRRHQRI-----HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSD-CGKSFTEKSNLRRH-QRIHTGEKPYHCSDCGKSFTEKSNLRRHQR 274          

HSP 10 Score: 65.4698 bits (158), Expect = 4.395e-10
Identity = 69/256 (26.95%), Postives = 101/256 (39.45%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPE------------GRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   SNL++H  +HT  +PY C  C K F  + +L+ H+     +  K   C  C K    +  LR H ++H  E   HC  C K F  + +L R    H  EK    S C +   E            G KP    S          + ++ + I        +K   C  C   F  K+    H  +    +  H +  C K+F   S    H Q +H     Y+C+ C   F ++S+   HQ+
Sbjct:  141 PYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRI--HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPY-HCSDCGKSFTEKSNLRRHQRI-----HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSD-CGKSFTEKSNLRRH-QRIHTGEKPYHCSDCGKSFTEKSNLRRHQR 386          

HSP 11 Score: 65.0846 bits (157), Expect = 4.788e-10
Identity = 69/256 (26.95%), Postives = 99/256 (38.67%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPE------------GRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   SNL++H  +HT  +PY C  C K F  + +L+ H+     +  K   C  C K    +  LR H ++H  E   HC  C K F  + +L R    H  EK    S C +   E            G KP    S            +  + I        +K   C  C   FN ++   NH  +    +  H +  C K F        H Q +H     Y+C+ C   F ++S+   HQ+
Sbjct:  309 PYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRI--HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPY-HCSDCGKSFTQKSDLKNHQRI-----HTGEKPYHCSDCGKSFNQQSHLKNHQRIHTGEKPYHCSD-CGKNFTEQCNLKKH-QRIHTGEKPYHCSDCGKSFTEKSNLRRHQR 554          

HSP 12 Score: 62.003 bits (149), Expect = 4.986e-9
Identity = 40/106 (37.74%), Postives = 54/106 (50.94%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH 4554
            PY CS C K FN+ S+L+ H  +HT  +PY C  C K F  +C+LK H+     +  K   C  C K    +  LR H ++H  E   HC  C K F  + +L RH
Sbjct:  477 PYHCSDCGKSFNQQSHLKNHQRIHTGEKPYHCSDCGKNFTEQCNLKKHQRI--HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRH 580          

HSP 13 Score: 61.2326 bits (147), Expect = 6.959e-9
Identity = 65/242 (26.86%), Postives = 92/242 (38.02%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 4950
            PY CS C K F   SNL++H  +HT  +PY C  C K F  + +L+ H+     +  K   C  C K    +  L+NH ++H  E   HC  C K F+ Q  L      H  EK    S C +   E                      Q    K       +K   C  C   F  K+    H  +    +  H +  C K+F   S    H Q +H     Y+C+ C   F ++S+   H
Sbjct:  393 PYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRI--HTGEKPYHCSDCGKSFTQKSDLKNHQRIHTGEKPYHCSDCGKSFNQQSHLKNHQRIHTGEKPYHCSDCGKNFTE----------------------QCNLKKHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSD-CGKSFTEKSNLRRH-QRIHTGEKPYHCSDCGKSFTEKSNLRMH 608          

HSP 14 Score: 52.7582 bits (125), Expect = 3.197e-6
Identity = 63/248 (25.40%), Postives = 96/248 (38.71%), Query Frame = 1
Query: 4261 KGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLPE------------GRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            K F + S+L+ H  +HT  +PY C  C K F  + +L+ H+     +  K   C  C K    +  LR H ++H  E   HC  C K F  + +L R    H  EK    S C +   E            G KP    S          + ++ + I        +K   C  C   F  K+    H  +    +  H +  C K+F   S    H Q +H     Y+C+ C   F ++S+   HQ+
Sbjct:    9 KSFTKQSDLKLHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRI--HTGEKPYHCSDCGKSFTQKSNLRRHQRIHTGEKPYHCSDCGKSFTQKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPY-HCSDCGKSFTEKSNLRRHQRI-----HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSD-CGKSFTEKSNLRRH-QRIHTGEKPYHCSDCGKSFTEKSNLRRHQR 246          

HSP 15 Score: 52.7582 bits (125), Expect = 3.634e-6
Identity = 36/108 (33.33%), Postives = 51/108 (47.22%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVD 4560
            PY CS C K F    NL++H  +HT  +PY C  C K F  + +L+ H+     +  K   C  C K    +  LR H ++H  E   HC  C K F  + +L  H +
Sbjct:  505 PYHCSDCGKNFTEQCNLKKHQRIHTGEKPYHCSDCGKSFTEKSNLRRHQRI--HTGEKPYHCSDCGKSFTEKSNLRRHQRIHTGEKPYHCSDCGKSFTEKSNLRMHWN 610          
BLAST of Zinc finger, C2H2 type vs. Ensembl Cavefish
Match: ENSAMXT00000018704.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001240.1:31030:34827:-1 gene:ENSAMXG00000018161.2 transcript:ENSAMXT00000018704.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 6.411e-34
Identity = 129/502 (25.70%), Postives = 206/502 (41.04%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSP---SDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEID--KRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            C+ CGK+F T   L++H+  HTG K + C  C K FT +S++K H  +H   K + C  CGK+FT + N+  H ++         S   +    +SN              K      T + P   SD  +      N       H   +P H S+      +  N       K+HQ I   E      D  +       ++ H+ I    TG + + C  C K +    +L  H RIHT +KP+ C  C KSF  +S LKNH + H   K + C  C K F  +  LK H+++H  +K  + C  C + F T  +L+     +H R      P           +    ++ +   T         KP   ++        + +   +R  +  + + C+ CGKS+  +  L  H + H +      C  C KSF T  +++ H R  H   + + C  C   F T+++L  H  +H+  KPY C  C + F  +    +H
Sbjct:   81 CSDCGKSFTTQSNLKKHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNL-------------KNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNL------KNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH---TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKP-YHCSDCGKSFTTQSNLK-----NHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGE-------KPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH-TGEKPYHCSDCGKSFTTQSNLKNHQRI-HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKKH 545          

HSP 2 Score: 141.354 bits (355), Expect = 7.195e-34
Identity = 127/493 (25.76%), Postives = 205/493 (41.58%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQ-YLWNENPTNEN--HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEID--KRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C+ CGK+F T   L+ H+  HTG K + C  C K FT +S++K H  +H   K + C  CGK+FT + N+  H ++         S   +    +SN              K      T + P   ++  + +    N  N    H   +P H S+      +  N       K+HQ I   E      D  +       ++ H+ I    TG + + C  C K +    +L  H RIHT +KP+ C  C KSF  +S LKNH + H   K + C  C K F  +  LK H+++H  +K  + C  C + F T  +L+     +H R      P           +    ++ +   T         KP   ++        + +   +R  +  + + C+ CGKS+  +  L  H + H +      C  C KSF T  +++ H R  H   + + C  C   F T+++L +H  +H+  KPY C  C + F
Sbjct:  109 CSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNL-------------KNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNL------KNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH---TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKP-YHCSDCGKSFTTQSNLK-----NHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGE-------KPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH-TGEKPYHCSDCGKSFTTQSNLKNHQRI-HTGEKPYHCSDCGKSFTTQSNLKKHQRIHTGEKPYYCSDCGKSF 564          

HSP 3 Score: 140.969 bits (354), Expect = 1.045e-33
Identity = 128/493 (25.96%), Postives = 204/493 (41.38%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQ-YLWNENPTNEN--HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDK--RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C+ CGK+F T   L+ H+  HTG K + C  C K FT +S++K H  +H   K + C  CGK+FT + N+  H ++         S   +    +SN              K      T + P   ++  + +    N  N    H   +P H S+      +  N       K+HQ I   E      D  +       ++ H+ I    TG + + C  C K +    +L  H RIHT +KP+ C  C KSF  +S LKNH + H   K + C  C K F  +  LK H+++H  +K  + C  C + F T  +L+     +H R      P           +    ++ +   T         KP   ++        + + K  R  +  + + C+ CGKS+  +  L  H + H +      C  C KSF T  +++ H R  H   + + C  C   F T+++L  H  +H+  KPY C  C + F
Sbjct:  193 CSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNL-------------KNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNL------KNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH---TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKP-YHCSDCGKSFTTQSNLK-----NHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGE-------KPYHCSDCGKSFTTQSNLKKHQRIHTGEKPYYCSDCGKSFTTQSNLKNHQRIH-TGEKPYHCSDCGKSFTTQSNLKNHQRI-HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTEEKPYHCSDCGKSF 648          

HSP 4 Score: 140.584 bits (353), Expect = 1.304e-33
Identity = 127/493 (25.76%), Postives = 205/493 (41.58%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQ-YLWNENPTNEN--HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEID--KRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C+ CGK+F T   L+ H+  HTG K + C  C K FT +S++K H  +H   K + C  CGK+FT + N+  H ++         S   +    +SN              K      T + P   ++  + +    N  N    H   +P H S+      +  N       K+HQ I   E      D  +       ++ H+ I    TG + + C  C K +    +L  H RIHT +KP+ C  C KSF  +S LKNH + H   K + C  C K F  +  LK H+++H  +K  + C  C + F T  +L+     +H R      P           +    ++ +   T         KP   ++        + +   +R  +  + + C+ CGKS+  +  L  H + H +      C  C KSF T  ++++H R  H   + + C  C   F T+++L  H  +H+  KPY C  C + F
Sbjct:  137 CSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNL-------------KNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNL------KNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH---TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKP-YHCSDCGKSFTTQSNLK-----NHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGE-------KPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH-TGEKPYHCSDCGKSFTTQSNLKKHQRI-HTGEKPYYCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSF 592          

HSP 5 Score: 139.428 bits (350), Expect = 3.370e-33
Identity = 127/493 (25.76%), Postives = 201/493 (40.77%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSP---SDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEID--KRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C+ CGK+F     L+ H+  HTG K + C  C K FT +S++K H  +H   K + C  CGK+FT + N+  H ++         S   +    +SN              K      T + P   SD  +      N       H   +P H S+      +  N       K+HQ I   E      D  +       ++ H+ I    TG + + C  C K +    +L  H RIHT +KP+ C  C KSF  +S LKNH + H   K + C  C K F  +  LK H+++H  +K  + C  C + F T  +L+     +H R      P           +    ++ +   T         KP   ++        + +   +R  +  + + C+ CGKS+  +  L  H + H +      C  C KSF T  +++ H R  H   + + C  C   F T+++L  H  +H+  KPY C  C + F
Sbjct:   53 CSDCGKSFNQQSTLKTHQRIHTGEKPYHCSDCGKSFTTQSNLKKHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNL-------------KNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNL------KNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH---TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKP-YHCSDCGKSFTTQSNLK-----NHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGE-------KPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH-TGEKPYHCSDCGKSFTTQSNLKNHQRI-HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSF 508          

HSP 6 Score: 139.428 bits (350), Expect = 3.523e-33
Identity = 127/490 (25.92%), Postives = 200/490 (40.82%), Query Frame = 1
Query: 1234 CGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSP---SDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEID--KRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            CGK+F T   L+ H+  HTG K + C  C K F Q+S++K H  +H   K + C  CGK+FT + N+  H ++         S   +    +SN              K      T + P   SD  +      N       H   +P H S+      +  N       K+HQ I   E      D  +       ++ H+ I    TG + + C  C K +    +L  H RIHT +KP+ C  C KSF  +S LKNH + H   K + C  C K F  +  LK H+++H  +K  + C  C + F T  +L+     +H R      P           +    ++ +   T         KP   ++        + +   +R  +  + + C+ CGKS+  +  L  H + H +      C  C KSF T  +++ H R  H   + + C  C   F T+++L  H  +H+  KPY C  C + F
Sbjct:   28 CGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFNQQSTLKTHQRIHTGEKPYHCSDCGKSFTTQSNLKKHQRIHTGEKPYHCSDCGKSFTTQSNL-------------KNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNL------KNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH---TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKP-YHCSDCGKSFTTQSNLK-----NHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGE-------KPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH-TGEKPYHCSDCGKSFTTQSNLKNHQRI-HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSF 480          

HSP 7 Score: 107.457 bits (267), Expect = 4.607e-23
Identity = 111/464 (23.92%), Postives = 179/464 (38.58%), Query Frame = 1
Query: 1303 FECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEID--KRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            F    C K FT +S++K H  +H   K + C  CGK+F  +  + TH ++         S   +    +SN             KK   +                          H   +P H S+      +  N       K+HQ I   E      D  +       ++ H+ I    TG + + C  C K +    +L  H RIHT +KP+ C  C KSF  +S LKNH + H   K + C  C K F  +  LK H+++H  +K  + C  C + F T  +L+     +H R      P           +    ++ +   T         KP   ++        + +   +R  +  + + C+ CGKS+  +  L  H + H +      C  C KSF T  +++ H R  H   + + C  C   F T+++L  H  +H+  KPY C  C + F
Sbjct:   23 FTTQNCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFNQQSTLKTHQRIHTGEKPYHCSDCGKSFTTQSN------------LKKHQRI--------------------------HTGEKPYHCSDCGKSFTTQSNL------KNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH---TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKP-YHCSDCGKSFTTQSNLK-----NHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGE-------KPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH-TGEKPYHCSDCGKSFTTQSNLKNHQRI-HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSF 424          

HSP 8 Score: 106.686 bits (265), Expect = 8.020e-23
Identity = 81/294 (27.55%), Postives = 127/294 (43.20%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQ-YLWNENPTNEN--HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKL 2097
            C+ CGK+F T   L+ H+  HTG K + C  C K FT +S++K H  +H   K + C  CGK+FT + N+  H ++         S   +    +SN              K      T + P   ++  + +    N  N    H   +P H S+      +  N  K     + +      D  +       ++ H+ I    TG + + C  C K +    +L  H RIHT +KP+ C  C KSF  +S LKNH + H + K + C  C K F  +  LK H+++H  +K 
Sbjct:  389 CSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNL-------------KNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKKHQRIHTGEKPYYCSDCGKSFTTQSNLKNHQRIH---TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTEEKPYHCSDCGKSFATQSQLKNHQRIHTGEKT 666          

HSP 9 Score: 73.559 bits (179), Expect = 1.259e-12
Identity = 73/251 (29.08%), Postives = 102/251 (40.64%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSR----HVDEKHAASSSCIEGLP-------EGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   SNL+ H  +HT  +PY C  C K F  + +LK H+     +  K   C  C K   +Q  L+NH ++H  E   HC  C K F  Q +L      H  EK    S C +            R   GE     +        Q      + I    +K   C  C   F T++   NH  +    +  H +  C K+F + S    H Q +H +   Y+C+ C   FA +S   NHQ+
Sbjct:  414 PYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH--TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKKHQRIHTGEKPYYCSDCGKSFTTQSNLKNHQRI-HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSD-CGKSFTTQSNLKNH-QRIHTEEKPYHCSDCGKSFATQSQLKNHQR 659          

HSP 10 Score: 73.1738 bits (178), Expect = 1.641e-12
Identity = 68/240 (28.33%), Postives = 100/240 (41.67%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   SNL++H  +HT  +PY C  C K F  + +LK H+     +  K   C  C K   +Q  L+NH ++H  E   HC  C K F  Q +L  H            + +  G KP    S          + +  + I        +K   C  C   F T++   NH  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F  +S+  NHQ+
Sbjct:   78 PYHCSDCGKSFTTQSNLKKHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH--TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNH------------QRIHTGEKPY-HCSDCGKSFTTQSNLKNHQRI-----HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSD-CGKSFTTQSNLKNH-QRIHTGEKPYHCSDCGKSFTTQSNLKNHQR 295          

HSP 11 Score: 73.1738 bits (178), Expect = 1.865e-12
Identity = 68/240 (28.33%), Postives = 100/240 (41.67%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K FN+ S L+ H  +HT  +PY C  C K F  + +LK H+     +  K   C  C K   +Q  L+NH ++H  E   HC  C K F  Q +L  H            + +  G KP    S          + +  + I        +K   C  C   F T++   NH  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F  +S+  NHQ+
Sbjct:   50 PYHCSDCGKSFNQQSTLKTHQRIHTGEKPYHCSDCGKSFTTQSNLKKHQRIH--TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNH------------QRIHTGEKPY-HCSDCGKSFTTQSNLKNHQRI-----HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSD-CGKSFTTQSNLKNH-QRIHTGEKPYHCSDCGKSFTTQSNLKNHQR 267          

HSP 12 Score: 72.7886 bits (177), Expect = 2.410e-12
Identity = 68/240 (28.33%), Postives = 99/240 (41.25%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   SNL+ H  +HT  +PY C  C K F  + +LK H+     +  K   C  C K   +Q  L+NH ++H  E   HC  C K F  Q +L  H            + +  G KP    S          + +  + I        +K   C  C   F T++   NH  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F  +S+  NHQ+
Sbjct:  134 PYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH--TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNH------------QRIHTGEKPY-HCSDCGKSFTTQSNLKNHQRI-----HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSD-CGKSFTTQSNLKNH-QRIHTGEKPYHCSDCGKSFTTQSNLKNHQR 351          

HSP 13 Score: 72.7886 bits (177), Expect = 2.410e-12
Identity = 68/240 (28.33%), Postives = 99/240 (41.25%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   SNL+ H  +HT  +PY C  C K F  + +LK H+     +  K   C  C K   +Q  L+NH ++H  E   HC  C K F  Q +L  H            + +  G KP    S          + +  + I        +K   C  C   F T++   NH  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F  +S+  NHQ+
Sbjct:  190 PYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH--TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNH------------QRIHTGEKPY-HCSDCGKSFTTQSNLKNHQRI-----HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSD-CGKSFTTQSNLKNH-QRIHTGEKPYHCSDCGKSFTTQSNLKNHQR 407          

HSP 14 Score: 72.7886 bits (177), Expect = 2.410e-12
Identity = 68/240 (28.33%), Postives = 99/240 (41.25%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   SNL+ H  +HT  +PY C  C K F  + +LK H+     +  K   C  C K   +Q  L+NH ++H  E   HC  C K F  Q +L  H            + +  G KP    S          + +  + I        +K   C  C   F T++   NH  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F  +S+  NHQ+
Sbjct:  246 PYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH--TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNH------------QRIHTGEKPY-HCSDCGKSFTTQSNLKNHQRI-----HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSD-CGKSFTTQSNLKNH-QRIHTGEKPYHCSDCGKSFTTQSNLKNHQR 463          

HSP 15 Score: 72.7886 bits (177), Expect = 2.410e-12
Identity = 68/240 (28.33%), Postives = 99/240 (41.25%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   SNL+ H  +HT  +PY C  C K F  + +LK H+     +  K   C  C K   +Q  L+NH ++H  E   HC  C K F  Q +L  H            + +  G KP    S          + +  + I        +K   C  C   F T++   NH  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F  +S+  NHQ+
Sbjct:  302 PYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH--TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNH------------QRIHTGEKPY-HCSDCGKSFTTQSNLKNHQRI-----HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSD-CGKSFTTQSNLKNH-QRIHTGEKPYHCSDCGKSFTTQSNLKNHQR 519          

HSP 16 Score: 72.0182 bits (175), Expect = 4.652e-12
Identity = 68/240 (28.33%), Postives = 98/240 (40.83%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY CS C K F   SNL+ H  +HT  +PY C  C K F  + +LK H+     +  K   C  C K   +Q  L+NH ++H  E   HC  C K F  Q +L  H            + +  G KP    S          + +  + I        +K   C  C   F T++   NH  +    +  H +  C K+F + S    H Q +H     Y C+ C   F  +S+  NHQ+
Sbjct:  358 PYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNHQRIH--TGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFTTQSNLKNH------------QRIHTGEKPY-HCSDCGKSFTTQSNLKNHQRI-----HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSD-CGKSFTTQSNLKKH-QRIHTGEKPYYCSDCGKSFTTQSNLKNHQR 575          

HSP 17 Score: 65.0846 bits (157), Expect = 5.169e-10
Identity = 64/234 (27.35%), Postives = 95/234 (40.60%), Query Frame = 1
Query: 4255 CHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            C K F   SNL+ H  +HT  +PY C  C K F  + +LKTH+     +  K   C  C K   +Q  L+ H ++H  E   HC  C K F  Q +L  H            + +  G KP    S          + +  + I        +K   C  C   F T++   NH  +    +  H +  C K+F + S    H Q +H     Y+C+ C   F  +S+  NHQ+
Sbjct:   28 CGKSFTTQSNLKNHQRIHTGEKPYHCSDCGKSFNQQSTLKTHQRIH--TGEKPYHCSDCGKSFTTQSNLKKHQRIHTGEKPYHCSDCGKSFTTQSNLKNH------------QRIHTGEKPY-HCSDCGKSFTTQSNLKNHQRI-----HTGEKPYHCSDCGKSFTTQSNLKNHQRIHTGEKPYHCSD-CGKSFTTQSNLKNH-QRIHTGEKPYHCSDCGKSFTTQSNLKNHQR 239          
BLAST of Zinc finger, C2H2 type vs. Ensembl Cavefish
Match: znf710a (zinc finger protein 710 [Source:NCBI gene;Acc:103038285])

HSP 1 Score: 140.969 bits (354), Expect = 1.343e-33
Identity = 105/328 (32.01%), Postives = 155/328 (47.26%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNG-TEVLSQ-SQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPS--AENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPD 2196
            C  CGK FK P  L+ H +TH G +  +C +CKK FTQ S +K HM+ H ++K + C+FCG+ F Y   + TH +  H+NG   V +Q   E   +      +   + P  F+      E ++S +  +++  +L                HQ NT SY+ S     F+++   K H   +L+  V      T Q   H+       G + ++C  C + +  S +L RH+ IHT  +PFQC++C KSF  K  LK H   H  +K F C++C K FN    L  H  LH   K  F C  C  +FN   +L  H    H    A+PD
Sbjct:  381 CLHCGKLFKQPSHLQTHLLTHQGTRPHKCTVCKKAFTQTSHLKRHMLQHSDIKPYSCRFCGRGFAYPSELRTH-EAKHENGHCHVCTQCGMEFPTHAHLRRHQVSHQGPTTFQ----CTECHKSFAYRSQLQNHLMK--------------HQ-NTRSYVCSECGMEFVQIHHLKQH---MLTHKVL-----TQQALEHK-------GMKGYKCDVCSREFTLSANLKRHMLIHTSVRPFQCHVCFKSFVQKQTLKTHMIVHLPVKPFKCKVCGKSFNRMYNLLGHMHLHAGSK-PFKCIYCTSKFNLKGNLSRHMKVKHGILDASPD 672          

HSP 2 Score: 98.2117 bits (243), Expect = 3.776e-20
Identity = 87/364 (23.90%), Postives = 148/364 (40.66%), Query Frame = 1
Query: 1834 GFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRL------------FKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLMTGIINRNPIGSLTNQIGQSDLEANDQSETFTAFRLEDLDMNSAQ 2889
            G +   C  C KL+++   L  H+  H   +P +C +C K+F   S LK H   H  +K +SC  C + F     L+ H   HE      VC  C   F T  HLR H        +++  P+  Q          + +  +N    + N     +  + +E   + + I  + +  L++  L            +KC+ C + +     L  H+  H S      C  C KSFV  ++++ H+   HL  + F C  C   F    +L+ H  +H+ SKP+ C  C  +F  K    RH+  K                 GI++ +P G   + + + ++  + + E +     E+L  N+AQ
Sbjct:  375 GIKPHECLHCGKLFKQPSHLQTHLLTHQGTRPHKCTVCKKAFTQTSHLKRHMLQHSDIKPYSCRFCGRGFAYPSELRTHEAKHENGHCH-VCTQCGMEFPTHAHLRRH-------QVSHQGPTTFQCTECHKSFAYRSQL-QNHLMKHQN----TRSYVCSECGMEFVQIHHLKQHMLTHKVLTQQALEHKGMKGYKCDVCSREFTLSANLKRHMLIHTSVRPFQ-CHVCFKSFVQKQTLKTHMIV-HLPVKPFKCKVCGKSFNRMYNLLGHMHLHAGSKPFKCIYCTSKFNLKGNLSRHMKVKH----------------GILDASPDGQ--DNLPEMEVHEDYEEEGYDYSERENLASNNAQ 705          

HSP 3 Score: 70.8626 bits (172), Expect = 8.747e-12
Identity = 46/159 (28.93%), Postives = 71/159 (44.65%), Query Frame = 1
Query: 1702 SAENFIKLDWDKSHQGILLSEDVE------RIDKETGQIQLHEMI-KDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYH 2157
            +AE  +  ++++S Q ++  +         +ID+    +Q+ E    D   G +R++CR C K Y    +L  HI  H   KP +C  C K F+  S L+ H  +H   +   C +C K F     LK H  L   D   + C+ C R F     LR H
Sbjct:  296 AAEMGLPAEYEESGQAMMWGDGENSLGRRMQIDRLDINVQIDESYCVDVGEGLKRWKCRMCEKSYTSKYNLVTHILGHNGIKPHECLHCGKLFKQPSHLQTHLLTHQGTRPHKCTVCKKAFTQTSHLKRH-MLQHSDIKPYSCRFCGRGFAYPSELRTH 453          

HSP 4 Score: 60.8474 bits (146), Expect = 1.174e-8
Identity = 45/125 (36.00%), Postives = 65/125 (52.00%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHA---ASSSCIEGLPE 4605
            Y C +C + F  ++NL++H+ +HT +RP+QC  C K F  + +LKTH    H  V K  +C +C K       L  H+ LH       C  C   F+L+ +LSRH+  KH    AS    + LPE
Sbjct:  557 YKCDVCSREFTLSANLKRHMLIHTSVRPFQCHVCFKSFVQKQTLKTHMIV-HLPV-KPFKCKVCGKSFNRMYNLLGHMHLHAGSKPFKCIYCTSKFNLKGNLSRHMKVKHGILDASPDGQDNLPE 679          

HSP 5 Score: 54.6842 bits (130), Expect = 8.674e-7
Identity = 36/98 (36.73%), Postives = 45/98 (45.92%), Query Frame = 1
Query: 2377 RLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            + +KC  C KSY  K  L  H+  H +    + C  C K F     +Q HL T H   R   C  C   F   + L RH L HS+ KPY+C  C R F
Sbjct:  349 KRWKCRMCEKSYTSKYNLVTHILGH-NGIKPHECLHCGKLFKQPSHLQTHLLT-HQGTRPHKCTVCKKAFTQTSHLKRHMLQHSDIKPYSCRFCGRGF 444          

HSP 6 Score: 52.7582 bits (125), Expect = 3.616e-6
Identity = 33/107 (30.84%), Postives = 53/107 (49.53%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            P+ C++C K F + S+L++H+  H+ ++PY C  C + F +   L+THEA KH +      C  C     +   LR H   H    +  C  C+K F  +  L  H+
Sbjct:  406 PHKCTVCKKAFTQTSHLKRHMLQHSDIKPYSCRFCGRGFAYPSELRTHEA-KHEN-GHCHVCTQCGMEFPTHAHLRRHQVSHQGPTTFQCTECHKSFAYRSQLQNHL 510          
BLAST of Zinc finger, C2H2 type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005225.1 (pep scaffold:Pmarinus_7.0:GL501320:452850:491555:1 gene:ENSPMAG00000004710.1 transcript:ENSPMAT00000005225.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.785 bits (434), Expect = 4.508e-43
Identity = 169/672 (25.15%), Postives = 281/672 (41.82%), Query Frame = 1
Query: 1825 QVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNP--PDVKPLIWNE------------LLNQPIPIAEI-DKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLMT-----------GIINRNPIGSLTNQIGQSDLEANDQSETFTAFRLEDLDMNSAQSSNILVTNYVNEFSSFPSTEKYMIVSLDNPNSKDQSGSSQQNYYASNIXXXXXXXXXXARNQIESQT-DQSENIMSLLDSGQMGVTPVDIGSLFAVQGFNGNIATQLVDHGNIQSNDIDYSQPQENIYYYQALNEIP----TVECPIECPSKSSLAD-KFPILKASLFSDDELTSNPKESNPFTNSSMVTNSNGSQFXXXXXXXXXXXXXXXXXXLQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVC 3744
            +V G R   C +C K ++K  DL RHIRIHT +KP++C  C ++F +KS L  H K+H  LKEF C +C+K+F+ + +LKVH +LH   K  F C  C+++F T  H + H + SH +              +  Q   +  S +  P  +   P  P  +P++  E            + +Q +P   + D   L  +R ++C +C K++K   +L +H++ H +      C  C++SFV+   ++ H+RT H+  + + C+ C   F T  SL RH   HS ++P+ CP C + FK  + C +H+   +    ++ + QQ+ L T           G++   P  S  +   Q+ L    Q  +     L      SAQ   ++      + +     E+ ++ +L    S+++  +SQ    A+              +Q E QT  Q       L  G        I   F  QG       Q      +Q++    SQP    Y+ Q +   P     V C I    +SS  + +    ++   SD E ++       + N     +S+  Q                   ++SH    P K    CA C   F  S  L  H+++ H   + + C++C   F+   SL  H   H     F C  C
Sbjct:  449 RVNGVRWHMCPYCNKEFKKPSDLVRHIRIHTHEKPYKCTQCFRAFAVKSTLTAHRKTHTGLKEFMCPLCDKLFSTQGSLKVHIRLHTGAK-PFDCPHCNKKFRTSGHRKSHIA-SHFKD-----------AQMRKQRFPRKPSRRRLPKQDMGLPEIPLQEPILITESGLIQQVTRSSHMYSQYLPDGMLSDGSGL--DRPYRCGYCNKAFKKSSHLKQHIRSH-TGEKPYRCGQCSRSFVSSGVLKAHIRT-HVGLKAYKCVMCDGTFTTNGSLKRHMSTHSETRPFMCPYCQKTFKTSVNCKKHMKTHRYELAQQLQ-QQSTLPTEHMEDMASHQQGMLVLTPEQSTVSSEQQAMLGLGQQQPSDQQALLGLAPQQSAQQQTLIGLEQTQQLA-----EQQLVQAL----SQEEFVTSQHGLQAN-------------MDQFEQQTLSQQTYEQQALTQG------FTITESFGQQG-------QFTAVQQLQASSTLESQPLTTTYHSQEMLTRPISPQIVICQILSLQESSQHEVQLSAEQSEYQSDGEESTRRSYRCGYCNKGFKKSSHLKQH------------------VRSHTGEKPFK----CAQCGRGFVSSGVLKAHMRT-HTGEKAYKCDLCDATFTTNGSLTRHMVMHTSMHPFKCPFC 1044          

HSP 2 Score: 145.591 bits (366), Expect = 4.610e-35
Identity = 186/836 (22.25%), Postives = 306/836 (36.60%), Query Frame = 1
Query:  580 REFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGE-----ECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIED-GMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPD------------VNRSISKRGR-PXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIK------------------------VIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLA---ETNQSPSDDAEITQYLWNENP----TNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLH-----------------EMIKDQVT-----------------------------------GFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPD-----PXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNR----------LFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNR 2736
            R   C +C   +    +L+ HI I HT+E            YKC  C   F+ K    AH   H   +E  C  C  LF  +  L  H+  H   +      C+ +  T+ + K  I    F++    K+ + R    +    P +D G+P  P++    PI   E    ++      ++  +Y+Q     D M  D             N++  K     +   + + +    C  C ++F +  +L+ H  TH G+K ++C +C   FT   S+K HM  H   + F+C +C K F    N   H+K                          H+ G  VL+  Q  + +E        Q+ P+  + +  LA      Q      E TQ L  +      + E   + Q   Q+N D +     +    +     QG  ++E   +  + T   QL                  EM+   ++                                     R +RC +C K ++KS  L +H+R HT +KPF+C  C + F    VLK H ++H   K + C++C+  F    +L  H  +H      F C  C+  F T  H R H  T      A+ D         +               + +    + + P     +  +LL Q    AE D+     +R            KC+ C KS+K    L   L+   S           +S     ++  H++T H  ++ F C  C + F TK SL  H  +H+ +KP+ CP C +RF+   +   HI +     ++R R
Sbjct:  454 RWHMCPYCNKEFKKPSDLVRHIRI-HTHE----------KPYKCTQCFRAFAVKSTLTAHRKTHTGLKEFMCPLCDKLFSTQGSLKVHIRLHTGAKPFDCPHCNKKFRTSGHRKSHIASH-FKDAQMRKQRFPR--KPSRRRLPKQDMGLPEIPLQE---PILITESGLIQQ----VTRSSHMYSQYLP--DGMLSDGSGLDRPYRCGYCNKAFKKSSHLKQHIRSHTGEKPYRCGQCSRSFVSSGVLKAHIRTHVGLKAYKCVMCDGTFTTNGSLKRHMSTHSETRPFMCPYCQKTFKTSVNCKKHMKTHRYELAQQLQQQSTLPTEHMEDMASHQQGMLVLTPEQSTVSSEQQAMLGLGQQQPSDQQALLGLAPQQSAQQQTLIGLEQTQQLAEQQLVQALSQEEFVTSQHGLQANMDQFEQQTLSQQTYEQQALTQGFTITESFGQQGQFTAVQQLQASSTLESQPLTTTYHSQEMLTRPISPQIVICQILSLQESSQHEVQLSAEQSEYQSDGEESTRRSYRCGYCNKGFKKSSHLKQHVRSHTGEKPFKCAQCGRGFVSSGVLKAHMRTHTGEKAYKCDLCDATFTTNGSLTRHMVMHT-SMHPFKCPFCEESFRTSLHCRKHMRTHQEHGDADADDECEEGEADRMAAARRSRPGILTLSQEETAVLAQSGPAEAASVSEKLLVQ--SAAERDRVSEMKDRQEELDDEPRHANKCSFCPKSFKKPSDLVR-LRSLPSDPIPVPATSLPRSITVKSTLDCHVKT-HTGQKHFKCHICNSPFSTKGSLKVHMRLHTGAKPFKCPHCEQRFRTSGHRKSHIQSHFKPSEQRPR 1261          

HSP 3 Score: 93.9745 bits (232), Expect = 2.350e-19
Identity = 77/303 (25.41%), Postives = 121/303 (39.93%), Query Frame = 1
Query: 1291 GIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYI--PSAENFIKLDWDKS----HQGILLSED-----VERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            G++   CP C K F + S +  H+ +H + K + C  C +AF  +  +  H K  H    E +    + L +                 K+     T   P D     +          +  S+  + Q     +   PS     K D         + IL++E      V R      Q     M+ D     R +RC +C K ++KS  L +HIR HT +KP++C  C +SF    VLK H ++H  LK + C +C+  F    +LK H   H   +  F+C  C + F T  + + H  T
Sbjct:  452 GVRWHMCPYCNKEFKKPSDLVRHIRIHTHEKPYKCTQCFRAFAVKSTLTAHRKT-HTGLKEFMCPLCDKLFSTQGSL------------KVHIRLHTGAKPFDCPHCNKKFRTSGHRKSHIASHFKDAQMRKQRFPRKPSRRRLPKQDMGLPEIPLQEPILITESGLIQQVTRSSHMYSQYLPDGMLSDGSGLDRPYRCGYCNKAFKKSSHLKQHIRSHTGEKPYRCGQCSRSFVSSGVLKAHIRTHVGLKAYKCVMCDGTFTTNGSLKRHMSTHSETR-PFMCPYCQKTFKTSVNCKKHMKT 740          

HSP 4 Score: 91.2781 bits (225), Expect = 1.649e-18
Identity = 86/327 (26.30%), Postives = 135/327 (41.28%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIH-ENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMV-VHDNVKG------FLCQFCGKAFTYEHNMNTHIKVIHKN 1464
            C+IC   F       KH+  H END+  +C  C  S+N E NLL+H A  H+ + T   D           C   FSR  + +AH ++H+ +E L C  C   F  +  L++H++ H+  E    R  T     C+ICH  F+ V  +++H          H+ I   +  +  +R          +  R      C+      Q  SQL       +  I    RP             C  CG+AF     L+ H+  HTG + + C  C   F+Q+ +++ H+  VH + K       F C+ C   F    ++N HI  +H +
Sbjct:    4 CDICNQLFHKHSQLQKHLRQHQENDKPHRCDQCPASFNVEYNLLLHRAT-HSVDQTACPD-----------CGRTFSRIASLKAHIMLHEKEENLMCTECGDEFTLQSQLERHMDMHR-QELSGARTFT-----CRICHQEFQRVSTLREHM-------RSHYKIRASLSTRSYKR----------NIDRSGFSHRCEHCMKTFQKPSQLIR-----HIRIHTGERPFT-----------CEECGRAFNQKGALQIHKAKHTGERPYRCAFCPHTFSQRGNLRAHIQRVHSDAKPGGEQPVFQCEDCSCVFKKLGSLNAHISRMHAD 279          

HSP 5 Score: 69.3218 bits (168), Expect = 7.834e-12
Identity = 32/78 (41.03%), Postives = 45/78 (57.69%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH 1458
            C  C K+F  P  L+RH   HTG + + C +C K F Q ++++IHM  H   K + CQ+C  AF+ + NM  HIK  H
Sbjct: 1693 CDHCDKSFAKPSQLQRHNRIHTGERPYICQVCDKAFNQTNALQIHMKKHTGEKPYKCQYCDMAFSQKGNMKIHIKRAH 1770          

HSP 6 Score: 68.5514 bits (166), Expect = 1.299e-11
Identity = 64/267 (23.97%), Postives = 110/267 (41.20%), Query Frame = 1
Query: 3130 QMGVTPVDIGSLFAVQGFNGNIATQLVDHGNIQSNDIDYSQPQ-----------ENIYYYQALNEIPTVECPIECPSKSSLA--DKFP--ILKASLFSDDELTSNPKESNPFTNSSMVTNSNGSQFXXXXXXXXXXXXXXXXXXLQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            Q   TPV        +G   ++  QL+D     S D  + QPQ                 QAL        P+E    S++A  ++ P  + +A+  +    T  P+   P  + S+       Q  +                L +   ++ ++ +H C  C+ +FK    LV H++  H   + + C  C +AF+ K +L AH KTH   +    F+C  C++ F +  SL  H+R+  +     + C HCNK ++T+    SH+
Sbjct:  309 QTVATPVSGAGARGARGVT-DVIQQLLDLSEQVSADPTHGQPQLQQLNLDSASISQDILQQALANSGLTAIPVESQVASAMASGNEVPTALQRAAAATIPRSTGRPRLQLP-GSLSLARQGGKKQLSMIKKRIEMFL-------LGTWRRVNGVR-WHMCPYCNKEFKKPSDLVRHIRI-HTHEKPYKCTQCFRAFAVKSTLTAHRKTHTGLKE---FMCPLCDKLFSTQGSLKVHIRL--HTGAKPFDCPHCNKKFRTSGHRKSHI 559          

HSP 7 Score: 65.0846 bits (157), Expect = 1.495e-10
Identity = 64/257 (24.90%), Postives = 101/257 (39.30%), Query Frame = 1
Query:  703 YKCVICSCLFSRKKAHQAHCLIHQV-DEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDE-MKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNG 1467
            ++C IC+ LF +    Q H   HQ  D+   C+ CPA F  +  L  H   H +           +   C  C   F  + ++K H +  H K       E G       ++   ++   +      +   C+      Q  S L E M+       S   R  K +   +  +  C  C K F+ P  L RH   HTG + F C  C + F QK +++IH   H   + + C FC   F+   N+  HI+ +H + 
Sbjct:    2 HQCDICNQLFHKHSQLQKHLRQHQENDKPHRCDQCPASFNVEYNLLLHRATHSV-----------DQTACPDCGRTFSRIASLKAH-IMLHEKEENLMCTECGDEFTLQSQLERHMDMHRQELSGART-FTCRICHQEFQRVSTLREHMRSHYKIRASLSTRSYKRNIDRSGFSHRCEHCMKTFQKPSQLIRHIRIHTGERPFTCEECGRAFNQKGALQIHKAKHTGERPYRCAFCPHTFSQRGNLRAHIQRVHSDA 245          

HSP 8 Score: 64.3142 bits (155), Expect = 2.958e-10
Identity = 39/120 (32.50%), Postives = 54/120 (45.00%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPD------KLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            +GF   RC  C K ++K   L RHIRIHT ++PF C  C ++F  K  L+ H   H   + + C  C   F+ +  L+ H Q    D      +  F C+ C   F     L  H S  H
Sbjct:  159 SGFSH-RCEHCMKTFQKPSQLIRHIRIHTGERPFTCEECGRAFNQKGALQIHKAKHTGERPYRCAFCPHTFSQRGNLRAHIQRVHSDAKPGGEQPVFQCEDCSCVFKKLGSLNAHISRMH 277          

HSP 9 Score: 63.1586 bits (152), Expect = 6.366e-10
Identity = 28/77 (36.36%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVH 2070
            R ++C  C K + K   L RH RIHT ++P+ C +C K+F   + L+ H K H   K + C+ C+  F+ K  +K+H
Sbjct: 1689 RLYKCDHCDKSFAKPSQLQRHNRIHTGERPYICQVCDKAFNQTNALQIHMKKHTGEKPYKCQYCDMAFSQKGNMKIH 1765          

HSP 10 Score: 61.6178 bits (148), Expect = 1.608e-9
Identity = 61/263 (23.19%), Postives = 109/263 (41.44%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSD-DAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHI-RIHTQQKP------FQCYMCHKSFRLKSVLKNHF 1989
            C  C  +F     L  H  TH+ + +  CP C + F++ +S+K H+++H+  +  +C  CG  FT +  +  H+ +              H    S       +     F+++++L E  +S     A ++   +  N  + + FS++  H   T          I+     + +     E+  R   + G +Q+H   K + TG R +RC FC   + +  +L  HI R+H+  KP      FQC  C   F+    L  H 
Sbjct:   33 CDQCPASFNVEYNLLLHRATHS-VDQTACPDCGRTFSRIASLKAHIMLHEKEENLMCTECGDEFTLQSQLERHMDM--------------HRQELSGARTFTCRICHQEFQRVSTLREHMRSHYKIRASLSTRSYKRN-IDRSGFSHRCEHCMKT---FQKPSQLIRHIRIHTGERPFTCEECGRAFNQKGALQIH---KAKHTGERPYRCAFCPHTFSQRGNLRAHIQRVHSDAKPGGEQPVFQCEDCSCVFKKLGSLNAHI 273          

HSP 11 Score: 61.2326 bits (147), Expect = 2.621e-9
Identity = 56/244 (22.95%), Postives = 99/244 (40.57%), Query Frame = 1
Query: 2020 CEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPD-PXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEH------LSANN----------TNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C+ICN++F+    L+ H + H+ +     C  C   FN  ++L  H +T      A PD       +      +  HE  +N       +   ++  +   +        ++ +++LS  R F C  C + ++    L EH++ H      LS  +          ++ C+ C K+F     + +H+R  H   R F+C +C   F  K +L  H   H+  +PY C  C   F  +     HI
Sbjct:    4 CDICNQLFHKHSQLQKHLRQHQENDKPHRCDQCPASFNVEYNLLLHRATHSVDQTACPDCGRTFSRIASLKAHIMLHEKEENLMCTECGDEFTLQSQLERHM--------DMHRQELSGARTFTCRICHQEFQRVSTLREHMRSHYKIRASLSTRSYKRNIDRSGFSHRCEHCMKTFQKPSQLIRHIRI-HTGERPFTCEECGRAFNQKGALQIHKAKHTGERPYRCAFCPHTFSQRGNLRAHI 238          

HSP 12 Score: 60.8474 bits (146), Expect = 2.900e-9
Identity = 34/119 (28.57%), Postives = 62/119 (52.10%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIH------TQQKP--FQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            R   C  C K ++++  L  H++ H      ++QKP  ++C  C KSF   S L+ H + H   + + C++C+K FN    L++H + H  +K  + C+ CD  F+   +++ H   +H
Sbjct: 1653 RLHTCPLCSKSFKRATHLKEHMQTHEPGSSASRQKPRLYKCDHCDKSFAKPSQLQRHNRIHTGERPYICQVCDKAFNQTNALQIHMKKHTGEK-PYKCQYCDMAFSQKGNMKIHIKRAH 1770          

HSP 13 Score: 58.9214 bits (141), Expect = 1.321e-8
Identity = 35/128 (27.34%), Postives = 65/128 (50.78%), Query Frame = 1
Query: 2359 RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAK-KCSKKKRNRF 2739
            R+++  R   C +C K +K    L  H++ H +      C  C ++F    ++  H +T H   ++F C  C   F T+ SL  H  +H+ +KP+ CP C ++F+   +   HI++  K ++ ++ RF
Sbjct:  448 RRVNGVRWHMCPYCNKEFKKPSDLVRHIRIH-THEKPYKCTQCFRAFAVKSTLTAHRKT-HTGLKEFMCPLCDKLFSTQGSLKVHIRLHTGAKPFDCPHCNKKFRTSGHRKSHIASHFKDAQMRKQRF 573          

HSP 14 Score: 57.7658 bits (138), Expect = 2.526e-8
Identity = 32/109 (29.36%), Postives = 55/109 (50.46%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C+  FK S  L +H++S H   + + C  C ++F +   L AH +TH+  +++ C   + C+  F +  SL RH  M  +     + C +C K +KT+     H+K
Sbjct:  637 CGYCNKAFKKSSHLKQHIRS-HTGEKPYRCGQCSRSFVSSGVLKAHIRTHVGLKAYKC---VMCDGTFTTNGSLKRH--MSTHSETRPFMCPYCQKTFKTSVNCKKHMK 739          

HSP 15 Score: 57.3806 bits (137), Expect = 3.253e-8
Identity = 34/123 (27.64%), Postives = 58/123 (47.15%), Query Frame = 1
Query: 3550 FYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHND-----NLNLYRCTHCNKVYKTTRELDSHVKQLVSD 3903
            F H C +C   F+    L+ H++  H   R FTC  C +AF+ K +L  H   H   R + C     C   F    +L  H++  H+D        +++C  C+ V+K    L++H+ ++ +D
Sbjct:  161 FSHRCEHCMKTFQKPSQLIRHIRI-HTGERPFTCEECGRAFNQKGALQIHKAKHTGERPYRCAF---CPHTFSQRGNLRAHIQRVHSDAKPGGEQPVFQCEDCSCVFKKLGSLNAHISRMHAD 279          

HSP 16 Score: 55.0694 bits (131), Expect = 1.859e-7
Identity = 42/149 (28.19%), Postives = 63/149 (42.28%), Query Frame = 1
Query: 1774 RIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQ----KPFQCYMCHKSFRLKSVLKNHFKSHWKLKE---------------FS--CEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYH 2157
            RI      I LHE  ++         C  C   +     L RH+ +H Q+    + F C +CH+ F+  S L+ H +SH+K++                FS  CE C K F     L  H ++H  ++  F C+ C R FN    L+ H
Sbjct:   69 RIASLKAHIMLHEKEEN-------LMCTECGDEFTLQSQLERHMDMHRQELSGARTFTCRICHQEFQRVSTLREHMRSHYKIRASLSTRSYKRNIDRSGFSHRCEHCMKTFQKPSQLIRHIRIHTGER-PFTCEECGRAFNQKGALQIH 209          

HSP 17 Score: 53.1434 bits (126), Expect = 6.859e-7
Identity = 36/118 (30.51%), Postives = 50/118 (42.37%), Query Frame = 1
Query: 2368 SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNV-------CQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
              +RL  C  C KS+K   +L EH++ H   ++ +        C  C+KSF     +Q+H R  H   R + C  C   F    +L  H   H+  KPY C  C   F  K     HI
Sbjct: 1650 GEDRLHTCPLCSKSFKRATHLKEHMQTHEPGSSASRQKPRLYKCDHCDKSFAKPSQLQRHNRI-HTGERPYICQVCDKAFNQTNALQIHMKKHTGEKPYKCQYCDMAFSQKGNMKIHI 1766          

HSP 18 Score: 52.373 bits (124), Expect = 1.156e-6
Identity = 36/108 (33.33%), Postives = 55/108 (50.93%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTK-LRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVD 4560
            + C IC++ F++ S LQ+HL  H +  +P++C +CP  F    +L  H AT     T    C      + S   L+ H+ LH +E ++ C  C   F LQ  L RH+D
Sbjct:    2 HQCDICNQLFHKHSQLQKHLRQHQENDKPHRCDQCPASFNVEYNLLLHRATHSVDQTACPDCGRTFSRIAS---LKAHIMLHEKEENLMCTECGDEFTLQSQLERHMD 106          

HSP 19 Score: 51.9878 bits (123), Expect = 1.392e-6
Identity = 62/247 (25.10%), Postives = 109/247 (44.13%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEV-IPEIPKKLIKCLSCSFIFNTKAK----YDNHFCVGLKAEKSHLN---RC--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 4950
            + C  C+K F + S+L +H+ +HT  +PY+C +C + F  + +L  H  T H+ + K   C LC KL  +Q +L+ H++LH       C  C K F        H+      +    +  P  RKP+                +++ P +++ +PEIP +    ++ S +     +    Y  +   G+ ++ S L+   RC  C+K F+ +S    H++  H     Y C QC+  F        H
Sbjct:  456 HMCPYCNKEFKKPSDLVRHIRIHTHEKPYKCTQCFRAFAVKSTLTAHRKT-HTGL-KEFMCPLCDKLFSTQGSLKVHIRLHTGAKPFDCPHCNKKFRTSGHRKSHIASHFKDAQMRKQRFP--RKPS----------------RRRLPKQDMGLPEIPLQEPILITESGLIQQVTRSSHMYSQYLPDGMLSDGSGLDRPYRCGYCNKAFKKSSHLKQHIRS-HTGEKPYRCGQCSRSFVSSGVLKAH 681          

HSP 20 Score: 50.8322 bits (120), Expect = 3.514e-6
Identity = 30/112 (26.79%), Postives = 57/112 (50.89%), Query Frame = 1
Query: 1852 CRFCYKLYRKSCDLTRHIR-IHTQQKPFQCYMCHKSFRLKSVLKNHFKSH--------WKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHY 2160
            C  C++       L +H+R +H + +   C +C KSF+  + LK H ++H         K + + C+ C+K F     L+ H ++H  ++  ++C++CD+ FN    L+ H 
Sbjct: 1628 CPECHQPCTSPMLLRQHLRLVHGEDRLHTCPLCSKSFKRATHLKEHMQTHEPGSSASRQKPRLYKCDHCDKSFAKPSQLQRHNRIHTGER-PYICQVCDKAFNQTNALQIHM 1738          

HSP 21 Score: 50.447 bits (119), Expect = 5.047e-6
Identity = 78/384 (20.31%), Postives = 136/384 (35.42%), Query Frame = 1
Query:  484 INGTGKQTCEICEVEFPSKRTYLKHMSIHENDR-----------------EFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHL----NDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTS-----------GHWPIEDGMPVK--PVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQ-------GRSQLDEMKPD---VNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVT----HTGIKEFECP----ICKKGFTQKSSV---KIHMVVH------DNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            ++G    TC IC  EF    T  +HM  H   R                   +C  C  ++     L+ HI  IHT           E  + C  C   F++K A Q H   H  +    C  CP  F  +  L  H+    +D K G E           +C+ C  +F+ +G++  H  R H   S               +   +PV+    + V TP+        R  + +  Q + L  Q       G+ QL ++  D   +++ I ++             +   +      + P  L+R         TG    + P    + ++G  ++ S+   +I M +       + V+  +C +C K F    ++  HI++
Sbjct:  112 LSGARTFTCRICHQEFQRVSTLREHMRSHYKIRASLSTRSYKRNIDRSGFSHRCEHCMKTFQKPSQLIRHIR-IHTG----------ERPFTCEECGRAFNQKGALQIHKAKHTGERPYRCAFCPHTFSQRGNLRAHIQRVHSDAKPGGE-------QPVFQCEDCSCVFKKLGSLNAHISRMHADESYTSQLLVARILAVGVLLTWLPVRMCAPQTVATPVSGAGARGARGVTDVIQQLLDLSEQVSADPTHGQPQLQQLNLDSASISQDILQQALANSGLTAIPVESQVASAMASGNEVPTALQRAAAATIPRSTGRPRLQLPGSLSLARQGGKKQLSMIKKRIEMFLLGTWRRVNGVRWHMCPYCNKEFKKPSDLVRHIRI 477          

HSP 22 Score: 50.0618 bits (118), Expect = 5.399e-6
Identity = 34/110 (30.91%), Postives = 54/110 (49.09%), Query Frame = 1
Query: 4228 LSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            L  PY C  C+K F ++S+L+QH+  HT  +PY+C +C + F     LK H  T H  + K  +C +C     +  +L+ H+  H       C  C K F    +  +H+
Sbjct:  631 LDRPYRCGYCNKAFKKSSHLKQHIRSHTGEKPYRCGQCSRSFVSSGVLKAHIRT-HVGL-KAYKCVMCDGTFTTNGSLKRHMSTHSETRPFMCPYCQKTFKTSVNCKKHM 738          

HSP 23 Score: 50.0618 bits (118), Expect = 5.775e-6
Identity = 27/106 (25.47%), Postives = 45/106 (42.45%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            Y C  C+KGF ++S+L+QH+  HT  +P++C +C + F                               S   L+ H++ H  E +  C +C   F     L+RH+
Sbjct:  955 YRCGYCNKGFKKSSHLKQHVRSHTGEKPFKCAQCGRGF------------------------------VSSGVLKAHMRTHTGEKAYKCDLCDATFTTNGSLTRHM 1030          
BLAST of Zinc finger, C2H2 type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002487.1 (pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1 gene:ENSPMAG00000002270.1 transcript:ENSPMAT00000002487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.265 bits (334), Expect = 1.444e-32
Identity = 131/495 (26.46%), Postives = 189/495 (38.18%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILL----RRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPS--AENFIKLDWDKSHQGILLSEDVERIDKETGQ-------IQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C  CGK F +   L    + H  THTG K F C  C K F+ KS++K H + H   K F+C  CGK F+    M  H                                          L  T + P    +  Q     +    + F++     +    +I +   + F++    K H  I   E    + KE G+       + +H+      TG + F C+ C + + +   L  H RIHT +KP+ C +C KSF L   LK H K+H K + + CE+C K F+ K+TL VH + H   K  ++C  C  +F+ G HL+ H                                   K       P   K       L   +   E      S  + F C HCGK Y  K  L  H   H S     +C+ C K F    S++ H  T H   + F C +C   F   +SL  H L+H+  K + CP C +RF
Sbjct:   16 CEQCGKTFSSRRTLGQHLKAHLRTHTGEKPFICQDCGKRFSLKSTLKTHSLTHSLEKPFVCNDCGKGFSKASYMKVH-----------------------------------------RLTHTGERPYACQDCGQRFSQPSSLKTHQFTH-----TGERPFICTDCGKRFLQASTLKEHHKIHTGER-PYVCKECGKSFSYSSAMTVHQKTH---TGEKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKP-YICTHCGNKFSQGQHLKAH-----------------------------------KRIHTGERPFICKICGKGFALKSTLKTHEFTH---SVEKPFICKHCGKGYSLKSTLKNHEIVH-SGEKPFLCKECGKGFSQGSSLKNHKLT-HDGEQPFICQECGRRFSQTSSLKTHQLLHTGEKTFLCPDCGKRF 419          

HSP 2 Score: 128.257 bits (321), Expect = 5.850e-31
Identity = 120/508 (23.62%), Postives = 203/508 (39.96%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDV------------------------KPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C  CGK F     L+ H +TH+  K F C  C KGF++ S +K+H + H   + + CQ CG+ F+   ++ TH                      + +          RF + ++L E ++  + +     Y+  E   + ++ S    HQ       P                  + +D  R   +   ++ H+ I    TG + + C  C K +  + +L  H + H +++P+ C +C K F  K  L  H ++H  +K + C  C   F+  Q LK H+++H  ++  F+CKIC + F     L+ H  T    S+  P            +      +LKN    +S   P +                        +P I  E   +    + +   +L  +  + F C  CGK + F   L +H + H S+    +C+ C KSF  Y +++ H +T H   + F+C  C   F  K  L  H   H+  KPY C  C + F
Sbjct:   48 CQDCGKRFSLKSTLKTHSLTHSLEKPFVCNDCGKGFSKASYMKVHRLTHTGERPYACQDCGQRFSQPSSLKTH------------------QFTHTGERPFICTDCGKRFLQASTLKEHHKIHTGERP---YVCKECGKSFSYSSAMTVHQKTHTGEKP-----------------FICKDCGRGFAQKPHLKTHQRIH---TGEKPYACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKRIHTGERP-FICKICGKGFALKSTLKTHEFT---HSVEKP-----FICKHCGKGYSLKSTLKNHEIVHSGEKPFLCKECGKGFSQGSSLKNHKLTHDGEQPFICQECGRRFSQTSSLKTHQLLHTGEKTFLCPDCGKRFSFPSSLKQHQQMH-SSERPFICKECGKSFSYYSNLKVHQKT-HTGDKPFTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCGKYF 503          

HSP 3 Score: 96.6709 bits (239), Expect = 1.184e-20
Identity = 80/324 (24.69%), Postives = 140/324 (43.21%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV----------IHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            C +CGK+F     L+ H+ TH   + + C +C K F+ K ++ +HM  H  VK ++C  CG  F+   ++  H ++          I   G  + S  + H    S +     +     +   ++L       S +     +L  E     +  S   NH+   D   P                  + ++  R   +T  ++ H+++    TG + F C  C K +     L +H ++H+ ++PF C  C KSF   S LK H K+H   K F+C +C + F+ K  LK H++ H  +K  + C+ C + F+   +L+ H  T
Sbjct:  216 CNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKRIHTGERPFICKICGKGFALKSTLKTHEFTHSVEKPFICKHCGKGYSLKSTLKNHEIVHSGEKP---FLCKECGKGFSQGSSLKNHKLTHDGEQP-----------------FICQECGRRFSQTSSLKTHQLLH---TGEKTFLCPDCGKRFSFPSSLKQHQQMHSSERPFICKECGKSFSYYSNLKVHQKTHTGDKPFTCTLCGRGFSQKPHLKSHQRTHTGEKP-YECQDCGKYFSLNCNLKVHKKT 515          

HSP 4 Score: 93.2041 bits (230), Expect = 1.185e-19
Identity = 77/288 (26.74%), Postives = 112/288 (38.89%), Query Frame = 1
Query: 1891 LTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST-----------------------SHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLN--QPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAK 2679
            L  H+R HT +KPF C  C K F LKS LK H  +H   K F C  C K F+    +KVHR  H  ++  + C+ C +RF+    L+ H  T                        HH+      P   +                   T +       KP I  +        P  +  +R  +  + + CN CGKS+     L  H K HL      +C+ C K F   R++  H+RT H   + + C  C   F     L  H  +H+  +P+ C +C + F  K
Sbjct:   33 LKAHLRTHTGEKPFICQDCGKRFSLKSTLKTHSLTHSLEKPFVCNDCGKGFSKASYMKVHRLTHTGERP-YACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQASTLKEHHKIHTGERPYVCKECGKSFSYSSAM-------TVHQKTHTGEKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTHL-KERPYMCELCGKRFSDKRTLVVHMRT-HTGVKPYICTHCGNKFSQGQHLKAHKRIHTGERPFICKICGKGFALK 310          

HSP 5 Score: 82.4185 bits (202), Expect = 3.196e-16
Identity = 70/254 (27.56%), Postives = 102/254 (40.16%), Query Frame = 1
Query: 1921 QKPFQCYMCHKSFRLKSVLKNHFKSHWKL----KEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            +K + C  C K+F  +  L  H K+H +     K F C+ C K F+LK TLK H   H  +K  FVC  C + F+   +++ H  T                                +P A  +           +  +QP  + +  +   +  R F C  CGK +     L EH K H +     VC+ C KSF    +M  H +T H   + F C  C   F  K  L  H  +H+  KPYAC +C + F
Sbjct:   11 EKMYMCEQCGKTFSSRRTLGQHLKAHLRTHTGEKPFICQDCGKRFSLKSTLKTHSLTHSLEKP-FVCNDCGKGFSKASYMKVHRLT----------------------------HTGERPYACQD---------CGQRFSQPSSL-KTHQFTHTGERPFICTDCGKRFLQASTLKEHHKIH-TGERPYVCKECGKSFSYSSAMTVHQKT-HTGEKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSF 223          

HSP 6 Score: 77.411 bits (189), Expect = 1.338e-14
Identity = 74/266 (27.82%), Postives = 108/266 (40.60%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPS-AENFIKLDWDKSHQGILLSEDVERIDKETGQ-------IQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSH 1998
            C +CGK F     L+ HE TH+  K F C  C KG++ KS++K H +VH   K FLC+ CGK F+   ++  H K+ H      + Q                 +   RF + +SL                            ++Q  H        P   + F      K HQ +  SE    I KE G+       +++H+      TG + F C  C + + +   L  H R HT +KP++C  C K F L   LK H K+H
Sbjct:  300 CKICGKGFALKSTLKTHEFTHSVEKPFICKHCGKGYSLKSTLKNHEIVHSGEKPFLCKECGKGFSQGSSLKNH-KLTHDGEQPFICQ-----------------ECGRRFSQTSSLK---------------------------THQLLHTGEKTFLCPDCGKRFSFPSSLKQHQQMHSSER-PFICKECGKSFSYYSNLKVHQKTH---TGDKPFTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCGKYFSLNCNLKVHKKTH 516          

HSP 7 Score: 63.5438 bits (153), Expect = 2.387e-10
Identity = 67/239 (28.03%), Postives = 91/239 (38.08%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQ 4953
            PY+C+IC K F+   NL+ H   H K RPY C  C KRF  + +L  H  T H+ V   +  H   K  + Q  L+ H ++H  E    CK+C KGF L+  L  H                                             E    + K  I C  C   ++ K+   NH  V    EK  L + C K F   S    H +  H+    + C +C   F+Q SS   HQ
Sbjct:  213 PYACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRT-HTGVKPYICTHCGNKFSQGQ-HLKAHKRIHTGERPFICKICGKGFALKSTLKTH---------------------------------------------EFTHSVEKPFI-CKHCGKGYSLKSTLKNHEIV-HSGEKPFLCKECGKGFSQGSSLKNH-KLTHDGEQPFICQECGRRFSQTSSLKTHQ 401          

HSP 8 Score: 60.077 bits (144), Expect = 3.468e-9
Identity = 67/255 (26.27%), Postives = 95/255 (37.25%), Query Frame = 1
Query: 4204 KTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLS----RHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            KT ++   L  P+ C+ C KGF++AS ++ H   HT  RPY C  C +RF    SLKTH+ T       +        L  S   L+ H K+H  E    CK C K F     ++     H  EK      C  G  +           P    H      +KP    I           S S  +N KA    H       E+ ++   C K F      + H++  H  +  Y C  C   F+Q      H++
Sbjct:   62 KTHSLTHSLEKPFVCNDCGKGFSKASYMKVHRLTHTGERPYACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQAS--TLKEHHKIHTGERPYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCGRGFAQ----------KPHLKTHQRIHTGEKPYACNICGK--------SFSLNYNLKAHQKTHL-----KERPYMCELCGKRFSDKRTLVVHMR-THTGVKPYICTHCGNKFSQGQHLKAHKR 290          

HSP 9 Score: 56.225 bits (134), Expect = 5.657e-8
Identity = 33/107 (30.84%), Postives = 51/107 (47.66%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSH 3882
            C +C   F     L  H +  H   + + CN+C K+FS   +L AH KTH+  R    ++C  C +RF    +L  H+R   +  +  Y CTHC   +   + L +H
Sbjct:  188 CKDCGRGFAQKPHLKTHQRI-HTGEKPYACNICGKSFSLNYNLKAHQKTHLKERP---YMCELCGKRFSDKRTLVVHMRT--HTGVKPYICTHCGNKFSQGQHLKAH 288          

HSP 10 Score: 52.7582 bits (125), Expect = 5.217e-7
Identity = 68/245 (27.76%), Postives = 100/245 (40.82%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            PY C+ C   F++  +L+ H  +HT  RP+ C  C K F  + +LKTHE T   SV K   C  C K    +  L+NH  +H  E    CK C KGF     L  H      E+      C      GR+     S T +   H      +K    + P+  K+       SF  + K     H      +E+  + + C K+F   S    H Q+ H     + C  C   F+Q+    +HQ++
Sbjct:  269 PYICTHCGNKFSQGQHLKAHKRIHTGERPFICKICGKGFALKSTLKTHEFT--HSVEKPFICKHCGKGYSLKSTLKNHEIVHSGEKPFLCKECGKGFSQGSSLKNHKLTHDGEQPFICQEC------GRR----FSQTSSLKTHQLLHTGEKTF--LCPDCGKRF------SFPSSLKQHQQMH-----SSERPFICKECGKSFSYYSNLKVH-QKTHTGDKPFTCTLCGRGFSQKPHLKSHQRT 487          

HSP 11 Score: 51.9878 bits (123), Expect = 1.054e-6
Identity = 33/109 (30.28%), Postives = 48/109 (44.04%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C +C  +F  + +L EH K  H   R + C  C K+FS   ++  H KTH   +    F+C  C + F   P L  H R+   +    Y C  C K +     L +H K
Sbjct:  132 CTDCGKRFLQASTLKEHHKI-HTGERPYVCKECGKSFSYSSAMTVHQKTHTGEKP---FICKDCGRGFAQKPHLKTHQRIHTGE--KPYACNICGKSFSLNYNLKAHQK 234          

HSP 12 Score: 49.2914 bits (116), Expect = 7.688e-6
Identity = 27/83 (32.53%), Postives = 39/83 (46.99%), Query Frame = 1
Query: 2458 ANNTNVCQFCNKSFVTYRSMQQHLRTQ---HLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            A    +C+ C K+F + R++ QHL+     H   + F C  C   F  K++L  H L HS  KP+ C  C + F    Y   H
Sbjct:   10 AEKMYMCEQCGKTFSSRRTLGQHLKAHLRTHTGEKPFICQDCGKRFSLKSTLKTHSLTHSLEKPFVCNDCGKGFSKASYMKVH 92          

HSP 13 Score: 48.9062 bits (115), Expect = 9.202e-6
Identity = 20/51 (39.22%), Postives = 33/51 (64.71%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEAT 4389
            P++C++C +GF++  +L+ H   HT  +PY+C  C K F   C+LK H+ T
Sbjct:  465 PFTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCGKYFSLNCNLKVHKKT 515          
BLAST of Zinc finger, C2H2 type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001529.1 (pep scaffold:Pmarinus_7.0:GL483083:8841:14719:-1 gene:ENSPMAG00000001385.1 transcript:ENSPMAT00000001529.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.079 bits (279), Expect = 3.061e-25
Identity = 131/560 (23.39%), Postives = 211/560 (37.68%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIAS--LAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIP-----SAENFIKLDWDKSH------QGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQ-------------QKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEID-----KRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHL-----------------------SANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK-AKIYCDR---HISAKKCSKKKR 2730
            CA CGK F     LR HE +HT  K ++CP+C K F    +V+ H  VH+  K F C  CGK F    ++ +H +V              HL  +     +  ++   R   + +     TN +P   +E  +     +       S + +H+ + +   P       E F +LD  + H      Q  LL  +      E   ++ HE   ++    +   C  C + + +   L RH RIHT+             QKP  C  C ++F     L+ H +SH + K   C  C + F    +L  H + HE  K   +C  C   F     LR      H R+  +  P            L       +    +  +  D KPL+ +E         E+D     +R   + +   C+ CG+++     L +H + H                        ++   N C  C K F    +++ H ++ H + + + C  C   F T  ++  H  VH+  KP+ C  C + F  AK  C     H+  KK  K KR
Sbjct:   16 CATCGKVFVNLGTLRSHEKSHTSEKTYKCPVCTKVFATLQNVQSHRAVHNGKKPFECDACGKVFANAKDLCSHQRV--------------HLCKKKGYKCKRCERSYTRLGALRTHEKTHTNDAPHVCSECGEVFTELD-------SLRRHHERSHEEQKPLLCSECGEAFTELDSLRQHERSHEEQKPLLCSECGEAFTELDSLRQHERTHEEQ---KPLLCSECGEAFTELDSLRRHERIHTELDSLRQHERSHEEQKPLLCSECGEAFTELDSLRQHERSHEEQKPLLCSECGEAFTELDSLHQHERTHEEQKP-LLCSECGEAFTELDSLR-----QHERTHKDQKPLLCSECGEAFTEL-------DSLRQHERSHKDQKPLLCSECGE---AFTELDSLRQHERTHKDQKPLLCSECGEAFTELDSLRQHERSHTRMVMMVRMVVAHFGKLRRHEKSHTSEKPNKCATCGKVFAHLGTLRSHEKS-HTSEKTYKCPVCTKVFATLQNVQSHRAVHNGKKPFECDACGKVFANAKDLCSHQRVHLCKKKGYKCKR 534          

HSP 2 Score: 98.9821 bits (245), Expect = 3.908e-21
Identity = 111/470 (23.62%), Postives = 192/470 (40.85%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVL-SQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPS--AENFIKLDWDKSHQG--ILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNN--RLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRH 2613
            C+ CG+AF     LR+HE +H   K   C  C + FT+  S+  H   H+  K  LC  CG+AFT   ++  H +  HK+   +L S+  E                   F ++ SL +  +S  D   +      E  T  +          +    + S   E F +LD  + H+     +   V  +    G+++ HE      T  +  +C  C K++     L  H + HT +K ++C +C K F     +++H   H   K F C+ C K+F   + L  H+++H   K  + CK C+R +     LR H  T       N  P            L       +    +     + KPL+++E   +   +  + + + S+   +   C+ CG+++     L++H   H       +C  C ++F    S+++H R+ H  R+   CL+C   F    SL +H
Sbjct:  255 CSECGEAFTELDSLRQHERSHEEQKPLLCSECGEAFTELDSLHQHERTHEEQKPLLCSECGEAFTELDSLRQHERT-HKDQKPLLCSECGE------------------AFTELDSLRQHERSHKDQKPLLCSECGEAFTELDSLRQHERTHKDQKPLLCSECGEAFTELDSLRQHERSHTRMVMMVRMVVAHFGKLRRHEKSH---TSEKPNKCATCGKVFAHLGTLRSHEKSHTSEKTYKCPVCTKVFATLQNVQSHRAVHNGKKPFECDACGKVFANAKDLCSHQRVHLCKKKGYKCKRCERSYTRLGALRTHEKTH-----TNDAPHVCSECGEVFTEL-------DSLRQHERTHEEQKPLLFSECGEEFTELDSLRRHERSHEEQKPLLCSECGEAFTELDSLHQHEISH-KEQKPLLCSECGEAFTELDSLRRHERS-HKERKPLLCLECGEAFTELDSLRQH 688          

HSP 3 Score: 95.5153 bits (236), Expect = 4.581e-20
Identity = 165/745 (22.15%), Postives = 268/745 (35.97%), Query Frame = 1
Query:  553 KHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIP-----SAENFIKLDWDKSH------QGILLSEDVERIDKETGQIQLHEMI-KDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSF-RLKSV-----------------------LKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKP---TANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            KH   H +++  KC+ C         + V++  + ++E         E  YKC +C+ +F+  +  Q+H  +H   +   C+ C  +F     L  H   H   +            KCK C   +  +G ++ H  + H   + H   E G                                       ++LD ++    RS  ++ +P             C+ CG+AF     LR+HE +H   K   C  C + FT+  S++ H   H+  K  LC  CG+AFT   ++  H ++     TE+ S  Q H  +          +    F ++ SL +  +S  +   +   L +E             H+   +   P       E F +LD  + H      Q  LL  +      E   ++ HE   KDQ    +   C  C + + +   L +H R H  QKP  C  C ++F  L S+                       L+ H KSH   K   C  C K+F    TL+ H + H  +K  + C +C + F T  +++ H      R++ N                        KP    A      + K L  ++ ++            L   + +KC  C +SY     L  H K H + +  +VC  C + F    S++QH RT H  ++     +C   F    SL RH   H   KP  C  C   F
Sbjct:    3 KHKRTHTSEKPNKCATCG-------KVFVNLGTLRSHE----KSHTSEKTYKCPVCTKVFATLQNVQSHRAVHNGKKPFECDACGKVFANAKDLCSHQRVHLCKK---------KGYKCKRCERSYTRLGALRTHE-KTHTNDAPHVCSECGEVF------------------------------------TELDSLRRHHERSHEEQ-KPLL-----------CSECGEAFTELDSLRQHERSHEEQKPLLCSECGEAFTELDSLRQHERTHEEQKPLLCSECGEAFTELDSLRRHERI----HTELDSLRQ-HERSHEEQKPLLCSECGEAFTELDSLRQHERSHEEQKPL---LCSECGEAFTELDSLHQHERTHEEQKPLLCSECGEAFTELDSLRQHERTHKDQKPLLCSECGEAFTELDSLRQHERSHKDQ----KPLLCSECGEAFTELDSLRQHERTHKDQKPLLCSECGEAFTELDSLRQHERSHTRMVMMVRMVVAHFGKLRRHEKSHTSEKPNKCATCGKVFAHLGTLRSHEKSHTSEKT-YKCPVCTKVFATLQNVQSH------RAVHNG----------------------KKPFECDACGKVFANAKDLCSHQRVH------------LCKKKGYKCKRCERSYTRLGALRTHEKTH-TNDAPHVCSECGEVFTELDSLRQHERT-HEEQKPLLFSECGEEFTELDSLRRHERSHEEQKPLLCSECGEAF 623          

HSP 4 Score: 76.2554 bits (186), Expect = 4.236e-14
Identity = 70/269 (26.02%), Postives = 109/269 (40.52%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIAS--LAETNQSP---SDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSH------QGILLSEDVERIDKETGQIQLHEMI-KDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKS 1995
            CA CGK F     LR HE +HT  K ++CP+C K F    +V+ H  VH+  K F C  CGK F    ++ +H +V              HL  +     +  ++   R   + +     TN +P   S+  E+   L +       H   +P        +    E F +LD  + H      Q  LL  +      E   +  HE+  K+Q    +   C  C + + +   L RH R H ++KP  C  C ++F     L+ H +S
Sbjct:  447 CATCGKVFAHLGTLRSHEKSHTSEKTYKCPVCTKVFATLQNVQSHRAVHNGKKPFECDACGKVFANAKDLCSHQRV--------------HLCKKKGYKCKRCERSYTRLGALRTHEKTHTNDAPHVCSECGEVFTELDSLRQHERTHEEQKPL------LFSECGEEFTELDSLRRHERSHEEQKPLLCSECGEAFTELDSLHQHEISHKEQ----KPLLCSECGEAFTELDSLRRHERSHKERKPLLCLECGEAFTELDSLRQHERS 691          

HSP 5 Score: 72.0182 bits (175), Expect = 7.728e-13
Identity = 64/247 (25.91%), Postives = 105/247 (42.51%), Query Frame = 1
Query: 1891 LTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSN 2631
            L +H R HT +KP +C  C K F     L++H KSH   K + C +C K+F   Q ++ HR +H   K  F C  C + F     L      SH R   +             +S  +  +L+     ++N+ P V      E+  +   +    +R     +   C+ CG+++     L +H + H       +C  C ++F    S++QH RT H  ++   C +C   F    SL RH  +H+ 
Sbjct:    1 LNKHKRTHTSEKPNKCATCGKVFVNLGTLRSHEKSHTSEKTYKCPVCTKVFATLQNVQSHRAVHNGKKP-FECDACGKVFANAKDL-----CSHQR--VHLCKKKGYKCKRCERSYTRLGALRTHEKTHTNDAPHVCS-ECGEVFTELDSLRRHHERSHEEQKPLLCSECGEAFTELDSLRQHERSH-EEQKPLLCSECGEAFTELDSLRQHERT-HEEQKPLLCSECGEAFTELDSLRRHERIHTE 236          
BLAST of Zinc finger, C2H2 type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002874.1 (pep scaffold:Pmarinus_7.0:GL481808:24509:27091:-1 gene:ENSPMAG00000002627.1 transcript:ENSPMAT00000002874.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 4.497e-25
Identity = 116/502 (23.11%), Postives = 206/502 (41.04%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKE---FECPICKKGFTQKSSVKIHMVVH----DNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQP---NHQSNTDSYIPSAENFIKLDWDKSHQG--ILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKE--FSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELL--NQPIPIAEIDK--RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLR-TQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFK 2673
            CA CGK+F  P  LRRH   H    E   FEC +C K F + S ++ H   H       + F C  CGK F    + + H K  H+  + +          ES+  E+  +          ++ +  ++ +  +++  Y      T E    ++      Q    S++         +  K+H G    + +   +   E+ Q+Q H+ I         F+C  C   + +S  L  H + H  Q+ F+C +C  +F   S L++H K+H +++   F C +C K F     L+ H ++H  +++ F C +C + F     L+ H+ T    +           L   H                 ++      +++   +   Q + ++ + +  +  +  RL KC  C K +    +L+EH K H+       C  C K+F    ++++H R TQH  +R F C  C   F    +L RH   H+  +P+ CP C + F+
Sbjct:   28 CAECGKSFVHPSSLRRHGKKHAEGGERRYFECSLCAKRFDELSHLEEHRETHAEGEQKRRFFECALCGKEFARSSDFDEHQKT-HRGSSHLECSVCGKEFAESSYLEKHRKTHSGETSFKCAVCDHRKTHTGSSDL--YELQRTHTGEERRFFKCLVCGKQFAESSHLE--------EHRKTHNGETSFVCKVCGKEFTESSQLQEHQKIHTAGESCF-FKCSLCGIAFSESLQLQEHHKTHMGQRLFKCAVCGMAFPDSSHLEDHRKTHMQVERHFFKCSVCGKQFVESSHLQEHHKIHAGEEMLFKCFMCRKDFADSMLLQEHFKTHARDTFFKCSVCGMAFLESVHL--------------EEHSKAHTGEMLFKCFVCGKQFVELSHLQEHCKTHTRKRLLKCAVCRKQFAESSHLDEHRKTHV-GETPFKCSLCPKAFPLPGALKRHHRKTQHAGQRPFCCATCGKAFSLPRALNRHHKTHAGKRPFPCPTCGKAFR 502          

HSP 2 Score: 108.997 bits (271), Expect = 2.077e-24
Identity = 120/506 (23.72%), Postives = 192/506 (37.94%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHF-SYQPNHQSNTDSY-------IPSAENFIKLDWDKSHQGILL------------SEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHT-QQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIA---EIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            CA+CGK F        H+ TH G    EC +C K F + S ++ H   H     F C  C            H K  H   +++    + H   E    +        +F + + L E  ++ + +      +  +  T  +    +Q  H +    +       I  +E+    +  K+H G  L            S  +E   K   Q++ H            F+C  C K + +S  L  H +IH  ++  F+C+MC K F    +L+ HFK+H +   F C +C   F     L+ H + H  + L F C +C ++F    HL+ H  T   + +        Q     H    +   +   P   S  P              P+P A      K + +  R F C  CGK++   + LN H K H +      C  C K+F     +++H    H   R F C  C   +   A+LIRH  +H+  K + CP C + F
Sbjct:   91 CALCGKEFARSSDFDEHQKTHRGSSHLECSVCGKEFAESSYLEKHRKTHSGETSFKCAVC-----------DHRKT-HTGSSDLYELQRTHTGEERRFFKCLV--CGKQFAESSHLEEHRKTHNGETSFVCKVCGKEFTESSQLQEHQKIHTAGESCFFKCSLCGIAFSESLQLQEHHKTHMGQRLFKCAVCGMAFPDSSHLEDHRKTHMQVERH-----------FFKCSVCGKQFVESSHLQEHHKIHAGEEMLFKCFMCRKDFADSMLLQEHFKTHARDTFFKCSVCGMAFLESVHLEEHSKAHTGEML-FKCFVCGKQFVELSHLQEHCKTHTRKRLLKCAVCRKQFAESSHLDEHRKTHVGETPFKCSLCPKAF-----------PLPGALKRHHRKTQHAGQRPFCCATCGKAFSLPRALNRHHKTH-AGKRPFPCPTCGKAFRESADLRKHQDAAHGAERSFVCPICGKGYPRSATLIRHRRIHTAEKRFKCPTCDKLF 558          

HSP 3 Score: 99.3673 bits (246), Expect = 2.659e-21
Identity = 120/530 (22.64%), Postives = 192/530 (36.23%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPIC--------------------------------KKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFS-------------YQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKET------------GQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVH-RQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL-SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSK 2637
            C+VCGK F     L +H  TH+G   F+C +C                                 K F + S ++ H   H+    F+C+ CGK FT    +  H K IH  G     +     +  S   + ++    +  +++   A    +  D + +  +         + F               Q +H+ +    +       + D+  S   +LL E  +   ++T              + L E  K   TG   F+C  C K + +   L  H + HT+++  +C +C K F   S L  H K+H     F C +C K F L   LK H R+     +  F C  C + F+    L  H+ T H      P P+  ++              K++  A+      V P+        P     I  R++ +  + FKC  C K +     L  H K H        C  C KSF     ++QH +T    RR+F C  C   F    +L RHG  H + +
Sbjct:  119 CSVCGKEFAESSYLEKHRKTHSGETSFKCAVCDHRKTHTGSSDLYELQRTHTGEERRFFKCLVCGKQFAESSHLEEHRKTHNGETSFVCKVCGKEFTESSQLQEHQK-IHTAGESCFFKCSLCGIAFSESLQLQEHHKTHMGQRLFKCAVCGMAFPDSSHLEDHRKTHMQVERHFFKCSVCGKQFVESSHLQEHHKIHAGEEMLFKCFMCRKDFADS---MLLQEHFKTHARDTFFKCSVCGMAFLESVHLEEHSKAH-TGEMLFKCFVCGKQFVELSHLQEHCKTHTRKRLLKCAVCRKQFAESSHLDEHRKTHVGETPFKCSLCPKAFPLPGALKRHHRKTQHAGQRPFCCATCGKAFSLPRALNRHHKT-HAGKRPFPCPTCGKAFRESADLR------KHQDAAHGAERSFVCPICGK---GYPRSATLIRHRRIHTAEKRFKCPTCDKLFLESGSLQRHQKTHAQGFE---CAVCGKSFAQPEKLEQHGKTHASGRRRFKCAVCGKSFSRLGNLRRHGNKHMDGE 630          

HSP 4 Score: 79.337 bits (194), Expect = 3.898e-15
Identity = 81/320 (25.31%), Postives = 117/320 (36.56%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNG 1467
            C +C  +F       +H   H  D  FKCS C +++   V+L  H +  HT E          M +KC +C   F      Q HC  H     L C  C   F     LD+H   H +GE            KC +C   F   G +K+H+ +   + +G  P       K    +P  +               C T     +  + L               R  +      + +  C +CGK +     L RH   HT  K F+CP C K F +  S++ H   H   +GF C  CGK+F     +  H K  H +G
Sbjct:  324 CFMCRKDFADSMLLQEHFKTHARDTFFKCSVCGMAFLESVHLEEH-SKAHTGE----------MLFKCFVCGKQFVELSHLQEHCKTHTRKRLLKCAVCRKQFAESSHLDEHRKTH-VGE---------TPFKCSLCPKAFPLPGALKRHHRK--TQHAGQRPFCCATCGKAFS-LPRAL-NRHHKTHAGKRPFPCPTCGKAFRESADL---------------RKHQDAAHGAERSFVCPICGKGYPRSATLIRHRRIHTAEKRFKCPTCDKLFLESGSLQRHQKTH--AQGFECAVCGKSFAQPEKLEQHGKT-HASG 600          

HSP 5 Score: 72.7886 bits (177), Expect = 4.869e-13
Identity = 102/479 (21.29%), Postives = 171/479 (35.70%), Query Frame = 1
Query: 1309 CPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYL-----WNENPTNENHFSYQPNHQSNTDSYIP-SAENFIKLDWDKSHQGILLSED------VERIDKETGQIQLHEMIKDQVTGFRRF-RCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKE--FSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNV-CQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            CP+C + F Q  S   H   +     F C  CGK+F +  ++  H K   + G        E    E +           RF +++ L E  ++ ++  +  ++        E   + +   +Q  H+ ++        + F +  + + H+     E        +     TG   L+E+ +      RRF +C  C K + +S  L  H + H  +  F C +C K F   S L+ H K H   +   F C +C   F+    L+ H + H   +L F C +C   F    HL  H  T  H  +                                      K  +  +   +   + E  K       LFKC  C K +     L EH K H  A +T   C  C  +F+    +++H +  H     F C  C   F+  + L  H   H+  +   C +C ++F    + D H
Sbjct:    1 CPLCGERFPQSRSRNGHSQKYAKC-SFECAECGKSFVHPSSLRRHGKKHAEGG--------ERRYFECSLC-------AKRFDELSHLEEHRETHAEGEQKRRFFECALCGKEFARSSDFDEHQKTHRGSSHLECSVCGKEFAESSYLEKHRKTHSGETSFKCAVCDHRKTHTGSSDLYELQRTHTGEERRFFKCLVCGKQFAESSHLEEHRKTHNGETSFVCKVCGKEFTESSQLQEHQKIHTAGESCFFKCSLCGIAFSESLQLQEHHKTHMGQRL-FKCAVCGMAFPDSSHLEDHRKT--HMQVERHF---------------------------------FKCSVCGKQFVESSHLQEHHKIHAGEEMLFKCFMCRKDFADSMLLQEHFKTH--ARDTFFKCSVCGMAFLESVHLEEHSKA-HTGEMLFKCFVCGKQFVELSHLQEHCKTHTRKRLLKCAVCRKQFAESSHLDEH 424          

HSP 6 Score: 72.4034 bits (176), Expect = 5.396e-13
Identity = 66/293 (22.53%), Postives = 111/293 (37.88%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICN--KIFNLKQTLKVHRQLHEPDKLRFV-CKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNV-CQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA 2706
            R F C  C K + +S D   H + H      +C +C K F   S L+ H K+H     F C +C+  K       L   ++ H  ++ RF  C +C ++F    HL  H  T       +   +         +  +  +  +++    +      K  +     ++ + + E  K  +   RLFKC  CG ++    +L +H K H+        C  C K FV    +Q+H +        F C  C   F     L  H   H+    + C +C   F   ++ + H  A
Sbjct:   87 RFFECALCGKEFARSSDFDEHQKTHRGSSHLECSVCGKEFAESSYLEKHRKTHSGETSFKCAVCDHRKTHTGSSDLYELQRTHTGEERRFFKCLVCGKQFAESSHLEEHRKT-------HNGETSFVCKVCGKEFTESSQLQEHQKIHTAGESCFFKCSLCGIAFSESLQLQEHHKTHM-GQRLFKCAVCGMAFPDSSHLEDHRKTHMQVERHFFKCSVCGKQFVESSHLQEHHKIHAGEEMLFKCFMCRKDFADSMLLQEHFKTHARDTFFKCSVCGMAFLESVHLEEHSKA 371          

HSP 7 Score: 51.6026 bits (122), Expect = 1.495e-6
Identity = 30/114 (26.32%), Postives = 48/114 (42.11%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSD 3903
            C  C   F++S  L +H  + H   R F C +C K +    +L  H + H   +    F C  C++ F+   SL RH +     +   + C  C K +    +L+ H K   S 
Sbjct:  494 CPTCGKAFRESADLRKHQDAAHGAERSFVCPICGKGYPRSATLIRHRRIHTAEKR---FKCPTCDKLFLESGSLQRHQKT----HAQGFECAVCGKSFAQPEKLEQHGKTHASG 600          

HSP 8 Score: 50.447 bits (119), Expect = 3.849e-6
Identity = 39/124 (31.45%), Postives = 52/124 (41.94%), Query Frame = 1
Query: 4246 CSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSS-----CIEGLP 4602
            C++C K F  +S+L +H   H    P++C  CPK F    +LK H      +  +   C  C K      AL  H K H  +    C  C K F    DL +H D  H A  S     C +G P
Sbjct:  408 CAVCRKQFAESSHLDEHRKTHVGETPFKCSLCPKAFPLPGALKRHHRKTQHAGQRPFCCATCGKAFSLPRALNRHHKTHAGKRPFPCPTCGKAFRESADLRKHQDAAHGAERSFVCPICGKGYP 531          

HSP 9 Score: 50.0618 bits (118), Expect = 5.098e-6
Identity = 32/90 (35.56%), Postives = 46/90 (51.11%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWK-LKEFSCEICNKIFNLKQTLKVHRQLHEPDKL 2097
            T  +RF+C  C KL+ +S  L RH + H Q   F+C +C KSF     L+ H K+H    + F C +C K F+    L+ H   H   +L
Sbjct:  544 TAEKRFKCPTCDKLFLESGSLQRHQKTHAQ--GFECAVCGKSFAQPEKLEQHGKTHASGRRRFKCAVCGKSFSRLGNLRRHGNKHMDGEL 631          

HSP 10 Score: 49.6766 bits (117), Expect = 5.319e-6
Identity = 35/118 (29.66%), Postives = 48/118 (40.68%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCI 4590
            P+ C+ C K F+    L +H   H   RP+ CP C K FR    L+ H+   H +    +         RS   +R H ++H  E    C  C K F     L RH  + HA    C 
Sbjct:  463 PFCCATCGKAFSLPRALNRHHKTHAGKRPFPCPTCGKAFRESADLRKHQDAAHGAERSFVCPICGKGYPRSATLIR-HRRIHTAEKRFKCPTCDKLFLESGSLQRH-QKTHAQGFECA 578          

HSP 11 Score: 49.6766 bits (117), Expect = 6.470e-6
Identity = 37/124 (29.84%), Postives = 52/124 (41.94%), Query Frame = 1
Query: 3517 LQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            L+ H +    +    C  C  QF +   L EH K+ H  +R   C VC K F+    L  H KTH+    F C +   C + F    +L RH R   +     + C  C K +   R L+ H K
Sbjct:  365 LEEHSKAHTGEMLFKCFVCGKQFVELSHLQEHCKT-HTRKRLLKCAVCRKQFAESSHLDEHRKTHVGETPFKCSL---CPKAFPLPGALKRHHRKTQHAGQRPFCCATCGKAFSLPRALNRHHK 484          
BLAST of Zinc finger, C2H2 type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002875.1 (pep scaffold:Pmarinus_7.0:GL481808:24524:27013:-1 gene:ENSPMAG00000002627.1 transcript:ENSPMAT00000002875.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 1.543e-24
Identity = 119/542 (21.96%), Postives = 201/542 (37.08%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICK--KGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIP------SAENFIKLDWDKSHQ----------------GILLSEDVE-----------RIDK---------ETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHT-QQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFC---NKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA 2706
            C+VCGK F     L +H  TH+G   F+C +C   K  T  S ++ H  +   +  F C  C   FT   ++  H K  H   +++    + H   E    +        +F + + L E  ++ + +      ++ +     +H   Q  H                 + F +    + HQ                GI  SE ++           R+ K         ++  ++ H     QV     F+C  C K + +S  L  H +IH  ++  F+C+MC K F    +L+ HFK+H +   F C +C   F     L+ H + H  + L F C +C ++F    HL+ H  T   + +                                     +K  +  +   +   + E  K  +     FKC+ C K++     L  HLK H +      C  C     +F T+  + +H +TQH  +R F C  C   F    +L RH   H+  +P+ CP C + F+      +H  A
Sbjct:  120 CSVCGKEFAESSYLEKHRKTHSGETSFKCAVCGHLKTHTGLSHLEKHQKIKKEMMFFKCMVCEMVFTELSHLEDHRKT-HTGSSDLYELQRTHTGEERRFFKCLV--CGKQFAESSHLEEHRKTHNGETSFVYVVFGKAFAETSHLQEQKTHTGRNTGEEKLFKCKVCGKEFTESSQLQEHQKIHTAGESCFFKCSLCGIAFSESLQLQEHHKTHMGQRLFKCAVCGMAFPDSSHLEDHRKTHMQVER-HFFKCSVCGKQFVESSHLQEHHKIHAGEEMLFKCFMCRKDFADSMLLQEHFKTHARDTFFKCSVCGMAFLESVHLEEHSKAHTGEML-FKCFVCGKQFVELSHLQEHCKTHTRKRL-------------------------------------LKCAVCRKQFAESSHLDEHRKTHVGET-PFKCSLCPKAFPLPGALKRHLKLHSTGTKRFKCAICADEKATFATFPELTEHRKTQHAGQRPFCCATCGKAFSLPRALNRHHKTHAGKRPFPCPTCGKAFRESADLRKHQDA 618          

HSP 2 Score: 91.2781 bits (225), Expect = 9.282e-19
Identity = 126/543 (23.20%), Postives = 196/543 (36.10%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKE---FECPICKKGFTQKSSVKIHMVVH----DNVKGFLCQFCGKAFTYE---------HNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRR-FRCRFCYKLYRKSCDLTRHIRIH--------------------------------TQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKE--FSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            CA CGK+F  P  LRRH   H    E   FEC +C K F + S ++ H   H       + F C  CGK F            H  ++H++  HK  TE L   ++   +E              F + + L +  ++ S +      +     T+    S+   HQ      +       ++ + +      LS   +     TG   L+E+ +      RR F+C  C K + +S  L  H + H                                 ++K F+C +C K F   S L+ H K H   +   F C +C   F+    L+ H + H   +L F C +C   F    HL  H  T  H  +               +S    E  K     ++      K  +  +     + + E  K   + +  FKC+ CG ++    +L EH K H +      C  C K FV    +Q+H +T H  +R   C  C   F   + L  H   H    P+ C LC + F       RH+
Sbjct:    2 CAECGKSFVHPSSLRRHGKKHAEGGERRYFECSLCAKRFDELSHLEEHRETHAEGEQKRRFFECALCGKEFARSSDFDEHQKTHRGSSHLEEHHKTCTESLHLEEQRTHSEGQRRLFNCSVCGKEFAESSYLEKHRKTHSGETSFKCAVCGHLKTHTG-LSHLEKHQKIKKEMMFFKCMVCEMVFTE------LSHLEDHRKTHTGSSDLYELQRTHTGEERRFFKCLVCGKQFAESSHLEEHRKTHNGETSFVYVVFGKAFAETSHLQEQKTHTGRNTGEEKLFKCKVCGKEFTESSQLQEHQKIHTAGESCFFKCSLCGIAFSESLQLQEHHKTHMGQRL-FKCAVCGMAFPDSSHLEDHRKT--HMQVERHFFKCSVCGKQFVESSHLQEHHK----IHAGEEMLFKCFMCRKDFADSMLLQEHFKTH-ARDTFFKCSVCGMAFLESVHLEEHSKAH-TGEMLFKCFVCGKQFVELSHLQEHCKT-HTRKRLLKCAVCRKQFAESSHLDEHRKTHVGETPFKCSLCPKAFPLPGALKRHL 527          

HSP 3 Score: 89.3521 bits (220), Expect = 4.187e-18
Identity = 87/314 (27.71%), Postives = 132/314 (42.04%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGI--LLSEDVERIDKETGQIQLHEMIKDQVTGFRR-FRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYH 2157
            C VCGK F     L+ H  THT  +  +C +C+K F + S +  H   H     F C  C KAF     +  H+K +H  GT                          RFK  A  A+   + +   E+T++   ++   +  F      ++ +   +P A N       K+H G          +  +E+  ++ H+   D   G  R F C  C K Y +S  L RH RIHT +K F+C  C K F     L+ H K+H   + F C +C K F   + L+ H + H   + RF C +C + F+   +LR H
Sbjct:  454 CFVCGKQFVELSHLQEHCKTHTRKRLLKCAVCRKQFAESSHLDEHRKTHVGETPFKCSLCPKAFPLPGALKRHLK-LHSTGT-------------------------KRFK-CAICADEKATFATFPELTEHRKTQHA-GQRPFCCATCGKAFS---LPRALN----RHHKTHAGKRPFPCPTCGKAFRESADLRKHQ---DAAHGAERSFVCPICGKGYPRSATLIRHRRIHTAEKRFKCPTCDKLFLESGSLQRHQKTHA--QGFECAVCGKSFAQPEKLEQHGKTHASGRRRFKCAVCGKSFSRLGNLRRH 727          

HSP 4 Score: 87.4261 bits (215), Expect = 1.375e-17
Identity = 125/524 (23.85%), Postives = 187/524 (35.69%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSV---KIHMVVHDNV-KGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFS-------------YQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKET------------GQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKIC-DRR--FNTGFHLRYHYSTS------------------------HHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL-SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVH 2625
            C VCGK F     L  H  TH G   F   +  K F + S +   K H   +    K F C+ CGK FT    +  H K IH  G     +     +  S   + ++    +  +++   A    +  D + +  +         + F               Q +H+ +    +       + D+  S   +LL E  +   ++T              + L E  K   TG   F+C  C K + +   L  H + HT+++  +C +C K F   S L  H K+H     F C +C K F L   LK H +LH     RF C IC D +  F T   L  H  T                         HH++ A   P             +  +  K++  A+      V P+        P     I  R++ +  + FKC  C K +     L  H K H        C  C KSF     ++QH +T    RR+F C  C   F    +L RHG  H
Sbjct:  221 CLVCGKQFAESSHLEEHRKTHNGETSFVYVVFGKAFAETSHLQEQKTHTGRNTGEEKLFKCKVCGKEFTESSQLQEHQK-IHTAGESCFFKCSLCGIAFSESLQLQEHHKTHMGQRLFKCAVCGMAFPDSSHLEDHRKTHMQVERHFFKCSVCGKQFVESSHLQEHHKIHAGEEMLFKCFMCRKDFADS---MLLQEHFKTHARDTFFKCSVCGMAFLESVHLEEHSKAH-TGEMLFKCFVCGKQFVELSHLQEHCKTHTRKRLLKCAVCRKQFAESSHLDEHRKTHVGETPFKCSLCPKAFPLPGALKRHLKLHSTGTKRFKCAICADEKATFATFPELTEHRKTQHAGQRPFCCATCGKAFSLPRALNRHHKTHAGKRP--FPCPTCGKAFRESADLRKHQDAAHGAERSFVCPICGK---GYPRSATLIRHRRIHTAEKRFKCPTCDKLFLESGSLQRHQKTHAQGFE---CAVCGKSFAQPEKLEQHGKTHASGRRRFKCAVCGKSFSRLGNLRRHGNKH 731          

HSP 5 Score: 78.5666 bits (192), Expect = 7.852e-15
Identity = 84/333 (25.23%), Postives = 124/333 (37.24%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTI-KLYAQGRSQLDEMK----------PDVNRSISKRG--RPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNG 1467
            C +C  +F       +H   H  D  FKCS C +++   V+L  H +  HT E          M +KC +C   F      Q HC  H     L C  C   F     LD+H   H +GE            KC +C   F   G +K+H ++ H   +  +        K        + E  K+         C T  K ++  R+     K          P   ++  +    R  +      + +  C +CGK +     L RH   HT  K F+CP C K F +  S++ H   H   +GF C  CGK+F     +  H K  H +G
Sbjct:  398 CFMCRKDFADSMLLQEHFKTHARDTFFKCSVCGMAFLESVHLEEH-SKAHTGE----------MLFKCFVCGKQFVELSHLQEHCKTHTRKRLLKCAVCRKQFAESSHLDEHRKTH-VGE---------TPFKCSLCPKAFPLPGALKRH-LKLHSTGTKRFKCAICADEKATFATFPELTEHRKTQHAGQRPFCCATCGKAFSLPRALNRHHKTHAGKRPFPCPTCGKAFRESADLRKHQDAAHGAERSFVCPICGKGYPRSATLIRHRRIHTAEKRFKCPTCDKLFLESGSLQRHQKTH--AQGFECAVCGKSFAQPEKLEQHGKT-HASG 705          

HSP 6 Score: 54.6842 bits (130), Expect = 1.952e-7
Identity = 41/125 (32.80%), Postives = 56/125 (44.80%), Query Frame = 1
Query: 3517 LQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTH-IDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            LQ H +    K    CA C  QF +S  L EH K+ H     F C++C KAF    +L  H K H   ++ F C +C      F + P L+ H + QH      + C  C K +   R L+ H K
Sbjct:  467 LQEHCKTHTRKRLLKCAVCRKQFAESSHLDEHRKT-HVGETPFKCSLCPKAFPLPGALKRHLKLHSTGTKRFKCAICADEKATFATFPELTEHRKTQHAGQ-RPFCCATCGKAFSLPRALNRHHK 589          

HSP 7 Score: 53.5286 bits (127), Expect = 4.193e-7
Identity = 39/149 (26.17%), Postives = 58/149 (38.93%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGC--------------------------FVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSDYDALIINSN 3930
            CA+    F     L EH K+QH  +R F C  C KAFS   +L  H KTH   R F C                          FVC  C + +    +L RH R+   +    ++C  C+K++  +  L  H K     ++  +   +
Sbjct:  542 CADEKATFATFPELTEHRKTQHAGQRPFCCATCGKAFSLPRALNRHHKTHAGKRPFPCPTCGKAFRESADLRKHQDAAHGAERSFVCPICGKGYPRSATLIRHRRIHTAE--KRFKCPTCDKLFLESGSLQRHQKTHAQGFECAVCGKS 688          

HSP 8 Score: 49.6766 bits (117), Expect = 5.987e-6
Identity = 35/118 (29.66%), Postives = 48/118 (40.68%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCI 4590
            P+ C+ C K F+    L +H   H   RP+ CP C K FR    L+ H+   H +    +         RS   +R H ++H  E    C  C K F     L RH  + HA    C 
Sbjct:  568 PFCCATCGKAFSLPRALNRHHKTHAGKRPFPCPTCGKAFRESADLRKHQDAAHGAERSFVCPICGKGYPRSATLIR-HRRIHTAEKRFKCPTCDKLFLESGSLQRH-QKTHAQGFECA 683          
BLAST of Zinc finger, C2H2 type vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 77.0258 bits (188), Expect = 2.010e-14
Identity = 37/113 (32.74%), Postives = 63/113 (55.75%), Query Frame = 1
Query: 1834 GFRRFRCRF--CYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            G   ++C +  C++ + +   L RH+++H++ KP++C  C + F  +  L  H ++H   K + C ICNK F +  +LK+H + H  +K    CKIC +RFN   +L  H  T
Sbjct:  734 GKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEK-PLQCKICGKRFNESSNLSKHIKT 845          

HSP 2 Score: 70.0922 bits (170), Expect = 2.582e-12
Identity = 30/99 (30.30%), Postives = 55/99 (55.56%), Query Frame = 1
Query: 1837 FRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFN 2133
            ++ ++C+ C + +     L +H R H+ +KP++C++C+K F + S LK H ++H   K   C+IC K FN    L  H + H+    ++ C  C + F+
Sbjct:  765 YKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQ---KKYKCSDCSKSFD 860          

HSP 3 Score: 64.3142 bits (155), Expect = 1.345e-10
Identity = 31/79 (39.24%), Postives = 42/79 (53.16%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHK 1461
            C  C + F +   L +H  TH+G K ++C IC K F   SS+KIH+  H   K   C+ CGK F    N++ HIK   K
Sbjct:  770 CKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQK 848          

HSP 4 Score: 56.6102 bits (135), Expect = 3.380e-8
Identity = 28/72 (38.89%), Postives = 40/72 (55.56%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFN 2046
            +G + ++C  C K +  S  L  HIR HT +KP QC +C K F   S L  H K+H   K++ C  C+K F+
Sbjct:  791 SGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQ--KKYKCSDCSKSFD 860          

HSP 5 Score: 54.299 bits (129), Expect = 1.607e-7
Identity = 33/121 (27.27%), Postives = 60/121 (49.59%), Query Frame = 1
Query: 3517 LQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDS 3879
            L+ H +  P K    C  C   F   ++LV+H ++ H   + + C++C+K F+   SL  H +TH   +   C +   C +RF    +LS+H++         Y+C+ C+K +    +L+S
Sbjct:  759 LKVHSKYKPYK----CKTCKRCFSSEETLVQHTRT-HSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKI---CGKRFNESSNLSKHIKTHQKK----YKCSDCSKSFDDLGKLNS 867          

HSP 6 Score: 53.1434 bits (126), Expect = 4.012e-7
Identity = 36/151 (23.84%), Postives = 63/151 (41.72%), Query Frame = 1
Query:  517 CEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRC 969
            C   FP ++  ++H+ +H   + +KC  CK  ++ E  L+ H               + E  YKC IC+  F+   + + H   H  ++ L C+ C   F     L KH+  H+   +C D            C   F+++G +    V+C
Sbjct:  745 CHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRT-----------HSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQKKYKCSD------------CSKSFDDLGKLNSQKVKC 872          

HSP 7 Score: 52.7582 bits (125), Expect = 5.305e-7
Identity = 33/101 (32.67%), Postives = 51/101 (50.50%), Query Frame = 1
Query: 4255 CHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            CH+ F +   L +HL VH+K +PY+C  C + F    +L  H  T HS            K   S  +L+ H++ H  E  + CK+C K F+   +LS+H+
Sbjct:  745 CHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRT-HSGEKPYKCHICNKKFAISS-SLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHI 843          

HSP 8 Score: 49.6766 bits (117), Expect = 4.522e-6
Identity = 29/105 (27.62%), Postives = 53/105 (50.48%), Query Frame = 1
Query: 2398 CGKSYKFKKYLNEHLKE-HLSANNTN---VCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C KS+   + LN+HL+  HL+   +    +   C+++F   + + +HL+  H   + + C  C   F ++ +L++H   HS  KPY C +C ++F        HI
Sbjct:  712 CNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKV-HSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHI 815          

HSP 9 Score: 48.9062 bits (115), Expect = 7.908e-6
Identity = 30/101 (29.70%), Postives = 47/101 (46.53%), Query Frame = 1
Query: 2398 CGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C +++  ++ L  HLK H S      C+ C + F +  ++ QH RT H   + + C  C   F   +SL  H   H+  KP  C +C +RF       +HI
Sbjct:  745 CHRTFPQRQKLIRHLKVH-SKYKPYKCKTCKRCFSSEETLVQHTRT-HSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHI 843          
BLAST of Zinc finger, C2H2 type vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 72.0182 bits (175), Expect = 6.114e-13
Identity = 38/118 (32.20%), Postives = 64/118 (54.24%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLR-FVCKI--CDRRFNTGFHLRYHYSTSHHRSI 2184
            ++  C +C++L+ ++  L  H+R H   KPF C  C K F     L+ H + H   K +SC+IC+K F+ K  L  H   H+  KL+ FVCK+  C++ F    +++ H +  H  ++
Sbjct:  591 KKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQ--KLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETL 706          

HSP 2 Score: 69.707 bits (169), Expect = 3.195e-12
Identity = 31/82 (37.80%), Postives = 46/82 (56.10%), Query Frame = 1
Query: 1834 GFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEI--CNKIFNLKQTLKVHR 2073
            G++ F C +C K + +  +L  H R+HT +KP+ C +C K F  K  L  H  +H KLK F C++  CNK F     +K H+
Sbjct:  617 GYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQ 698          

HSP 3 Score: 68.9366 bits (167), Expect = 5.934e-12
Identity = 35/88 (39.77%), Postives = 45/88 (51.14%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQF--CGKAFTYEHNMNTHIKVIHKNGTEVLS 1482
            C  CGK F     LR HE  HTG K + C IC K F++K ++  H+V H  +K F+C+   C K FT   NM  H    HK     L+
Sbjct:  623 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETLNALT 710          

HSP 4 Score: 51.2174 bits (121), Expect = 1.457e-6
Identity = 26/79 (32.91%), Postives = 38/79 (48.10%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHK 1461
            C  C + F     L  H  +H G K F C  C K FTQ  +++ H  +H   K + C  C K F+ + N+  H+ V H+
Sbjct:  595 CPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL-VTHQ 672          

HSP 5 Score: 50.8322 bits (120), Expect = 1.960e-6
Identity = 20/53 (37.74%), Postives = 34/53 (64.15%), Query Frame = 1
Query: 1294 IKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            +K+ ECP C + F+Q + +++H+  H   K F+C +CGK FT   N+ TH ++
Sbjct:  590 VKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERL 642          

HSP 6 Score: 48.9062 bits (115), Expect = 7.278e-6
Identity = 23/51 (45.10%), Postives = 29/51 (56.86%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQC--PKCPKRFRHRCSLKTHE 4383
            PYSC IC K F+R  NL  HL  H KL+P+ C    C K F    ++K H+
Sbjct:  648 PYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQ 698          
BLAST of Zinc finger, C2H2 type vs. Ensembl Yeast
Match: PZF1 (Transcription factor IIIA (TFIIIA); essential DNA binding protein required for transcription of 5S rRNA by RNA polymerase III; not involved in transcription of other RNAP III genes; nine conserved zinc fingers; may also bind 5S rRNA [Source:SGD;Acc:S000006390])

HSP 1 Score: 60.4622 bits (145), Expect = 1.163e-9
Identity = 43/125 (34.40%), Postives = 55/125 (44.00%), Query Frame = 1
Query: 1834 GFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSC--EICNKIFNLKQTLKVH---RQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANP 2193
            G R F+C  C K + K   L RH+  H+  KPFQC  C K    +  LK H  +H   K F C  E CN  F     L+ H     LH     +  C  C++ F   + LR H S  H   + NP
Sbjct:   76 GLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRHEVTH--TKSFICPEEGCNLRFYKHPQLRAHILSVHLH-----KLTCPHCNKSFQRPYRLRNHISKHHDPEVENP 193          

HSP 2 Score: 59.6918 bits (143), Expect = 2.082e-9
Identity = 26/71 (36.62%), Postives = 40/71 (56.34%), Query Frame = 1
Query: 1234 CGKAFKTPILLRRHEVT-HTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTH 1443
            C KAF  P +L  H+++ H G++ F+C  C K F +KS ++ H+  H + K F C +CGK  T    +  H
Sbjct:   56 CDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRH 126          

HSP 3 Score: 53.9138 bits (128), Expect = 1.374e-7
Identity = 41/140 (29.29%), Postives = 55/140 (39.29%), Query Frame = 1
Query: 3541 PIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGC-----------------------FVCI--ACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV 3885
            P  ++     CD  F     L EH  S H+  R F C+ C K+F  K  L  H  TH D++ F C                       F+C    CN RF   P L  H+   H   L+   C HCNK ++    L +H+
Sbjct:   46 PKTYFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRHEVTHTKSFICPEEGCNLRFYKHPQLRAHILSVH---LHKLTCPHCNKSFQRPYRLRNHI 182          
BLAST of Zinc finger, C2H2 type vs. Ensembl Yeast
Match: MSN4 (Stress-responsive transcriptional activator; activated in stochastic pulses of nuclear localization in response to various stress conditions; binds DNA at stress response elements of responsive genes, inducing gene expression; involved in diauxic shift [Source:SGD;Acc:S000001545])

HSP 1 Score: 55.4546 bits (132), Expect = 6.124e-8
Identity = 24/58 (41.38%), Postives = 34/58 (58.62%), Query Frame = 1
Query: 1846 FRCRFCYKLYRKSCDLTRHIR-IHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEF 2016
            F+C+ C K +R+S  L RHIR +H+ ++PF C  C K F     L  H K+H K  +F
Sbjct:  573 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 630          
BLAST of Zinc finger, C2H2 type vs. Ensembl Yeast
Match: COM2 (Transcription factor that binds IME1 Upstream Activation Signal (UAS)ru; COM2 transcription is regulated by Haa1p, Sok2p and Zap1p transcriptional activators; may bind the IME1 promoter under all growth conditions to negatively regulate its transcription in the absence of a positive regulator that binds more effectively; repressor activity may depend on phosphorylation by PKA; C. albicans homolog (MNL1) plays a role in adaptation to stress [Source:SGD;Acc:S000000932])

HSP 1 Score: 51.6026 bits (122), Expect = 8.531e-7
Identity = 23/51 (45.10%), Postives = 31/51 (60.78%), Query Frame = 1
Query: 3559 GCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTH 3711
            GC  CD +FK  + L  HV+S H   + FTC++C+K FS   +L  H KTH
Sbjct:  390 GCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKTH 440          

HSP 2 Score: 48.521 bits (114), Expect = 6.750e-6
Identity = 26/80 (32.50%), Postives = 44/80 (55.00%), Query Frame = 1
Query: 1777 IDKETGQIQLHEMIKDQVT--GFRRFRCRFCYKLYRKSCDLTRHIR-IHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKL 2007
            + K+TG +Q     K  +     ++F C FC + +++   L RH+R +H  +KPF C++C+K+F     L  H K+H  L
Sbjct:  364 VRKKTGSMQKTRGRKPSLIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKTHASL 443          
BLAST of Zinc finger, C2H2 type vs. Ensembl Nematostella
Match: EDO48839 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIQ4])

HSP 1 Score: 132.88 bits (333), Expect = 5.503e-32
Identity = 125/492 (25.41%), Postives = 192/492 (39.02%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRH-EVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRH 2697
            C  C K FKT   +  H   TH  +K F C  C K    KS +  H   H   K + C++CG+ F    ++  H ++                   +N+   + +  P  F   +SL   N+  S D      +          FS      SN   ++ S +N       +       S D++R       ++ H       TG + +RC  C K +  SC L+ H +IH   KP  C +CHK F     + +H ++H   + F C  C+K F++K  L VH + H  ++  +VC  C + F     L       H+RS  +  P                                 K  I  +   Q   ++ I K+  +  +  +C  C K++  K  L+ H + H S      C+ C KSF    S+  H+R  H N ++ SC  CP  F TK  L +H  +H+  KPY CP C + F  K  C  H
Sbjct:   78 CVYCSKKFKTKAKVAEHTRRTHLKVKPFSCTYCNKKCASKSDLDKHERTHTGEKPYSCKYCGRMFGESSSLIMHQRI------------------HTNEKPYKCKLCPKAFTSHSSLVMHNRHHSGDKPYKCEICGRA------FSVS----SNRARHMRSHKNIKPYSCSQCEWSFTTSSDLKR------HLKTH-------TGEKPYRCEECDKAFSSSCGLSTHKKIHFNIKPHSCTVCHKRFATTGQVTSHMRTHTGEQPFKCTYCDKAFSIKGNLTVHIRRHTNERP-YVCTTCGKSFTVISQL-----VMHNRSHTDERP--------------------------------YKCDICGKKFRQQGGLS-IHKKIHTEEKPHECTQCEKAFITKAKLDRHFRTH-SGEKPYRCEICEKSFRDKDSLNIHMRI-HNNDKRHSCSYCPKLFYTKTELRQHVRIHTGEKPYKCPYCDKAFAVKGNCTVH 487          

HSP 2 Score: 94.3597 bits (233), Expect = 1.146e-19
Identity = 77/309 (24.92%), Postives = 132/309 (42.72%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV-----------------------IHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLH 2082
            C VC K F T   +  H  THTG + F+C  C K F+ K ++ +H+  H N + ++C  CGK+FT    +  H +                        IHK   ++ ++ + H   +         K    F+       + + P    EI +  + +  +   H     N + ++ SY P      KL + K+                  +++ H  I    TG + ++C +C K +    + T H R HT+++P++C  C ++F  +S L+ H ++H  +KEF C IC K F  +  LK H +LH
Sbjct:  275 CTVCHKRFATTGQVTSHMRTHTGEQPFKCTYCDKAFSIKGNLTVHIRRHTNERPYVCTTCGKSFTVISQLVMHNRSHTDERPYKCDICGKKFRQQGGLSIHK---KIHTEEKPHECTQCEKAFITKAKLDRHFR-----THSGEKPYR-CEICEKSFRDKDSLNIHMRIHNNDKRHSCSYCP------KLFYTKT------------------ELRQHVRIH---TGEKPYKCPYCDKAFAVKGNCTVHARTHTKERPYKCTNCGRAFSCRSGLREHMRTHGGVKEFICSICEKAFLRRGCLKKHEKLH 547          

HSP 3 Score: 83.5741 bits (205), Expect = 3.408e-16
Identity = 73/281 (25.98%), Postives = 123/281 (43.77%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIR-IHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL---SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            R + C +C K ++    +  H R  H + KPF C  C+K    KS L  H ++H   K +SC+ C ++F    +L +H+++H  +K  + CK+C + F +   L  H   + H S   P             S +      +K         ++KP   ++        +++ KR L   +  + ++C  C K++     L+ H K H +    + C  C+K F T   +  H+RT H   + F C  C   F  K +L  H   H+N +PY C  C + F
Sbjct:   74 RPWGCVYCSKKFKTKAKVAEHTRRTHLKVKPFSCTYCNKKCASKSDLDKHERTHTGEKPYSCKYCGRMFGESSSLIMHQRIHTNEKP-YKCKLCPKAFTSHSSLVMH---NRHHSGDKPYKCEICGRAFSVSSNRARHMRSHK---------NIKPYSCSQCEWSFTTSSDL-KRHLKTHTGEKPYRCEECDKAFSSSCGLSTHKKIHFNI-KPHSCTVCHKRFATTGQVTSHMRT-HTGEQPFKCTYCDKAFSIKGNLTVHIRRHTNERPYVCTTCGKSF 338          

HSP 4 Score: 81.6481 bits (200), Expect = 1.339e-15
Identity = 88/357 (24.65%), Postives = 135/357 (37.82%), Query Frame = 1
Query:  478 KTINGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIG-----EECDDRKLTTNYL-------------KCKICHDIFENVGNVKKHYVRCHPKTSGHWPIE----------DGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDE--MKPDV--NRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            +T  G    +C+ C   F    + + H  IH N++ +KC  C  ++    +L++H               + +  YKC IC   FS       H   H+  +   C  C   F     L +HL  H        EECD    ++  L              C +CH  F   G V  H +R H   +G  P +           G     + R          +  +  + I+    +L    RS  DE   K D+   +   + G        + +    C  C KAF T   L RH  TH+G K + C IC+K F  K S+ IHM +H+N K   C +C K F  +  +  H+++
Sbjct:  125 RTHTGEKPYSCKYCGRMFGESSSLIMHQRIHTNEKPYKCKLCPKAFTSHSSLVMH-----------NRHHSGDKPYKCEICGRAFSVSSNRARHMRSHKNIKPYSCSQCEWSFTTSSDLKRHLKTHTGEKPYRCEECDKAFSSSCGLSTHKKIHFNIKPHSCTVCHKRFATTGQVTSH-MRTH---TGEQPFKCTYCDKAFSIKGNLTVHIRRHTNERPYVCTTCGKSFTVIS----QLVMHNRSHTDERPYKCDICGKKFRQQGGLSIHKKIHTEEKPHECTQCEKAFITKAKLDRHFRTHSGEKPYRCEICEKSFRDKDSLNIHMRIHNNDKRHSCSYCPKLFYTKTELRQHVRI 462          

HSP 5 Score: 72.0182 bits (175), Expect = 1.115e-12
Identity = 64/248 (25.81%), Postives = 105/248 (42.34%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLS----RHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKL------IKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 4950
            PYSCS C   F  +S+L++HL  HT  +PY+C +C K F   C L TH+    +                 QV   +H++ H  E    C  C K F ++ +L+    RH +E+    ++C +      +      S      +      +K  ++    I KK+       +C  C   F TKAK D HF      EK +    C+K+F        H++ +HN   +++C+ C  +F  ++    H
Sbjct:  216 PYSCSQCEWSFTTSSDLKRHLKTHTGEKPYRCEECDKAFSSSCGLSTHKKIHFNIKPHSCTVCHKRFATTGQVT--SHMRTHTGEQPFKCTYCDKAFSIKGNLTVHIRRHTNERPYVCTTCGKSFTVISQLVMHNRSHTDERPYKCDICGKKFRQQGGLSIHKKIHTEEKPHECTQCEKAFITKAKLDRHF-RTHSGEKPYRCEICEKSFRDKDSLNIHMR-IHNNDKRHSCSYCPKLFYTKTELRQH 459          

HSP 6 Score: 63.1586 bits (152), Expect = 6.220e-10
Identity = 48/161 (29.81%), Postives = 65/161 (40.37%), Query Frame = 1
Query:  475 YKTINGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKH 957
            ++T +G     CEICE  F  K +   HM IH ND+   CS+C   +  +  L  H+  IHT           E  YKC  C   F+ K     H   H  +    C +C   F C+  L +H+  H   +E            C IC   F   G +KKH
Sbjct:  404 FRTHSGEKPYRCEICEKSFRDKDSLNIHMRIHNNDKRHSCSYCPKLFYTKTELRQHVR-IHTG----------EKPYKCPYCDKAFAVKGNCTVHARTHTKERPYKCTNCGRAFSCRSGLREHMRTHGGVKE----------FICSICEKAFLRRGCLKKH 543          

HSP 7 Score: 61.2326 bits (147), Expect = 2.862e-9
Identity = 38/124 (30.65%), Postives = 58/124 (46.77%), Query Frame = 1
Query: 2341 IAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKK 2712
            +AE  +R     + F C +C K    K  L++H + H +      C++C + F    S+  H R  H N + + C  CP  F + +SL+ H   HS  KPY C +C R F       RH+ + K
Sbjct:   91 VAEHTRRTHLKVKPFSCTYCNKKCASKSDLDKHERTH-TGEKPYSCKYCGRMFGESSSLIMHQRI-HTNEKPYKCKLCPKAFTSHSSLVMHNRHHSGDKPYKCEICGRAFSVSSNRARHMRSHK 212          

HSP 8 Score: 60.4622 bits (145), Expect = 4.705e-9
Identity = 36/113 (31.86%), Postives = 54/113 (47.79%), Query Frame = 1
Query: 2335 IPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKE-HLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            +P+           R + C +C K +K K  + EH +  HL     + C +CNK   +   + +H RT H   + +SC  C   F   +SLI H  +H+N KPY C LC + F
Sbjct:   60 VPVQAAFDSSGKTERPWGCVYCSKKFKTKAKVAEHTRRTHLKVKPFS-CTYCNKKCASKSDLDKHERT-HTGEKPYSCKYCGRMFGESSSLIMHQRIHTNEKPYKCKLCPKAF 170          

HSP 9 Score: 58.5362 bits (140), Expect = 1.934e-8
Identity = 35/125 (28.00%), Postives = 62/125 (49.60%), Query Frame = 1
Query: 3517 LQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQ 3891
            ++SH  I P    + C+ C+  F  S  L  H+K+ H   + + C  C KAFS+   L  H K H + +   C V   C++RF +   ++ H+R    +    ++CT+C+K +     L  H+++
Sbjct:  208 MRSHKNIKP----YSCSQCEWSFTTSSDLKRHLKT-HTGEKPYRCEECDKAFSSSCGLSTHKKIHFNIKPHSCTV---CHKRFATTGQVTSHMRTHTGE--QPFKCTYCDKAFSIKGNLTVHIRR 322          

HSP 10 Score: 53.5286 bits (127), Expect = 6.293e-7
Identity = 69/254 (27.17%), Postives = 98/254 (38.58%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLH--VREYSVHCKVCYKGFDLQEDLSRHV----DEK--------HAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PYSC  C + F  +S+L  H  +HT  +PY+C  CPK F    SL  H   +H S  K  +C +C +          H++ H  ++ YS  C  C   F    DL RH+     EK         A SSSC  GL   +K    +        H       +    +     ++  KC  C   F+ K     H       E+ ++   C K+F   SQ + H    H     Y C  C   F Q+     H+K
Sbjct:  132 PYSCKYCGRMFGESSSLIMHQRIHTNEKPYKCKLCPKAFTSHSSLVMHN--RHHSGDKPYKCEICGRAFSVSSNRARHMRSHKNIKPYS--CSQCEWSFTTSSDLKRHLKTHTGEKPYRCEECDKAFSSSC--GLSTHKKIHFNIKPHSCTVCHKRFATTGQVTSHMRTHTGEQPFKCTYCDKAFSIKGNLTVHI-RRHTNERPYVCTTCGKSFTVISQLVMH-NRSHTDERPYKCDICGKKFRQQGGLSIHKK 377          

HSP 11 Score: 52.373 bits (124), Expect = 1.518e-6
Identity = 34/124 (27.42%), Postives = 58/124 (46.77%), Query Frame = 1
Query: 3517 LQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            +++H    P K    C  CD  F    +L  H++ +H   R + C  C K+F+    L  H+++H D R + C +   C ++F     LS H ++   +    + CT C K + T  +LD H +
Sbjct:  292 MRTHTGEQPFK----CTYCDKAFSIKGNLTVHIR-RHTNERPYVCTTCGKSFTVISQLVMHNRSHTDERPYKCDI---CGKKFRQQGGLSIHKKIHTEE--KPHECTQCEKAFITKAKLDRHFR 405          

HSP 12 Score: 51.6026 bits (122), Expect = 2.268e-6
Identity = 28/81 (34.57%), Postives = 39/81 (48.15%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNG 1467
            C  C KAF        H  THT  + ++C  C + F+ +S ++ HM  H  VK F+C  C KAF     +  H K+  K G
Sbjct:  471 CPYCDKAFAVKGNCTVHARTHTKERPYKCTNCGRAFSCRSGLREHMRTHGGVKEFICSICEKAFLRRGCLKKHEKLHVKQG 551          
BLAST of Zinc finger, C2H2 type vs. Ensembl Nematostella
Match: EDO31838 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWT3])

HSP 1 Score: 121.709 bits (304), Expect = 9.458e-29
Identity = 126/489 (25.77%), Postives = 191/489 (39.06%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLA-----ETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDV--KPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C  CGK F     L+ H V H+G K ++C  C K FTQ ++   H+ +H   K + C  CGK F+    +  H+ +IH       +  + H  ++             RF +   L       T + P +  +  +            F+   N    T   I S +   K D            +  +   E+G ++ H MI    +G + ++C  C K + +S DL RH+RIHT +KP++C  C K F L   +K H K H   K + C+ C K F     LK H  +H   K  + C  C + F     L+ H            D          +           KP        DV  K    +  L   + I    K      +  KC+ CGK +    +L  HLK H +      C  C+K F     ++ HLR  H  ++ + C  C   F    +L RH ++HS  KPY C +C + F
Sbjct:   11 CDECGKCFTRHAQLKEHLVIHSGKKPYKCDECGKCFTQHANT--HLRIHSGKKPYKCDECGKCFSESGKLKRHL-MIH-------TGEKPHKCDDCG----------KRFTRSGDLKTHLRIHTGEKPYECDDCGK-----------RFTLSGN--MKTHLRIHSGKKPYKCD------------ECGKCFTESGNLKTHLMIH---SGEKPYKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNMKKHLKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKKP-YKCDECGKCFTELETLKTHLMIHSGEKPYKCDECGKCFTQSGNLKRHLMIHSGQKPYKC-----DVCGKCFTRSGALTTHLMIHSGQK----PYKPHKCDECGKCFNQSGHLKRHLKIH-TGQKPYECGECSKCFTRSERLKTHLRI-HSGQKPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCF 439          

HSP 2 Score: 107.457 bits (267), Expect = 4.552e-24
Identity = 83/315 (26.35%), Postives = 134/315 (42.54%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHF----SYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYH 2157
            C  CGK F     L+ H + H+G K ++C  C K FTQ   +K H+ +H   K + C  CGK FT   NM  H+K+         S  + +  +E      E     + + K   +  + + P    E  +  + E  T + H       +P            + N  +     S Q     +   +    +G +  H MI      ++  +C  C K + +S  L RH++IHT QKP++C  C K F     LK H + H   K + C++C K F+  + LK H  +H   K  + C +C + F+   +L+ H
Sbjct:  149 CDECGKCFTESGNLKTHLMIHSGEKPYKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNMKKHLKI--------HSGKKPYKCDECGKSFTE-----HAYLKTHLIIHSGKKPYKCDECGK-CFTELETLKTHLMIHSGEKPYKCDECGKCFTQSGNLKRHLMIHSGQKPYKCDVCGKCFTRSGALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKRHLKIHTGQKPYECGECSKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHLMIHSGQKP-YKCDVCGKCFSESGNLKKH 448          

HSP 3 Score: 106.686 bits (265), Expect = 8.789e-24
Identity = 113/476 (23.74%), Postives = 171/476 (35.92%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNEN---HFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQV---TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDK--LRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHS 2628
            C  CGK F     L+RH + HTG K  +C  C K FT+   +K H+ +H   K + C  CGK FT   NM TH++ IH                ES +             K   +  + + P    E  +          +   H   +P    +       + N       K H  I   +   + D+       H  +K  +   +G + ++C  C K + +   L  H+ IH+ +KP++C  C K F     LK H   H   K + C++C K F     L  H  +H   K      C  C + FN   HL+ H                                   KP          K    +E L   + I        S  + +KC+ CGK +   + L  HL  H S      C  C K F    ++++HL   H  ++ + C +C   FI   +L  H  +HS
Sbjct:   65 CDECGKCFSESGKLKRHLMIHTGEKPHKCDDCGKRFTRSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKTHLR-IHSGKKPYKCDECGKCFTESGNL------------KTHLMIHSGEKPYKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNM------KKHLKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCDECGKCFTELETLKTHLMIHSGEKPYKCDECGKCFTQSGNLKRHLMIHSGQKPYKCDVCGKCFTRSGALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKRHLKI----------------------------HTGQKPYECGECS---KCFTRSERLKTHLRIH-------SGQKPYKCDVCGKCFSESRNLKRHLMIH-SGQKPYKCDVCGKCFSESGNLKKHLMI-HSGQKPYKCDECGKCFILYRNLKTHLSIHS 481          

HSP 4 Score: 95.5153 bits (236), Expect = 3.056e-20
Identity = 82/308 (26.62%), Postives = 125/308 (40.58%), Query Frame = 1
Query: 1786 ETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPY---ACPLCLRRFKAKIYCDRHI 2700
            E+G+++ H MI    TG +  +C  C K + +S DL  H+RIHT +KP++C  C K F L   +K H + H   K + C+ C K F     LK H  +H  +K  + C  C + F     L+ H            D    +     +           KP          K    +  L   + I        S  + +KC+ CGK +   + L  HL  H S      C  C K F    ++++HL   H  ++ + C  C   F    +L  H ++HS  KPY    C  C + F    +  RH+
Sbjct:   74 ESGKLKRHLMIH---TGEKPHKCDDCGKRFTRSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKTHLRIHSGKKPYKCDECGKCFTESGNLKTHLMIHSGEKP-YKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNMKKHLKIHSGKKPYKCDECG---KSFTEHAYLKTHLIIH-------SGKKPYKCDECGKCFTELETLKTHLMIH-SGEKPYKCDECGKCFTQSGNLKRHLMI-HSGQKPYKCDVCGKCFTRSGALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKRHL 365          

HSP 5 Score: 77.7962 bits (190), Expect = 1.602e-14
Identity = 81/336 (24.11%), Postives = 128/336 (38.10%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHK--------IGEECDDR--KLTTNYL-----------KCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            C+ C   F       KH+ IH   + +KC  C  S+     L  H+ IIH+ +            YKC  C   F+  +  + H +IH  ++   C+ C   F     L +HL  H         +  +C  R   LTT+ +           KC  C   F   G++K+H ++ H   +G  P E G   K   R                     + +K + +  S     K                          C VCGK F     L+RH + H+G K ++C +C K F++  ++K H+++H   K + C  CGK F    N+ TH+ +
Sbjct:  205 CDDCGKRFTLSGNMKKHLKIHSGKKPYKCDECGKSFTEHAYLKTHL-IIHSGK----------KPYKCDECGKCFTELETLKTHLMIHSGEKPYKCDECGKCFTQSGNLKRHLMIHSGQKPYKCDVCGKCFTRSGALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKRH-LKIH---TGQKPYECGECSKCFTRS--------------------ERLKTHLRIHSGQKPYK--------------------------CDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHLMIHSGQKPYKCDECGKCFILYRNLKTHLSI 479          

HSP 6 Score: 62.3882 bits (150), Expect = 9.610e-10
Identity = 77/335 (22.99%), Postives = 125/335 (37.31%), Query Frame = 1
Query:  508 CEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTN----EC-------TVVNDSNQEMN-------YKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPD-VNRSISKRGR-PXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            C+ C   F        H+ IH  ++ +KC  C   +    +L  H+  IHT     EC       T+  +  + +        YKC  C   F+     + H +IH   +   C+ C   F     L  HL  H  GE+           KC  C   F   GN+K+H +      SG  P +  +  K   R                   A  T  +   G+      K D   +  ++ G   +     + +    C  C K F     L+ H   H+G K ++C +C K F++  ++K H+++H   K + C  CGK F+   N+  H+ +
Sbjct:  149 CDECGKCFTESGNLKTHLMIHSGEKPYKCDECGKCFTQSGDLKRHLR-IHTGEKPYECDDCGKRFTLSGNMKKHLKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCDECGKCFTELETLKTHLMIHS-GEK---------PYKCDECGKCFTQSGNLKRHLMI----HSGQKPYKCDVCGKCFTRSG-----------------ALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKRHLKIHTGQKPYECGECSKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHLMI 451          

HSP 7 Score: 55.8398 bits (133), Expect = 1.224e-7
Identity = 67/256 (26.17%), Postives = 93/256 (36.33%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSC-----IEG-------LPEGRKP--AGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 4950
            P+ C  C K F R+ +L+ HL +HT  +PY+C  C KRF    ++KTH    HS                S   L+ HL +H  E    C  C K F    DL RH+     EK      C     + G       +  G+KP    E   + T H +            +I    KK  KC  C   F        H  +    EK +    C K F  +     H+  +H+    Y C  C   F +  +   H
Sbjct:   90 PHKCDDCGKRFTRSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKTHLRI-HSGKKPYKCDECGKCFTESG-NLKTHLMIHSGEKPYKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNMKKHLKIHSGKKPYKCDECGKSFTEHAYLKT--------HLIIHSGKKPYKCDECGKCFTELETLKTHLMI-HSGEKPYKCDECGKCFTQSGNLKRHLM-IHSGQKPYKCDVCGKCFTRSGALTTH 333          

HSP 8 Score: 54.6842 bits (130), Expect = 2.633e-7
Identity = 62/244 (25.41%), Postives = 92/244 (37.70%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCV--GLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 4950
            PY C  C K F ++ +L++HL +HT  +PY+C  C KRF    ++K H   K  S  K  +C  C K       L+ HL +H  +    C  C K F   E L  H+     EK      C +   +    +G L                   + ++    +K  KC  C   F        H  +  G K  K H    C K F  +     H++ +H     Y C +C+  F +      H
Sbjct:  174 PYKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNMKKH--LKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCDECGKCFTELETLKTHLMIHSGEKPYKCDECGKCFTQ----SGNLK------------------RHLMIHSGQKPYKCDVCGKCFTRSGALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKRHLK-IHTGQKPYECGECSKCFTRSERLKTH 392          

HSP 9 Score: 52.7582 bits (125), Expect = 1.126e-6
Identity = 32/101 (31.68%), Postives = 46/101 (45.54%), Query Frame = 1
Query: 2368 SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            S  + + C+ CGK +     L EHL  H S      C  C K F  +     HLR  H  ++ + C +C   F     L RH ++H+  KP+ C  C +RF
Sbjct:    4 SGQKRYNCDECGKCFTRHAQLKEHLVIH-SGKKPYKCDECGKCFTQH--ANTHLRI-HSGKKPYKCDECGKCFSESGKLKRHLMIHTGEKPHKCDDCGKRF 100          

HSP 10 Score: 52.373 bits (124), Expect = 1.445e-6
Identity = 35/107 (32.71%), Postives = 52/107 (48.60%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            P+ C  C K FN++ +L++HL +HT  +PY+C +C K F     LKTH    HS                S+  L+ HL +H  +    C VC K F    +L +H+
Sbjct:  345 PHKCDECGKCFNQSGHLKRHLKIHTGQKPYECGECSKCFTRSERLKTHLRI-HSGQKPYKCDVCGKCFSESR-NLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHL 449          

HSP 11 Score: 51.6026 bits (122), Expect = 2.318e-6
Identity = 33/108 (30.56%), Postives = 47/108 (43.52%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVA-LRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            PY C  C K F ++ NL++HL +H+  +PY+C  C K F    +L TH                      +Q   L+ HLK+H  +    C  C K F   E L  H+
Sbjct:  286 PYKCDECGKCFTQSGNLKRHLMIHSGQKPYKCDVCGKCFTRSGALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKRHLKIHTGQKPYECGECSKCFTRSERLKTHL 393          
BLAST of Zinc finger, C2H2 type vs. Ensembl Nematostella
Match: EDO41082 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5G4])

HSP 1 Score: 120.168 bits (300), Expect = 2.264e-28
Identity = 117/496 (23.59%), Postives = 190/496 (38.31%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSE-DV-ERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C+ C +AFK    L +H+  H   K + C  C K FT++ ++  H+ +H   + + C++C K F+                    S   +H    S +           F + ++L     S +DD        N+       F+Y              + + +K D    H+G+   E D+  R   +   +  HE      TG R F C FC+ ++     LTRH+R HT Q+P++C  C  +F +   LK+H + H   + + CEICNK F     L  H   H   K  + C  C + F +  +L YH     HR  A                                      P          +    + K  L  +  + +KC  C + +     L  H + H        C+ C+K F +     +H+RT H   + ++C  C   F+   SL RH L+HS +KP+ C  C + F++     RH+
Sbjct:    1 CSECSRAFKNKSDLVKHKRVHCDDKPYSCRTCDKEFTRRDALTCHIRIHTGERPYECRYCDKRFSQP------------------SHRVQHEFKHSGERSHMCDICSKSFSRASTLVRHMISHTDDKPYVCTKCNKA------FAY--------------SASLVKHDR-VYHRGVKPYECDICGRAFSDRSGLVKHERTH---TGERPFECSFCHMMFSLKGLLTRHMRSHTGQRPYKCEYCSAAFSVSDTLKSHLRLHTGERPYKCEICNKGFVQSSALSSHLLTHS-GKRPYECLTCGQTFRSRSNLLYH--ERRHRGEA--------------------------------------PFECQTCGKVFVRSDNLSKHMLCHTGEKPYKCQVCERGFACTSALKSHQRRH-DGIKPYKCERCDKRFTSSNERTRHMRT-HTGDKPYTCDICKENFMYTTSLARHKLIHSGAKPFKCDTCEKAFRSSSELTRHV 411          

HSP 2 Score: 94.3597 bits (233), Expect = 6.693e-20
Identity = 84/324 (25.93%), Postives = 131/324 (40.43%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV----------IHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            C +CG+AF     L +HE THTG + FEC  C   F+ K  +  HM  H   + + C++C  AF+    + +H+++          I   G    S    HLL  S            R  +  +  +T +S S+       L++E      H    P            ++N  K     + +     +  ER    T  ++ H+   D   G + ++C  C K +  S + TRH+R HT  KP+ C +C ++F   + L  H   H   K F C+ C K F     L  H +L    K  F C  C + F +   L  H +T
Sbjct:  142 CDICGRAFSDRSGLVKHERTHTGERPFECSFCHMMFSLKGLLTRHMRSHTGQRPYKCEYCSAAFSVSDTLKSHLRLHTGERPYKCEICNKGFVQSSALSSHLLTHSG----------KRPYECLTCGQTFRSRSN------LLYHER----RHRGEAPFECQTCGKVFVRSDNLSKHMLCHTGEKPYKCQVCERGFACTSALKSHQRRHD---GIKPYKCERCDKRFTSSNERTRHMRTHTGDKPYTCDICKENFMYTTSLARHKLIHSGAKPFKCDTCEKAFRSSSELTRHVKLVHVKKP-FPCDTCKQAFRSEDALARHKNT 441          

HSP 3 Score: 90.1225 bits (222), Expect = 1.654e-18
Identity = 79/322 (24.53%), Postives = 126/322 (39.13%), Query Frame = 1
Query:  487 NGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            +G     C+IC   F    T ++HM  H +D+ + C+ C  ++ Y  +L+ H  + H               Y+C IC   FS +     H   H  +    C  C  +F  K LL +H+  H  G+            KC+ C   F +V +  K ++R H   +G  P +  +  K    V +                 C T     + RS L      +      RG          +    C  CGK F     L +H + HTG K ++C +C++GF   S++K H   HD +K + C+ C K FT  +    H++ 
Sbjct:   78 SGERSHMCDICSKSFSRASTLVRHMISHTDDKPYVCTKCNKAFAYSASLVKHDRVYHRG----------VKPYECDICGRAFSDRSGLVKHERTHTGERPFECSFCHMMFSLKGLLTRHMRSH-TGQ---------RPYKCEYCSAAF-SVSDTLKSHLRLH---TGERPYKCEICNKGF--VQSSALSSHLLTHSGKRPYECLTCGQTFRSRSNL------LYHERRHRG----------EAPFECQTCGKVFVRSDNLSKHMLCHTGEKPYKCQVCERGFACTSALKSHQRRHDGIKPYKCERCDKRFTSSNERTRHMRT 357          

HSP 4 Score: 84.7297 bits (208), Expect = 9.118e-17
Identity = 84/327 (25.69%), Postives = 121/327 (37.00%), Query Frame = 1
Query:  478 KTINGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH 1458
            +T  G     C  C + F  K    +HM  H   R +KC +C  +++    L  H+  +HT           E  YKC IC+  F +  A  +H L H       C  C   F+ +  L  H   H+ GE            +C+ C  +F    N+ KH + CH   +G  P +     +  ER                   AC +     Q R   D +KP                         C  C K F +     RH  THTG K + C ICK+ F   +S+  H ++H   K F C  C KAF     +  H+K++H
Sbjct:  160 RTHTGERPFECSFCHMMFSLKGLLTRHMRSHTGQRPYKCEYCSAAFSVSDTLKSHLR-LHTG----------ERPYKCEICNKGFVQSSALSSHLLTHSGKRPYECLTCGQTFRSRSNLLYHERRHR-GEA---------PFECQTCGKVFVRSDNLSKHML-CH---TGEKPYK----CQVCER-----------------GFACTSALKSHQRRH--DGIKP-----------------------YKCERCDKRFTSSNERTRHMRTHTGDKPYTCDICKENFMYTTSLARHKLIHSGAKPFKCDTCEKAFRSSSELTRHVKLVH 415          

HSP 5 Score: 60.077 bits (144), Expect = 5.119e-9
Identity = 57/241 (23.65%), Postives = 93/241 (38.59%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            PY C IC + F+  S L +H   HT  RP++C  C   F  +  L T     H+        +       S   L++HL+LH  E    C++C KGF     LS H+                G++P   L+   T     +    ++  +   P       +C +C  +F        H  +    EK +  + C++ F  TS    H Q  H+ +  Y C +C+  F   +    H ++
Sbjct:  139 PYECDICGRAFSDRSGLVKHERTHTGERPFECSFCHMMFSLK-GLLTRHMRSHTGQRPYKCEYCSAAFSVSDT-LKSHLRLHTGERPYKCEICNKGFVQSSALSSHLLTH------------SGKRPYECLTCGQTFRSRSNLLYHERRHRGEAP------FECQTCGKVFVRSDNLSKHM-LCHTGEKPYKCQVCERGFACTSALKSH-QRRHDGIKPYKCERCDKRFTSSNERTRHMRT 357          

HSP 6 Score: 57.7658 bits (138), Expect = 2.608e-8
Identity = 33/109 (30.28%), Postives = 55/109 (50.46%), Query Frame = 1
Query: 3562 CANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            C  C+  F  S SLV+H +  H+  + + C++C +AFS +  L  H +TH   R F C     C+  F     L+RH+R   +     Y+C +C+  +  +  L SH++
Sbjct:  113 CTKCNKAFAYSASLVKHDRVYHRGVKPYECDICGRAFSDRSGLVKHERTHTGERPFECSF---CHMMFSLKGLLTRHMRS--HTGQRPYKCEYCSAAFSVSDTLKSHLR 216          

HSP 7 Score: 57.3806 bits (137), Expect = 3.687e-8
Identity = 62/241 (25.73%), Postives = 95/241 (39.42%), Query Frame = 1
Query: 4246 CSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKP------AGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 4950
            C IC K F+RAS L +H+  HT  +PY C KC K F +  SL  H+   H  V K   C +C +    +  L  H + H  E    C  C+  F L+  L+RH+                G++P      +   S + T   H      ++P             KC  C+  F   +   +H  +    ++ +    C +TF S S  LYH +  H     + C  C  +F +  +   H
Sbjct:   85 CDICSKSFSRASTLVRHMISHTDDKPYVCTKCNKAFAYSASLVKHDRVYHRGV-KPYECDICGRAFSDRSGLVKHERTHTGERPFECSFCHMMFSLKGLLTRHMRSH------------TGQRPYKCEYCSAAFSVSDTLKSHLRLHTGERP------------YKCEICNKGFVQSSALSSHL-LTHSGKRPYECLTCGQTFRSRSNLLYH-ERRHRGEAPFECQTCGKVFVRSDNLSKH 298          

HSP 8 Score: 56.9954 bits (136), Expect = 4.738e-8
Identity = 64/241 (26.56%), Postives = 92/241 (38.17%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSC--SFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQ 4953
            PY C IC+KGF ++S L  HL  H+  RPY+C  C + FR R +L  HE  +H               +RS   L  H+  H  E    C+VC +GF     L  H   +H           +G KP                    +  + +      K   C  C  +F++ T          G K  K      C+K F S+S+   HV+ VH +   + C  C   F  E +   H+
Sbjct:  223 PYKCEICNKGFVQSSALSSHLLTHSGKRPYECLTCGQTFRSRSNLLYHE-RRHRGEAPFECQTCGKVFVRSD-NLSKHMLCHTGEKPYKCQVCERGFACTSALKSH-QRRH-----------DGIKPY------KCERCDKRFTSSNERTRHMRTHTGDKPYTCDICKENFMYTTSLARHKLIHSGAKPFKCDT---CEKAFRSSSELTRHVKLVHVK-KPFPCDTCKQAFRSEDALARHK 439          

HSP 9 Score: 52.7582 bits (125), Expect = 8.707e-7
Identity = 34/123 (27.64%), Postives = 57/123 (46.34%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDP 2199
            TG + ++C+ C + +  +  L  H R H   KP++C  C K F   +    H ++H   K ++C+IC + F    +L  H+ +H   K  F C  C++ F +   L  H    H   +  P P
Sbjct:  303 TGEKPYKCQVCERGFACTSALKSHQRRHDGIKPYKCERCDKRFTSSNERTRHMRTHTGDKPYTCDICKENFMYTTSLARHKLIHSGAKP-FKCDTCEKAFRSSSELTRHVKLVH---VKKPFP 421          
BLAST of Zinc finger, C2H2 type vs. Ensembl Nematostella
Match: EDO35006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMP5])

HSP 1 Score: 111.694 bits (278), Expect = 8.430e-26
Identity = 108/466 (23.18%), Postives = 179/466 (38.41%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNN---RLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRH 2613
            C  C + F  P  L  H   H   K F C  C K FT    +  HMV H  +K F+C FC   FT+   ++ H+ ++H              LNE +      +K    FK I  L+    +  D  +  +                       D    S+   ++      H  +      ++      ++++H ++ D         C  C K +  S  L  H+R+HT +KPF C  C K+F     L  H ++H   K + CE C++ FN    LK H +LH  +K  + C+ CDR F+   HLR H  +    S+   +                                   P+   E+ ++  P  ++    L  +   R  +C  CGK++     L  HL+ H +      C++C+++F    +++ H+RT H   + ++C  C   F   + L RH
Sbjct:   31 CPCCPEKFNDPSSLALHVACHVKSKGFLCGQCNKCFTSDRQLAEHMVQHSGIKPFICHFCRSGFTHSLALSRHV-ILH--------------LNEQSCRCNYCKKS---FKGIRELSVHILTHMDSQKCNK----------------------CDKIFSSSSELVR--HFHHHMDVYQCTKCDKTFARECELKMHLIMHDSKPTLT---CPKCDKTFIHSHGLNLHLRVHTGEKPFTCKHCGKAFAHSGNLTVHLRTHTGEKPYQCEYCHQAFNHSSNLKNHMRLHTGEK-PYKCRACDRTFSRSSHLRNHVIS---HSLGKTET----------------------------------PMHRCEVCDKSFPELDLLTEHLKTHNDMRPHQCRFCGKAFTVPSGLAVHLRTH-TGEKPYRCEYCSRAFSHSSNLKVHVRT-HTGEKPYNCPTCKITFARSSDLRRH 411          

HSP 2 Score: 77.0258 bits (188), Expect = 1.986e-14
Identity = 80/338 (23.67%), Postives = 132/338 (39.05%), Query Frame = 1
Query:  487 NGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYN----YEVNLLVHIAIIHTNECTVVNDSNQEMN---------YKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGR--SQLDEMKPDV-NRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            +G     C  C   F       +H+ +H N++  +C++CK S+       V++L H+     N+C  +  S+ E+          Y+C  C   F+R+   + H ++H     L C  C   F     L+ HL  H  GE+            CK C   F + GN+  H +R H   +G  P +        E                      +  K  A  R  S+   ++  V + S+ K   P             C VC K+F    LL  H  TH  ++  +C  C K FT  S + +H+  H   K + C++C +AF++  N+  H++ 
Sbjct:   80 SGIKPFICHFCRSGFTHSLALSRHVILHLNEQSCRCNYCKKSFKGIRELSVHILTHMDSQKCNKCDKIFSSSSELVRHFHHHMDVYQCTKCDKTFARECELKMHLIMHDSKPTLTCPKCDKTFIHSHGLNLHLRVH-TGEK---------PFTCKHCGKAFAHSGNLTVH-LRTH---TGEKPYQ-------CEYCHQAFNHSSNLKNHMRLHTGEKPYKCRACDRTFSRSSHLRNHVISHSLGKTETP----------MHRCEVCDKSFPELDLLTEHLKTHNDMRPHQCRFCGKAFTVPSGLAVHLRTHTGEKPYRCEYCSRAFSHSSNLKVHVRT 386          

HSP 3 Score: 74.7146 bits (182), Expect = 9.308e-14
Identity = 71/285 (24.91%), Postives = 117/285 (41.05%), Query Frame = 1
Query: 1846 FRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            ++C  C K + + C+L  H+ +H  +    C  C K+F     L  H + H   K F+C+ C K F     L VH + H  +K  + C+ C + FN   +L+     +H R      P   ++               ++  + S++       + N +++  +   E          + +C  C KS+     L EHLK H +    + C+FC K+F     +  HLRT H   + + C  C   F   ++L  H   H+  KPY CP C   F       RH+
Sbjct:  165 YQCTKCDKTFARECELKMHLIMHDSKPTLTCPKCDKTFIHSHGLNLHLRVHTGEKPFTCKHCGKAFAHSGNLTVHLRTHTGEK-PYQCEYCHQAFNHSSNLK-----NHMRLHTGEKPYKCRAC--------------DRTFSRSSH-------LRNHVISHSLGKTETP--------MHRCEVCDKSFPELDLLTEHLKTH-NDMRPHQCRFCGKAFTVPSGLAVHLRT-HTGEKPYRCEYCSRAFSHSSNLKVHVRTHTGEKPYNCPTCKITFARSSDLRRHV 412          

HSP 4 Score: 62.7734 bits (151), Expect = 6.371e-10
Identity = 72/295 (24.41%), Postives = 115/295 (38.98%), Query Frame = 1
Query: 1798 IQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKP----YACPLCLRRF 2670
            + LH     +  GF   +C  C+   R+   L  H+  H+  KPF C+ C   F     L  H   H   +   C  C K F   + L VH   H   +    C  CD+ F++   L  H+   HH           ++   E +         +KPT     P   K  I +  LN       +  R  +  + F C HCGK++     L  HL+ H +      C++C+++F    +++ H+R  H   + + C  C   F   + L  H + HS  K     + C +C + F
Sbjct:   44 LALHVACHVKSKGFLCGQCNKCFTSDRQ---LAEHMVQHSGIKPFICHFCRSGFTHSLALSRHVILHLNEQSCRCNYCKKSFKGIRELSVHILTHMDSQ---KCNKCDKIFSSSSELVRHF---HHHMDVYQCTKCDKTFARECELKMHLIMHDSKPTLTC--PKCDKTFIHSHGLN-------LHLRVHTGEKPFTCKHCGKAFAHSGNLTVHLRTH-TGEKPYQCEYCHQAFNHSSNLKNHMRL-HTGEKPYKCRACDRTFSRSSHLRNHVISHSLGKTETPMHRCEVCDKSF 318          

HSP 5 Score: 54.6842 bits (130), Expect = 2.401e-7
Identity = 42/136 (30.88%), Postives = 61/136 (44.85%), Query Frame = 1
Query: 3550 FYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHV-----KQLVSDYDALIINSNQFVE 3942
            F H C  C  +F D  SL  HV + H   + F C  C+K F++   L  H   H   +    F+C  C   F    +LSRHV +  N+     RC +C K +K  REL  H+      Q  +  D +  +S++ V 
Sbjct:   27 FKHKCPCCPEKFNDPSSLALHV-ACHVKSKGFLCGQCNKCFTSDRQLAEHMVQHSGIKP---FICHFCRSGFTHSLALSRHVILHLNE--QSCRCNYCKKSFKGIRELSVHILTHMDSQKCNKCDKIFSSSSELVR 156          

HSP 6 Score: 53.1434 bits (126), Expect = 7.224e-7
Identity = 61/243 (25.10%), Postives = 84/243 (34.57%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPK-----KLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 4950
            P++C  C K F  + NL  HL  HT  +PYQC  C            H+A  HSS                   L+NH++LH  E    C+ C + F     L  HV                    +  L  T T  H      +  P  +++ E  K     +  +C  C   F   +    H       EK +    C + F  +S    HV+  H     YNC  C I FA+ S    H
Sbjct:  220 PFTCKHCGKAFAHSGNLTVHLRTHTGEKPYQCEYC------------HQAFNHSS------------------NLKNHMRLHTGEKPYKCRACDRTFSRSSHLRNHV-------------------ISHSLGKTETPMHRCEVCDKSFPELDLLTEHLKTHNDMRPHQCRFCGKAFTVPSGLAVHL-RTHTGEKPYRCEYCSRAFSHSSNLKVHVR-THTGEKPYNCPTCKITFARSSDLRRH 411          
BLAST of Zinc finger, C2H2 type vs. Ensembl Nematostella
Match: EDO26879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAT8])

HSP 1 Score: 107.842 bits (268), Expect = 1.510e-24
Identity = 92/324 (28.40%), Postives = 139/324 (42.90%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLW---NENP--TNENHFSYQPNHQSNTDSYIPSAEN----------FIKLDWDKSHQGILLSEDVERIDK------ETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFN 2133
            C VCGK F     L+ H + H+G K ++C  C K FTQ + +K H+V+H   K + C  CGK FT   ++ TH+ VIH                +S   +   +   +  KK     E     S+ A +  +L     E P   ++    +  +    T   I S E           F +    K H  I   +   + D+      E+G+++ H +I    TG +  +C  C K + +S DL  H+RIHT +KP++C  C K F L   +K H K H   K + C+ C K F     LK H  +H   K  + C  C + F 
Sbjct:   89 CEVCGKCFTRKTHLKTHLMVHSGQKPYKCDECGKCFTQHAHLKAHLVIHSGKKPYKCDECGKCFTLSGDLKTHL-VIHSGEKPYECDDCGKCFTQSGAMKRHLR--IHTGKKPYKCDECGNCFSESAHLKAHLVIHSGEKPYKCDDCGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESGKLKRHLVIH---TGEKPHKCDDCGKRFTQSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKKHVKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKK-PYKCYECGKCFT 405          

HSP 2 Score: 99.7525 bits (247), Expect = 7.478e-22
Identity = 89/334 (26.65%), Postives = 138/334 (41.32%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGT-----------EVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAE-----TNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWD-KSHQGILLSE------DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYH 2157
            C  CGK F     L+ H   HT +K +EC +C K FT+K+ +K H++VH   K + C  CGK FT   ++  H+ VIH                +    + HL+  S +   E       F +  ++       T + P    E     ++E+   + H      H                L  D K+H  I   E      D  +   ++G ++ H  I    TG + ++C  C   + +S  L RH+ IHT +KP +C  C K F     LK H + H   K + C+ C K F L   +K H ++H   K  + C  C + F    +L+ H
Sbjct:   61 CDECGKCFTQSGTLKTHLRIHTKVKPYECEVCGKCFTRKTHLKTHLMVHSGQKPYKCDECGKCFTQHAHLKAHL-VIHSGKKPYKCDECGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGN-CFSESAHLKAHLVI---HSGEKPYKCDDCGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIH---TGKKPYKCDECGNCFSESGKLKRHLVIHTGEKPHKCDDCGKRFTQSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKKHVKIHSGKK-PYKCDECGKSFTEHAYLKTH 385          

HSP 3 Score: 97.4413 bits (241), Expect = 4.349e-21
Identity = 76/276 (27.54%), Postives = 112/276 (40.58%), Query Frame = 1
Query: 1849 RCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL--SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            +C  C K + +S  L  H+RIHT+ KP++C +C K F  K+ LK H   H   K + C+ C K F     LK H  +H   K  + C  C + F     L+ H         +   P                +      T         KP   +E  N     A +    +  S  + +KC+ CGK +     L  HL  H S      C  C K F    +M++HLR  H  ++ + C +C   F     L RH ++H+  KP+ C  C +RF
Sbjct:   60 KCDECGKCFTQSGTLKTHLRIHTKVKPYECEVCGKCFTRKTHLKTHLMVHSGQKPYKCDECGKCFTQHAHLKAHLVIHSGKK-PYKCDECGKCFTLSGDLKTHLVIH-----SGEKPYECDDCGKCFTQSGAMKRHLRIHTGK-------KPYKCDECGNCFSESAHLKAHLVIHSGEKPYKCDDCGKCFTLSGDLKTHLVIH-SGEKPYECDDCGKCFTQSGAMKRHLRI-HTGKKPYKCDECGNCFSESGKLKRHLVIHTGEKPHKCDDCGKRF 320          

HSP 4 Score: 89.7373 bits (221), Expect = 1.449e-18
Identity = 75/323 (23.22%), Postives = 122/323 (37.77%), Query Frame = 1
Query: 1786 ETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNP------PDVKPLIWNELLNQPIPIAEIDK------------RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            ++G ++ H  I  +V   + + C  C K + +   L  H+ +H+ QKP++C  C K F   + LK H   H   K + C+ C K F L   LK H  +H  +K  + C  C + F     ++ H      +     D   +      H           KP    +         D+K  +      +P    +  K            R  +  + +KC+ CG  +     L  HL  H +    + C  C K F     ++ HLR  H   + + C  C   F    ++ +H  +HS  KPY C  C + F    Y   H+
Sbjct:   70 QSGTLKTHLRIHTKV---KPYECEVCGKCFTRKTHLKTHLMVHSGQKPYKCDECGKCFTQHAHLKAHLVIHSGKKPYKCDECGKCFTLSGDLKTHLVIHSGEK-PYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESAHLKAHLVIHSGEKPYKCDDCGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESGKLKRHLVIH-TGEKPHKCDDCGKRFTQSGDLKTHLRI-HTGEKPYECDDCGKRFTLSGNMKKHVKIHSGKKPYKCDECGKSFTEHAYLKTHL 386          

HSP 5 Score: 88.9669 bits (219), Expect = 2.255e-18
Identity = 78/301 (25.91%), Postives = 120/301 (39.87%), Query Frame = 1
Query: 1789 TGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGF----HLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKL---SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            +G ++ H +I    +G + + C  C K + +S  + RH+RIHT +KP++C  C   F   + LK H   H   K + C+ C K F L   LK H  +H  +K  + C  C + F        HLR H                                               KP   +E  N      ++ KR L   +  +  KC+ CGK +     L  HL+ H +      C  C K F    +M++H++  H  ++ + C +C   F   A L  H ++HS  KPY C  C + F
Sbjct:  155 SGDLKTHLVIH---SGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESAHLKAHLVIHSGEKPYKCDDCGKCFTLSGDLKTHLVIHSGEK-PYECDDCGKCFTQSGAMKRHLRIHTGK--------------------------------------------KPYKCDECGNCFSESGKL-KRHLVIHTGEKPHKCDDCGKRFTQSGDLKTHLRIH-TGEKPYECDDCGKRFTLSGNMKKHVKI-HSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCYECGKCF 404          

HSP 6 Score: 82.4185 bits (202), Expect = 3.327e-16
Identity = 76/315 (24.13%), Postives = 110/315 (34.92%), Query Frame = 1
Query: 1924 KPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI------SAKKCSKKKRNRFQQNDLMTGIINRNPIGSLTNQIGQSDLEANDQSETFT 2850
            KP +C  C K F     LK H + H K+K + CE+C K F  K  LK H  +H   K  + C  C + F    HL+ H      +     D                      KP    +     K    +  + + + I        +  + +KC+ CG  +    +L  HL  H S      C  C K F     ++ HL   H   + + C  C   F    ++ RH  +H+  KPY C  C   F       RH+         KC    +   Q  DL T          L    G+   E +D  + FT
Sbjct:   57 KPHKCDECGKCFTQSGTLKTHLRIHTKVKPYECEVCGKCFTRKTHLKTHLMVHSGQK-PYKCDECGKCFTQHAHLKAHLVIHSGKKPYKCDECGKCFTLSGDLKTHLVIHSGEKPYECDDCG---KCFTQSGAMKRHLRIH-------TGKKPYKCDECGNCFSESAHLKAHLVIH-SGEKPYKCDDCGKCFTLSGDLKTHL-VIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESGKLKRHLVIHTGEKPHKCDDCGKRFTQSGDLKT---------HLRIHTGEKPYECDDCGKRFT 349          

HSP 7 Score: 56.225 bits (134), Expect = 6.487e-8
Identity = 63/242 (26.03%), Postives = 91/242 (37.60%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 4950
            P+ C  C K F ++  L+ HL +HTK++PY+C  C K F  +  LKTH      S  K  +C  C K       L+ HL +H  +    C  C K F L  DL  H+     EK      C +   +    +G +                   + +     KK  KC  C   F+  A    H  +    EK +    C K F  +     H+  +H+    Y C  C   F Q  +   H
Sbjct:   58 PHKCDECGKCFTQSGTLKTHLRIHTKVKPYECEVCGKCFTRKTHLKTHLMV--HSGQKPYKCDECGKCFTQHAHLKAHLVIHSGKKPYKCDECGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQ----SGAMK------------------RHLRIHTGKKPYKCDECGNCFSESAHLKAHLVI-HSGEKPYKCDDCGKCFTLSGDLKTHLV-IHSGEKPYECDDCGKCFTQSGAMKRH 273          

HSP 8 Score: 55.0694 bits (131), Expect = 1.482e-7
Identity = 36/128 (28.12%), Postives = 57/128 (44.53%), Query Frame = 1
Query: 2287 PPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            P ++K  +  EL +      E+ K    +++  KC+ CGK +     L  HL+ H        C+ C K F     ++ HL   H  ++ + C +C   F   A L  H ++HS  KPY C  C + F
Sbjct:   29 PQEIK--VEPELFDLKGITEEVSKALNLSDKPHKCDECGKCFTQSGTLKTHLRIHTKVKPYE-CEVCGKCFTRKTHLKTHLMV-HSGQKPYKCDECGKCFTQHAHLKAHLVIHSGKKPYKCDECGKCF 152          

HSP 9 Score: 52.7582 bits (125), Expect = 9.919e-7
Identity = 59/244 (24.18%), Postives = 85/244 (34.84%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PY C  C K F  + +L+ HL +H+  +PY+C  C K F    ++K H    H+                S   L+ HL +H  E    C  C K F L  DL  H+     EK      C +   +    +G +                   + +     KK  KC  C   F+   K   H  +    EK H    C K F  +     H++ +H     Y C  C   F    +   H K
Sbjct:  142 PYKCDECGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRI-HTGKKPYKCDECGNCFSES-AHLKAHLVIHSGEKPYKCDDCGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQ----SGAMK------------------RHLRIHTGKKPYKCDECGNCFSESGKLKRHLVIHT-GEKPHKCDDCGKRFTQSGDLKTHLR-IHTGEKPYECDDCGKRFTLSGNMKKHVK 359          
BLAST of Zinc finger, C2H2 type vs. Ensembl Medaka
Match: ENSORLT00000031019.1 (pep primary_assembly:ASM223467v1:17:11111179:11269269:-1 gene:ENSORLG00000007097.2 transcript:ENSORLT00000031019.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 156.762 bits (395), Expect = 2.008e-38
Identity = 137/526 (26.05%), Postives = 224/526 (42.59%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV--IHKNGTEVLSQS--------QEHLLNESNXXXXXXQKDPNRFKKIASL-----AETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAE----NFIKLDWDKSHQGILLSED-------VERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTA------NSNNPPDVKPLIWNELLNQPIPIAEIDK------------RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C +C K F +   L  H  THTG K + C +C+K F Q S + IHM +H   + + C+ C KAF Y +++  H++     ++ T  + Q         + H+    ++     +    RF   +SL       T ++P    E+   ++++    + H       +S+T   + S +     F+ L     H      E        ++R   +T  + +H  I    TG R F C+ C K   KS DL  H+R HT ++   C +C K FR  S LK H  +H   + +SCE+C K F+ K +L VH ++H  ++  F C++C + F TG  L+ H  T         D        L   +         +P              D+K  +      +P      +K            R  +  R F C  CGK++  +  L  H++ H +A N   C  C K FV+ R++  H++T H   R +SC  C   FI  + L  H  +H+  +PY+C +C + F
Sbjct:  127 CDICNKGFVSSGALTGHMRTHTGEKPYSCKVCQKCFFQSSYLNIHMRIHTGERPYSCEICKKAFIYANSLTYHMRTHTGERHFTCEICQKDFMQSRDLKAHMGTHKDERPYSCKVCEKRFTHKSSLNVHMRIHTGETPFT-CEVCGKIFSQRSKLKAHT------RSHTGEKLFSCDICKKVFVSLRNLTCHMRTHTGERPYSCKVCLKRFT-QTSCLNVHMRIH---TGERPFTCKVCGKSLIKSSDLKIHMRTHTGERHLTCKLCQKGFRQSSALKAHMGTHTGERPYSCEVCEKQFSYKSSLNVHMRIHTGERP-FTCEVCGKSFTTGSDLKVHIETHTAEKPFPCDICKKAFASLRSFTCHMRTHTSLRPFTCKLCQKGFMQSRDLKIHMRIHTGERPYSCELCEKQFSYKSSLSVHIRTHTGERPFTCEVCGKTFSQRSKLKAHIRTH-TAENPFSCDICKKVFVSLRNLTCHMKT-HTGERPYSCKVCQKCFIQPSHLNIHMRIHTGERPYSCDICKKTF 638          

HSP 2 Score: 155.606 bits (392), Expect = 4.329e-38
Identity = 184/842 (21.85%), Postives = 312/842 (37.05%), Query Frame = 1
Query:  193 SFINNSNVFQTVEDDCGEIYYACIGANDNDINHQDQVLQLIPQNQISNYI--ISDKDYSNVTYVNESVINGTN----YYDSQNTTYNQNKYQYDNLDPTVYKTINGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV----------IHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            SF   S++   +    GE  ++C   N   IN       +        Y   +  K ++  +Y+N  + + T       D     +  + Y   ++     +   G    +C+IC   F S      HM  H  ++ + C  C+  +     L +H+ I HT E            Y C IC   F    +   H   H  +    CE C   F     L  H+  HK     D+R  +     CK+C   F +  ++  H +R H   +G  P    +  K                      I  Q  KL A  RS   E                           +C +C K F +   L  H  THTG + + C +C K FTQ S + +HM +H   + F C+ CGK+     ++  H++           + + G    S  + H+   + +     +    +F   +SL    +  + +   T  +  ++      F+   + + + +++  +AE     D        +  +    +   T  ++ H       T  R F C+ C K + +S DL  H+RIHT ++P+ C +C K F  KS L  H ++H   + F+CE+C K F+ +  LK H + H  +   F C IC + F +  +L  H  T                                        P   K  +  +   QP  +  I  R  +  R + C+ C K++     L  H++ H +      C+ C K F+  R+++ H+RT H   R +SC  C   F   +SL  H  +H+  +P+ C +C + F
Sbjct:   21 SFTKGSDLKMHIRIHTGERPFSCDICNKGFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMRSHTGERPFTCDVCGKGFTISSYLKIHM-----RIHTGERPYSCDICNKGFVSSGALTGHMRTHTGEKPYSCKVCQKCFFQSSYLNIHMRI-HTGE----------RPYSCEICKKAFIYANSLTYHMRTHTGERHFTCEICQKDFMQSRDLKAHMGTHK-----DERPYS-----CKVCEKRFTHKSSLNVH-MRIH---TGETPFTCEVCGK----------------------IFSQRSKLKAHTRSHTGE------------------------KLFSCDICKKVFVSLRNLTCHMRTHTGERPYSCKVCLKRFTQTSCLNVHMRIHTGERPFTCKVCGKSLIKSSDLKIHMRTHTGERHLTCKLCQKGFRQSSALKAHMGTHTGERPYSCEVCEKQFSYKSSLNVHMRIHTGERPFTCEVCGKS------FTTGSDLKVHIETH--TAEKPFPCD--------ICKKAFASLRSFTCHMRTH-------TSLRPFTCKLCQKGFMQSRDLKIHMRIHTGERPYSCELCEKQFSYKSSLSVHIRTHTGERPFTCEVCGKTFSQRSKLKAHIRTHTAENP-FSCDICKKVFVSLRNLTCHMKTH-----------------------------------TGERPYSCK--VCQKCFIQPSHL-NIHMRIHTGERPYSCDICKKTFIHANRLTCHMRTH-TGERPFTCELCQKGFMDSRALKVHMRT-HTGERPYSCKVCEKNFAHNSSLKVHMRIHTGERPFTCEVCGKGF 722          

HSP 3 Score: 135.961 bits (341), Expect = 6.232e-32
Identity = 146/603 (24.21%), Postives = 247/603 (40.96%), Query Frame = 1
Query:  436 QNKYQYDNLDPTVYKTINGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAF----TYEHNMNTHIKV---IHKNGTEVLSQSQE---HLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAEN----------FIKLDWDKSHQGILLSED------VERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            +  + Y N      +T  G    TCEIC+ +F   R    HM  H+++R + C  C+  + ++ +L VH+ I HT E            + C +C  +FS++   +AH   H  ++   C+ C  +F     L  H+  H  GE             CK+C   F     +  H +R H   +G  P    +  K +  + +   +           + C   KL  +G  Q   +K  +     +R               +C VC K F     L  H   HTG + F C +C K FT  S +K+H+  H   K F C  C KAF    ++  +M TH  +     K   +   QS++   H+   + +     +    +F   +SL+   ++ + +   T  +  +       FS +   +++  ++  +AEN          F+ L     H      E        ++   +   + +H  I    TG R + C  C K +  +  LT H+R HT ++PF C +C K F     LK H ++H   + +SC++C K F    +LKVH ++H  ++  F C++C + F TG  L+ H  T
Sbjct:  187 KKAFIYANSLTYHMRTHTGERHFTCEICQKDFMQSRDLKAHMGTHKDERPYSCKVCEKRFTHKSSLNVHMRI-HTGE----------TPFTCEVCGKIFSQRSKLKAHTRSHTGEKLFSCDICKKVFVSLRNLTCHMRTH-TGE---------RPYSCKVCLKRFTQTSCLNVH-MRIH---TGERPFTCKVCGKSL--IKSSDLKIHMRTHTGERHLTC---KLCQKGFRQSSALKAHMGTHTGER-------------PYSCEVCEKQFSYKSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKVHIETHTAEKPFPCDICKKAFASLRSFTCHMRTHTSLRPFTCKLCQKGFMQSRDLKIHMRIHTGERPYSCELCEKQFSYKSSLSVHIRTHTGERPFTCEVCGKT------FSQRSKLKAHIRTH--TAENPFSCDICKKVFVSLRNLTCHMKTHTGERPYSCKVCQKCFIQPSHLNIHMRIH---TGERPYSCDICKKTFIHANRLTCHMRTHTGERPFTCELCQKGFMDSRALKVHMRTHTGERPYSCKVCEKNFAHNSSLKVHMRIHTGERP-FTCEVCGKGFTTGSDLKAHAGT 734          

HSP 4 Score: 130.954 bits (328), Expect = 2.579e-30
Identity = 125/518 (24.13%), Postives = 199/518 (38.42%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV----------IHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSA--ENFIKLDWDKSHQGILLSED------VERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRF----NTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDV----KPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            C +C K F     L  H  THTG + + C +C+K FTQ S + IHM  H   + F C  CGK FT    +  H+++          I   G         H+   + +     +     F + + L    +  + +   +  +  +     N  +Y     +    +      ++F++    K+H G    E        E+       + +H  I    T F    C  C K++ +   L  H R HT +K F C +C K F     L  H ++H   + +SC++C K F     L VH ++H  ++  F CK+C +      +   H+R H    H                 +    Q      +  T     P       K   +   LN       +  R  +  R F C  CGKS+     L  H++ H +A     C  C K+F + RS   H+RT H + R F+C  C   F+    L  H  +H+  +PY+C LC ++F  K     HI
Sbjct:   43 CDICNKGFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMRSHTGERPFTCDVCGKGFTISSYLKIHMRIHTGERPYSCDICNKGFVSSGALTGHMRTHTGEKPYSCKVCQKCFFQSSYLNIHMRIHTGERPYSCEICKKAFIYANSLTYHMRTHTGERHFTCEICQKDFMQSRDLKAHMGTHKDERPYSCKVCEKRFTHKSSLNVHMRIHTGETPF---TCEVCGKIFSQRSKLKAHTRSHTGEKLFSCDICKKVFVSLRNLTCHMRTHTGERPYSCKVCLKRFTQTSCLNVHMRIHTGERP-FTCKVCGKSLIKSSDLKIHMRTHTGERH-----------LTCKLCQKGFRQSSALKAHMGTHTGERPYSCEVCEKQFSYKSSLN-------VHMRIHTGERPFTCEVCGKSFTTGSDLKVHIETH-TAEKPFPCDICKKAFASLRSFTCHMRT-HTSLRPFTCKLCQKGFMQSRDLKIHMRIHTGERPYSCELCEKQFSYKSSLSVHI 536          

HSP 5 Score: 106.301 bits (264), Expect = 1.190e-22
Identity = 77/283 (27.21%), Postives = 123/283 (43.46%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAK 2679
            TG R F C  C K +  S  LT H+R HT ++P+ C +C KSF   S L  H +SH   + F+C++C K F +   LK+H ++H  ++  + C IC++ F +   L     T H R+     P   +                             K    +  LN       I  R  +  R + C  C K++ +   L  H++ H +      C+ C K F+  R ++ H+ T H + R +SC  C   F  K+SL  H  +H+   P+ C +C + F  +
Sbjct:   36 TGERPFSCDICNKGFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMRSHTGERPFTCDVCGKGFTISSYLKIHMRIHTGERP-YSCDICNKGFVSSGAL-----TGHMRTHTGEKPYSCKVCQ--------------------------KCFFQSSYLN-------IHMRIHTGERPYSCEICKKAFIYANSLTYHMRTH-TGERHFTCEICQKDFMQSRDLKAHMGT-HKDERPYSCKVCEKRFTHKSSLNVHMRIHTGETPFTCEVCGKIFSQR 277          

HSP 6 Score: 104.76 bits (260), Expect = 3.855e-22
Identity = 83/297 (27.95%), Postives = 125/297 (42.09%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKA----KIYCDRHISAK 2709
            TG R F C  C K + +S DL  H+  H  ++P+ C +C K F  KS L  H + H     F+CE+C KIF+ +  LK H + H  +KL F C IC + F +  +L     T H R+     P   +                            +K       LN       +  R  +  R F C  CGKS      L  H++ H    +   C+ C K F    +++ H+ T H   R +SC  C   F  K+SL  H  +H+  +P+ C +C + F      K++ + H + K
Sbjct:  204 TGERHFTCEICQKDFMQSRDLKAHMGTHKDERPYSCKVCEKRFTHKSSLNVHMRIHTGETPFTCEVCGKIFSQRSKLKAHTRSHTGEKL-FSCDICKKVFVSLRNL-----TCHMRTHTGERPYSCKVC--------------------------LKRFTQTSCLN-------VHMRIHTGERPFTCKVCGKSLIKSSDLKIHMRTHTGERHLT-CKLCQKGFRQSSALKAHMGT-HTGERPYSCEVCEKQFSYKSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKVHIETHTAEK 459          

HSP 7 Score: 100.138 bits (248), Expect = 1.063e-20
Identity = 82/317 (25.87%), Postives = 133/317 (41.96%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRF----NTGFHLRYHYSTSHHR-SIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPL---IWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLC----LRRFKAKIYC-----DRHISAKKCSKKKR 2730
            TG R F C  C K +  S  L  H+RIHT ++P+ C +C+K F     L  H ++H   K +SC++C K F     L +H ++H  ++  + C+IC + F    +  +H+R H    H    I   D                         A+     D +P    +  +       +  +  R  +    F C  CGK +  +  L  H + H +      C  C K FV+ R++  H+RT H   R +SC  C   F   + L  H  +H+  +P+ C +C    ++    KI+      +RH++ K C K  R
Sbjct:   92 TGERPFTCDVCGKGFTISSYLKIHMRIHTGERPYSCDICNKGFVSSGALTGHMRTHTGEKPYSCKVCQKCFFQSSYLNIHMRIHTGERP-YSCEICKKAFIYANSLTYHMRTHTGERHFTCEICQKD-----------------FMQSRDLKAHMGTHKDERPYSCKVCEKRFTHKSSL-NVHMRIHTGETPFTCEVCGKIFSQRSKLKAHTRSH-TGEKLFSCDICKKVFVSLRNLTCHMRT-HTGERPYSCKVCLKRFTQTSCLNVHMRIHTGERPFTCKVCGKSLIKSSDLKIHMRTHTGERHLTCKLCQKGFR 387          

HSP 8 Score: 89.3521 bits (220), Expect = 2.223e-17
Identity = 69/257 (26.85%), Postives = 107/257 (41.63%), Query Frame = 1
Query: 1915 TQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDV--KPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAK 2679
            + ++PF C +C KSF   S LK H + H   + FSC+ICNK F     L  H + H  ++  + CK+C + F    +L  H      RS     P                +      T       D+  K  + +  L   +       R  +  + + C  C K +    YLN H++ H +      C+ C K+F+   S+  H+RT H   R F+C  C   F+    L  H   H + +PY+C +C +RF  K
Sbjct:    8 SSERPFTCEVCGKSFTKGSDLKMHIRIHTGERPFSCDICNKGFINSGALTCHMRTHTGERP-YSCKVCQKSFTQSSYLNIHM-----RSHTGERPFTCDVCGKGFTISSYLKIHMRIHTGERPYSCDICNKGFVSSGALTGHM-------RTHTGEKPYSCKVCQKCFFQSSYLNIHMRIH-TGERPYSCEICKKAFIYANSLTYHMRT-HTGERHFTCEICQKDFMQSRDLKAHMGTHKDERPYSCKVCEKRFTHK 249          

HSP 9 Score: 71.633 bits (174), Expect = 6.638e-12
Identity = 39/96 (40.62%), Postives = 51/96 (53.12%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKIC 2118
            TG R F C  C K +  S  L  H+R HT ++P+ C +C K+F   S LK H + H   + F+CE+C K F     LK H   H  +KL F C IC
Sbjct:  652 TGERPFTCELCQKGFMDSRALKVHMRTHTGERPYSCKVCEKNFAHNSSLKVHMRIHTGERPFTCEVCGKGFTTGSDLKAHAGTHTAEKL-FPCDIC 746          

HSP 10 Score: 70.8626 bits (172), Expect = 9.736e-12
Identity = 75/300 (25.00%), Postives = 110/300 (36.67%), Query Frame = 1
Query:  505 TCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFC 1404
            TC++C+  F   R    HM IH  +R + C  C+  ++Y+ +L VHI   HT E            + C +C   FS++   +AH   H  +    C+ C  +F     L  H+  H  GE             CK+C   F    ++  H +R H   +G  P    +  K    +                   C+  +     +  +D     V+       RP             C VC K F     L+ H   HTG + F C +C KGFT  S +K H   H   K F C  C
Sbjct:  490 TCKLCQKGFMQSRDLKIHMRIHTGERPYSCELCEKQFSYKSSLSVHIRT-HTGE----------RPFTCEVCGKTFSQRSKLKAHIRTHTAENPFSCDICKKVFVSLRNLTCHMKTH-TGE---------RPYSCKVCQKCFIQPSHLNIH-MRIH---TGERPYSCDICKKTF--IHANRLTCHMRTHTGERPFTCELCQ-----KGFMDSRALKVHMRTHTGERPYS-----------CKVCEKNFAHNSSLKVHMRIHTGERPFTCEVCGKGFTTGSDLKAHAGTHTAEKLFPCDIC 746          

HSP 11 Score: 63.5438 bits (153), Expect = 1.930e-9
Identity = 61/258 (23.64%), Postives = 91/258 (35.27%), Query Frame = 1
Query: 1999 WKL------KEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRF-NTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQ---------------------------HLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            WK       + F+CE+C K F     LK+H ++H  ++  F C IC++ F N+G        T H R+     P   +                             K    +  LN       I  R  +  R F C+ CGK +    YL  H++ H +      C  CNK FV+  ++  H+RT                            H   R +SC  C   FI   SL  H   H+  + + C +C + F
Sbjct:    2 WKWERSSSERPFTCEVCGKSFTKGSDLKMHIRIHTGERP-FSCDICNKGFINSG------ALTCHMRTHTGERPYSCKVCQ--------------------------KSFTQSSYLN-------IHMRSHTGERPFTCDVCGKGFTISSYLKIHMRIH-TGERPYSCDICNKGFVSSGALTGHMRTHTGEKPYSCKVCQKCFFQSSYLNIHMRIHTGERPYSCEICKKAFIYANSLTYHMRTHTGERHFTCEICQKDF 218          

HSP 12 Score: 59.3066 bits (142), Expect = 3.908e-8
Identity = 28/75 (37.33%), Postives = 40/75 (53.33%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIK 1449
            C VCGK+F     L+ H   HTG + F C IC KGF    ++  HM  H   + + C+ C K+FT    +N H++
Sbjct:   15 CEVCGKSFTKGSDLKMHIRIHTGERPFSCDICNKGFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMR 89          

HSP 13 Score: 58.5362 bits (140), Expect = 6.235e-8
Identity = 37/108 (34.26%), Postives = 48/108 (44.44%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVD 4560
            PYSC IC K F  A+ L  H+  HT  RP+ C  C K F    +LK H  T         +         S  +L+ H+++H  E    C+VC KGF    DL  H  
Sbjct:  628 PYSCDICKKTFIHANRLTCHMRTHTGERPFTCELCQKGFMDSRALKVHMRTHTGERPYSCKVCEKNFAHNS--SLKVHMRIHTGERPFTCEVCGKGFTTGSDLKAHAG 733          

HSP 14 Score: 58.5362 bits (140), Expect = 6.846e-8
Identity = 43/132 (32.58%), Postives = 59/132 (44.70%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHR----CSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGF----DLQEDLSRHVDEKHAASSSCIEGLPEG 4608
            PYSC +C K F + S+L  H+ +HT  RPY C  C K F H     C ++TH   +  +        LC K      AL+ H++ H  E    CKVC K F     L+  +  H  E+      C +G   G
Sbjct:  600 PYSCKVCQKCFIQPSHLNIHMRIHTGERPYSCDICKKTFIHANRLTCHMRTHTGERPFTC------ELCQKGFMDSRALKVHMRTHTGERPYSCKVCEKNFAHNSSLKVHMRIHTGERPFTCEVCGKGFTTG 725          

HSP 15 Score: 56.225 bits (134), Expect = 3.211e-7
Identity = 33/107 (30.84%), Postives = 53/107 (49.53%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            P++C +C KGF ++ +L+ H+ +HT  RPY C  C K+F ++ SL  H  T                  RS+  L+ H++ H  E    C +C K F    +L+ H+
Sbjct:  488 PFTCKLCQKGFMQSRDLKIHMRIHTGERPYSCELCEKQFSYKSSLSVHIRTHTGERPFTCEVCGKTFSQRSK--LKAHIRTHTAENPFSCDICKKVFVSLRNLTCHM 592          

HSP 16 Score: 56.225 bits (134), Expect = 3.408e-7
Identity = 34/111 (30.63%), Postives = 51/111 (45.95%), Query Frame = 1
Query: 2368 SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            S+ R F C  CGKS+     L  H++ H +      C  CNK F+   ++  H+RT H   R +SC  C   F   + L  H   H+  +P+ C +C + F    Y   H+
Sbjct:    8 SSERPFTCEVCGKSFTKGSDLKMHIRIH-TGERPFSCDICNKGFINSGALTCHMRT-HTGERPYSCKVCQKSFTQSSYLNIHMRSHTGERPFTCDVCGKGFTISSYLKIHM 116          

HSP 17 Score: 55.4546 bits (132), Expect = 4.786e-7
Identity = 60/271 (22.14%), Postives = 96/271 (35.42%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHS-----------------SVTXXXXXXXXXXXXXSQVALRN---------HLKLHVREYSVHCKVCYKGF----DLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            PYSC +C K F   S+L  H+ +HT   P+ C  C K F  R  LK H  +                    ++T  +R H   +    +V L+          H+++H  E    CKVC K      DL+  +  H  E+H     C +G  +       + +                         ++   C  C   F+ K+  + H  +    E+      C K+F + S    H+ E H     + C  C   FA   S+  H ++
Sbjct:  236 PYSCKVCEKRFTHKSSLNVHMRIHTGETPFTCEVCGKIFSQRSKLKAHTRSHTGEKLFSCDICKKVFVSLRNLTCHMRTHTGERPYSCKVCLKRFTQTSCLNVHMRIHTGERPFTCKVCGKSLIKSSDLKIHMRTHTGERHLTCKLCQKGFRQSSALKAHMGT----------------------HTGERPYSCEVCEKQFSYKSSLNVHMRIHT-GERPFTCEVCGKSFTTGSDLKVHI-ETHTAEKPFPCDICKKAFASLRSFTCHMRT 482          

HSP 18 Score: 54.6842 bits (130), Expect = 8.382e-7
Identity = 39/124 (31.45%), Postives = 60/124 (48.39%), Query Frame = 1
Query: 3517 LQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            L+ H  I   +  + C  C+ QF    SL  H+++ H   R FTC VC K FS +  L AH +TH     F C +   C + F+S+ +L+ H  M+ +     Y C  C K +     L+ H++
Sbjct:  504 LKIHMRIHTGERPYSCELCEKQFSYKSSLSVHIRT-HTGERPFTCEVCGKTFSQRSKLKAHIRTHTAENPFSCDI---CKKVFVSLRNLTCH--MKTHTGERPYSCKVCQKCFIQPSHLNIHMR 621          

HSP 19 Score: 54.6842 bits (130), Expect = 8.454e-7
Identity = 35/111 (31.53%), Postives = 53/111 (47.75%), Query Frame = 1
Query: 3556 HGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            + C  C   F  + SL  H+++ H   R FTC +C K F     L AH  TH D R + C V   C +RF    SL+ H+R+   +    + C  C K++    +L +H +
Sbjct:  181 YSCEICKKAFIYANSLTYHMRT-HTGERHFTCEICQKDFMQSRDLKAHMGTHKDERPYSCKV---CEKRFTHKSSLNVHMRIHTGE--TPFTCEVCGKIFSQRSKLKAHTR 285          

HSP 20 Score: 53.1434 bits (126), Expect = 2.592e-6
Identity = 31/107 (28.97%), Postives = 49/107 (45.79%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            P++C +C K F + S+L+ H+ +HT  RP+ C  C K F +  +L  H  T         +         S + +  H++ H  E    C VC KGF +   L  H+
Sbjct:   12 PFTCEVCGKSFTKGSDLKMHIRIHTGERPFSCDICNKGFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNI--HMRSHTGERPFTCDVCGKGFTISSYLKIHM 116          

HSP 21 Score: 53.1434 bits (126), Expect = 2.637e-6
Identity = 38/107 (35.51%), Postives = 51/107 (47.66%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            PYSC +C K F+  S+L  H+ +HT  RP+ C  C K F     LK H  T   +  K   C +C K   S  +   H++ H       CK+C KGF    DL  H+
Sbjct:  404 PYSCEVCEKQFSYKSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKVHIETH--TAEKPFPCDICKKAFASLRSFTCHMRTHTSLRPFTCKLCQKGFMQSRDLKIHM 508          

HSP 22 Score: 51.9878 bits (123), Expect = 5.856e-6
Identity = 34/111 (30.63%), Postives = 53/111 (47.75%), Query Frame = 1
Query: 3556 HGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            + C  C   F  S  L  H++S H   R FTC+VC K F+    L  H + H   R + C +   CN+ F+S  +L+ H+R    +    Y C  C K +  +  L+ H++
Sbjct:   69 YSCKVCQKSFTQSSYLNIHMRS-HTGERPFTCDVCGKGFTISSYLKIHMRIHTGERPYSCDI---CNKGFVSSGALTGHMRTHTGE--KPYSCKVCQKCFFQSSYLNIHMR 173          

HSP 23 Score: 51.6026 bits (122), Expect = 7.553e-6
Identity = 36/111 (32.43%), Postives = 53/111 (47.75%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSL----KTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            PYSC +C K F ++S L  H+ +HT  RPY C  C K F +  SL    +TH   +H +     +  +  +       L+ H+  H  E    CKVC K F  +  L+ H+
Sbjct:  152 PYSCKVCQKCFFQSSYLNIHMRIHTGERPYSCEICKKAFIYANSLTYHMRTHTGERHFTCEICQKDFMQSRD------LKAHMGTHKDERPYSCKVCEKRFTHKSSLNVHM 256          
BLAST of Zinc finger, C2H2 type vs. Ensembl Medaka
Match: ENSORLT00000027602.1 (pep primary_assembly:ASM223467v1:2:11815178:11931414:1 gene:ENSORLG00000027982.1 transcript:ENSORLT00000027602.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.058 bits (375), Expect = 1.624e-36
Identity = 151/548 (27.55%), Postives = 220/548 (40.15%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPS-AENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNEL---LNQPIPIAEIDKRKLSNNRL---FKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA---------KKCSKKKRNRFQQNDLMTGIINRNPIGSLTNQIGQSDL 2820
            C  C  +FKT   L+ H  THTG K F C  C K F +KS +K HM +H   K F CQ C   F+   ++ THI +IH                                +K  S  E N+S  + + + +++     T E  F  Q   + +T   + S  E  ++    +      L    E  DK        E      TG + F C+ C K + +   L RH+R HT +KPF C  C KS+   S LK H  +H   K FSCE C+  F+    LK+H + H  +K  F CK CDR F+  F L+ H      R+     P   +        L      KN    ++      KP   NE     +Q   +    +     N +   + C  CGKS+ +  +   H++ H+  NN   C+ C+ SF     ++ H+RT H   + FSC +C   F    +L  H  +H+  KP++C  C  RF+   +   H+           K+C K     F     M       P       IG SDL
Sbjct:   32 CQECETSFKTKSSLKVHMKTHTGEKPFSCKECDKCFCEKSHLKRHMRIHTGEKPFSCQECDTRFSRISSLKTHI-IIHTG------------------------------EKPFSCKECNKSFREKSHLKRHMRTH--TGEKPFCCQ---ECDTSFSLKSHLETHMRTHTGEKPFSCQLFSCTE-CDKSFCAKSYLERHMRSHTGEKLFSCKECDKGFGQISHLKRHMRTHTGEKPFACLECDKSYGDASTLKYHMTTHTGEKPFSCEECDACFSRVSGLKIHMRTHTGEKP-FSCKECDRSFSHVFSLKIHM-----RTHTGERPFSCKECDKRFSQLSTL---KNHIRTHTGE----KPFSCNECDSSFSQKSNLKTHMRTHTGENLIKKPYDCKECGKSFSWWSHFRVHMRTHI-GNNPFSCEECDTSFSRLSHLKAHMRT-HTGEKPFSCKECDTSFSDMHNLKAHMRIHTGEKPFSCEKCETRFRRLSHLKAHMRTHTGEKPFLCKECDKSFGQIFGLRRHMRTHTGEKPFSCKVCDIGFSDL 527          

HSP 2 Score: 131.339 bits (329), Expect = 8.485e-31
Identity = 166/723 (22.96%), Postives = 274/723 (37.90%), Query Frame = 1
Query:  526 EFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPI---EDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDE-MKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV-----------IHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYAC 2649
            +FP     + HM  H  ++ F C  C+ S+  + +L VH+   HT E            + C  C   F  K   + H  IH  ++   C+ C   F     L  H+  H  GE+            CK C+  F    ++K+H +R H   +G  P    E          + T +              +C         +S L+  M+      +                  +C  C K F     L+RH  THTG K F C  C K +   S++K HM  H   K F C+ C   F+    +  H++              ++ + V S  + H+   + +     ++   RF ++++L    ++ + +   +    NE  ++   FS + N +++  ++  + EN IK  +D    G   S             ++H  ++  + G   F C  C   + +   L  H+R HT +KPF C  C  SF     LK H + H   K FSCE C   F     LK H + H  +K  F+CK CD+ F   F LR H  T                                  T        V  + +++L N    +     R  +  + + C  C  S+    +L  H++ H + +    C+ C+KS+     +++H+RT H   + FSC +C   F   +SL RH   H+   P++C
Sbjct:   10 KFPRVDVKILHMRSHTGEKPFSCQECETSFKTKSSLKVHMKT-HTGE----------KPFSCKECDKCFCEKSHLKRHMRIHTGEKPFSCQECDTRFSRISSLKTHIIIH-TGEK---------PFSCKECNKSFREKSHLKRH-MRTH---TGEKPFCCQECDTSFSLKSHLETHMRTHTGEKPFSCQLFSCTECDKSFCAKSYLERHMRSHTGEKL-----------------FSCKECDKGFGQISHLKRHMRTHTGEKPFACLECDKSYGDASTLKYHMTTHTGEKPFSCEECDACFSRVSGLKIHMRTHTGEKPFSCKECDRSFSHVFSL-KIHMRTHTGERPFSCKECDKRFSQLSTLKNHIRTHTGEKPFS---CNECDSS---FSQKSNLKTHMRTH--TGENLIKKPYDCKECGKSFSW--------WSHFRVH--MRTHI-GNNPFSCEECDTSFSRLSHLKAHMRTHTGEKPFSCKECDTSFSDMHNLKAHMRIHTGEKPFSCEKCETRFRRLSHLKAHMRTHTGEKP-FLCKECDKSFGQIFGLRRHMRTH---------------------------------TGEKPFSCKVCDIGFSDLYNLKAHM-----RTHTGEKPYSCEECDTSFSRLFHLKTHMRTH-TGDKPFSCKECDKSYYVKSHLKRHIRT-HTGEKVFSCKECDRGFSQMSSLKRHMKAHTADVPFSC 629          

HSP 3 Score: 113.235 bits (282), Expect = 5.649e-25
Identity = 124/540 (22.96%), Postives = 204/540 (37.78%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQS-----------------QEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAEN----FIKLDWDKSHQGILLSE---DVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWK----LKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPL------IWNELLNQPIPIAEIDK------------RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISA 2706
            C  C   F     L+ H + HTG K F C  C K F +KS +K HM  H   K F CQ C  +F+ + ++ TH++     G +  S                   + H+ + + +     ++    F +I+ L    ++ + +        +++  + +   Y     +    +  S E     F ++   K H      E     +  D+    +   ++     TG R F C+ C K + +   L  HIR HT +KPF C  C  SF  KS LK H ++H       K + C+ C K F+     +VH + H  +   F C+ CD  F+   HL+ H  T       +          + +           KP +        + L      +      +P    E DK            R  +  + F C  C   +     L  H++ H +      C+ C+ SF     ++ H+RT H   + FSC +C   +  K+ L RH   H+  K ++C  C R F       RH+ A
Sbjct:   88 CQECDTRFSRISSLKTHIIIHTGEKPFSCKECNKSFREKSHLKRHMRTHTGEKPFCCQECDTSFSLKSHLETHMRT--HTGEKPFSCQLFSCTECDKSFCAKSYLERHMRSHTGEKLFSCKECDKGFGQISHLKRHMRTHTGEKPFACLECDKSYGDASTLKYHMTTHTGEKPF--SCEECDACFSRVSGLKIHMRTHTGEKPFSCKECDRSFSHVFSLKIHMRTHTGERPFSCKECDKRFSQLSTLKNHIRTHTGEKPFSCNECDSSFSQKSNLKTHMRTHTGENLIKKPYDCKECGKSFSWWSHFRVHMRTHIGNNP-FSCEECDTSFSRLSHLKAHMRTHTGEKPFSCKECDTSFSDMHNLKAHMRIHTGEKPFSCEKCETRFRRLSHLKAHMRTHTGEKPFLCKECDKSFGQIFGLRRHMRTHTGEKPFSCKVCDIGFSDLYNLKAHMRTH-TGEKPYSCEECDTSFSRLFHLKTHMRT-HTGDKPFSCKECDKSYYVKSHLKRHIRTHTGEKVFSCKECDRGFSQMSSLKRHMKA 620          

HSP 4 Score: 102.449 bits (254), Expect = 1.453e-21
Identity = 79/269 (29.37%), Postives = 123/269 (45.72%), Query Frame = 1
Query: 1858 FCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIP--IAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLC 2658
            +CYK  R    +  H+R HT +KPF C  C  SF+ KS LK H K+H   K FSC+ C+K F  K  LK H ++H  +K  F C+ CD RF+    L+ H        I +    P           ++    ++  T     P   +    +  L   +   +      K  + +LF C  C KS+  K YL  H++ H +      C+ C+K F     +++H+RT H   + F+CL+C   +   ++L  H   H+  KP++C  C
Sbjct:    7 YCYKFPRVDVKIL-HMRSHTGEKPFSCQECETSFKTKSSLKVHMKTHTGEKPFSCKECDKCFCEKSHLKRHMRIHTGEKP-FSCQECDTRFSRISSLKTHI-------IIHTGEKPFSCKECNKSFREKSHLKRHMRTHTGEKPFCCQECDTSFSLKSHLETHMRTHTGEKPFSCQLFSCTECDKSFCAKSYLERHMRSH-TGEKLFSCKECDKGFGQISHLKRHMRT-HTGEKPFACLECDKSYGDASTLKYHMTTHTGEKPFSCEEC 264          

HSP 5 Score: 88.5817 bits (218), Expect = 2.609e-17
Identity = 145/588 (24.66%), Postives = 213/588 (36.22%), Query Frame = 1
Query:  505 TCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNE----CTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGE------ECDDRKLTTNYLK-------------CKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDN----VKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSED---VERIDKETGQI-QLHEMIKDQVTGFRRFRCRFC----YKLYR----------------KSCD--------LTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPD 2091
            +C+ C   F  K    +HM  H  ++ F C  C  S++ + +L  H+   HT E    C +         + C  C   F  K   + H   H  ++   C+ C   F     L +H+  H  GE      ECD      + LK             C+ C   F  V  +K H +R H   +G  P       K  +R  + +                    L    R+   E             RP             C  C K F     L+ H  THTG K F C  C   F+QKS++K HM  H       K + C+ CGK+F++  +   H++     G    S  +E   + S     +     +  +K  S  E + S SD   +  ++     T E  FS +                F +L   K+H      E     +  DK  GQI  L   ++   TG + F C+ C      LY                 + CD        L  H+R HT  KPF C  C KS+ +KS LK H ++H   K FSC+ C++ F+   +LK H + H  D
Sbjct:  115 SCKECNKSFREKSHLKRHMRTHTGEKPFCCQECDTSFSLKSHLETHMRT-HTGEKPFSCQL---------FSCTECDKSFCAKSYLERHMRSHTGEKLFSCKECDKGFGQISHLKRHMRTH-TGEKPFACLECDKSYGDASTLKYHMTTHTGEKPFSCEECDACFSRVSGLKIH-MRTH---TGEKPFS----CKECDRSFSHV------------------FSLKIHMRTHTGE-------------RPFS-----------CKECDKRFSQLSTLKNHIRTHTGEKPFSCNECDSSFSQKSNLKTHMRTHTGENLIKKPYDCKECGKSFSWWSHFRVHMRT--HIGNNPFS-CEECDTSFSRLSHLKAHMRTHTGEKPFSCKECDTSFSDMHNLKAHMRIH--TGEKPFSCEK-----------CETRFRRLSHLKAHMRTHTGEKPFLCKECDKSFGQIFGLRRHMRTH-TGEKPFSCKVCDIGFSDLYNLKAHMRTHTGEKPYSCEECDTSFSRLFHLKTHMRTHTGDKPFSCKECDKSYYVKSHLKRHIRTHTGEKVFSCKECDRGFSQMSSLKRHMKAHTAD 624          

HSP 6 Score: 70.8626 bits (172), Expect = 7.721e-12
Identity = 79/325 (24.31%), Postives = 116/325 (35.69%), Query Frame = 1
Query:  478 KTINGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            +T  G    +C+ C+  F    T   H+  H  ++ F C+ C  S++ + NL  H+   HT E  +         Y C  C   FS     + H   H  +    CE C   F     L  H+  H  GE+            CK C   F ++ N+K            H  I  G      E+  T                  +   L A  R+   E KP +                       C  C K+F     LRRH  THTG K F C +C  GF+   ++K HM  H   K + C+ C  +F+   ++ TH++ 
Sbjct:  307 RTHTGERPFSCKECDKRFSQLSTLKNHIRTHTGEKPFSCNECDSSFSQKSNLKTHMRT-HTGENLIKKP------YDCKECGKSFSWWSHFRVHMRTHIGNNPFSCEECDTSFSRLSHLKAHMRTH-TGEK---------PFSCKECDTSFSDMHNLK-----------AHMRIHTGEKPFSCEKCETRFR---------------RLSHLKAHMRTHTGE-KPFL-----------------------CKECDKSFGQIFGLRRHMRTHTGEKPFSCKVCDIGFSDLYNLKAHMRTHTGEKPYSCEECDTSFSRLFHLKTHMRT 564          

HSP 7 Score: 62.7734 bits (151), Expect = 2.630e-9
Identity = 35/122 (28.69%), Postives = 61/122 (50.00%), Query Frame = 1
Query: 2335 IPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            + +  +  R  +  + F C  C  S+K K  L  H+K H +      C+ C+K F     +++H+R  H   + FSC +C   F   +SL  H ++H+  KP++C  C + F+ K +  RH+
Sbjct:   14 VDVKILHMRSHTGEKPFSCQECETSFKTKSSLKVHMKTH-TGEKPFSCKECDKCFCEKSHLKRHMRI-HTGEKPFSCQECDTRFSRISSLKTHIIIHTGEKPFSCKECNKSFREKSHLKRHM 133          

HSP 8 Score: 58.5362 bits (140), Expect = 5.587e-8
Identity = 89/392 (22.70%), Postives = 137/392 (34.95%), Query Frame = 1
Query:  451 YDNLDPTVYKTINGTGKQ--TCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNE----CTV--------------VNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQ----VDEELPCEHCPALFKCKVLLDKHLNDHKIG------EECDDRKLTTNYLK-------------CKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKR-----GRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLS 1482
            Y +     Y     TG++  +CE C+  F        HM  H  ++ F C  C  S+++  +L +H+   HT E    C                +     E  + C  C   FS+K   + H   H     + +   C+ C   F        H+  H IG      EECD      ++LK             CK C   F ++ N+K            H  I  G      E+  T                  +   L A  R+   E KP + +   K      G  +     + +   +C VC   F     L+ H  THTG K + C  C   F++   +K HM  H   K F C+ C K++  + ++  HI+     G +V S
Sbjct:  240 YGDASTLKYHMTTHTGEKPFSCEECDACFSRVSGLKIHMRTHTGEKPFSCKECDRSFSHVFSLKIHMR-THTGERPFSCKECDKRFSQLSTLKNHIRTHTGEKPFSCNECDSSFSQKSNLKTHMRTHTGENLIKKPYDCKECGKSFSWWSHFRVHMRTH-IGNNPFSCEECDTSFSRLSHLKAHMRTHTGEKPFSCKECDTSFSDMHNLK-----------AHMRIHTGEKPFSCEKCETRFR---------------RLSHLKAHMRTHTGE-KPFLCKECDKSFGQIFGLRRHMRTHTGEKPFSCKVCDIGFSDLYNLKAHMRTHTGEKPYSCEECDTSFSRLFHLKTHMRTHTGDKPFSCKECDKSYYVKSHLKRHIRT--HTGEKVFS 600          

HSP 9 Score: 56.9954 bits (136), Expect = 1.609e-7
Identity = 38/122 (31.15%), Postives = 53/122 (43.44%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQV-ALRNHLKLHVREYSVHCKVCYKGF----DLQEDLSRHVDEKHAASSSC 4587
            P+SC  C   F+   NL+ H+ +HT  +P+ C KC  RFR    LK H  T      +             Q+  LR H++ H  E    CKVC  GF    +L+  +  H  EK  +   C
Sbjct:  430 PFSCKECDTSFSDMHNLKAHMRIHTGEKPFSCEKCETRFRRLSHLKAHMRT---HTGEKPFLCKECDKSFGQIFGLRRHMRTHTGEKPFSCKVCDIGFSDLYNLKAHMRTHTGEKPYSCEEC 548          

HSP 10 Score: 56.225 bits (134), Expect = 3.156e-7
Identity = 34/107 (31.78%), Postives = 49/107 (45.79%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            P+SC +C  GF+   NL+ H+  HT  +PY C +C   F     LKTH  T         +       ++S   L+ H++ H  E    CK C +GF     L RH+
Sbjct:  514 PFSCKVCDIGFSDLYNLKAHMRTHTGEKPYSCEECDTSFSRLFHLKTHMRTHTGDKPFSCKECDKSYYVKSH--LKRHIRTHTGEKVFSCKECDRGFSQMSSLKRHM 618          

HSP 11 Score: 53.9138 bits (128), Expect = 1.528e-6
Identity = 61/263 (23.19%), Postives = 103/263 (39.16%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYS---------VHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPE------------GRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 4950
            P+SC  C   F+R S+L+ H+ +HT  +P+ C +C K FR +  LK H        T       C +   +  +L++HL+ H+R ++           C  C K F  +  L RH+     EK  +   C +G  +            G KP   L    ++      +        +     +K   C  C   F+  +    H       EK    + CD++F        H++  H     ++C +C+  F+Q S+  NH
Sbjct:   85 PFSCQECDTRFSRISSLKTHIIIHTGEKPFSCKECNKSFREKSHLKRHMR------THTGEKPFCCQECDTSFSLKSHLETHMRTHTGEKPFSCQLFSCTECDKSFCAKSYLERHMRSHTGEKLFSCKECDKGFGQISHLKRHMRTHTGEKPFACLECDKSYGDASTLKY------HMTTHTGEKPFSCEECDACFSRVSGLKIHM-RTHTGEKPFSCKECDRSFSHVFSLKIHMR-THTGERPFSCKECDKRFSQLSTLKNH 333          

HSP 12 Score: 53.5286 bits (127), Expect = 1.843e-6
Identity = 58/243 (23.87%), Postives = 91/243 (37.45%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAG--ELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            P+SC  C K F   S+L++H+ +HT  +P+ C +C  RF    SLKTH            +        +S   L+ H++ H  E    C+ C   F L+  L  H+                G KP      S T            ++ ++    E   KL  C  C   F   +    H       EK      CDK++   S   YH+   H     ++C +C+  F++ S    H ++
Sbjct:   57 PFSCKECDKCFCEKSHLKRHMRIHTGEKPFSCQECDTRFSRISSLKTHIIIHTGEKPFSCKECNKSFREKSH--LKRHMRTHTGEKPFCCQECDTSFSLKSHLETHMR------------THTGEKPFSCQLFSCTECDKSFCAKSYLERHMRSHTGE---KLFSCKECDKGFGQISHLKRHM-RTHTGEKPFACLECDKSYGDASTLKYHMT-THTGEKPFSCEECDACFSRVSGLKIHMRT 280          

HSP 13 Score: 53.5286 bits (127), Expect = 1.940e-6
Identity = 42/156 (26.92%), Postives = 70/156 (44.87%), Query Frame = 1
Query:  433 NQNKYQYDNLDPTVYKTINGTGKQ--TCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGE------ECD 876
            N+  Y++  +D  +    + TG++  +C+ CE  F +K +   HM  H  ++ F C  C   +  + +L  H+ I HT E            + C  C   FSR  + + H +IH  ++   C+ C   F+ K  L +H+  H  GE      ECD
Sbjct:    5 NEYCYKFPRVDVKILHMRSHTGEKPFSCQECETSFKTKSSLKVHMKTHTGEKPFSCKECDKCFCEKSHLKRHMRI-HTGE----------KPFSCQECDTRFSRISSLKTHIIIHTGEKPFSCKECNKSFREKSHLKRHMRTH-TGEKPFCCQECD 148          
BLAST of Zinc finger, C2H2 type vs. Ensembl Medaka
Match: ENSORLT00000033373.1 (pep primary_assembly:ASM223467v1:17:11165735:11271835:-1 gene:ENSORLG00000007097.2 transcript:ENSORLT00000033373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.599 bits (379), Expect = 2.672e-36
Identity = 181/746 (24.26%), Postives = 284/746 (38.07%), Query Frame = 1
Query:  505 TCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKP-VERVPTPIXXXXXXXXXXXXXIAC-----QTIKLYAQGRSQLDE--MKPDVNRSI--SKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSA--ENFIKLDWDKSHQGI-----LLSEDVER-----IDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDV--KPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            +CEIC+    S R    HM IH  +R F C  C  S+    +L +HI I HT E            + C IC+  F    A   H   H  +    C+ C   F     L+ H+  H  GE             C IC   F +  ++  H +R H   +G  P    +  K  ++     +     + +R      C     Q+ KL A  R+         D+ + +  S R         + +   +C VC K F  P  L  H   HTG + + C ICKK F   S +  HM +H   + + C+ C K FT    +  H++ IH      L     H+   + +     +    RF + +SL    +  + +   T  +  ++ T            +    Y      ++F +    K H  I     L + +V R     +   T  ++ H       T  R F C+ C K + +S DL  H+RIHT ++P+ C +C K F  KS L  H  +H   + F+CE+C K F+ +  LK H + H  +   F+C IC + F +  +L YH  T          P   +                   T       D+  K  I+   L           R  +  R + C  C K + +K   N H++ H +      C+ C KSF     ++ H+ T H   + F C  C   F +  +L  H   H+  + + C LC + F
Sbjct:   73 SCEICKKVLISLRNLTYHMRIHTGERPFTCEVCGKSFTKGSDLKMHIRI-HTGE----------RPFSCDICNKGFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMRSH-TGER---------PYSCDICKKTFIHANSLTYH-MRTH---TGERPYSCKLCQKGFLQSKDLKVHMRTHTGERPFICEVCGKNFLQSTKLKAHIRTHTATKLFSCDICKKVFVSLRNLTYHMKTHTGERPYSCKVCQKCFIQPSHLNIHMRLHTGERPYSCDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCFTQSSCLIVHMR-IHTVFVS-LRNLTYHMKTHTGERPYSCKICLKRFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGRDLKAHMRTHTGEKPYSCKVCEKHFTQKYSLKVHMRIHTGERLFTCEVCRKFFASLRNLTCHVRTH-------TSLRPFTCQLCQKGFMQSRDLKIHMRIHTGERPYSCEVCEKQFSYKSSLNIHMGTHTGERPFTCEVCGKNFSQRSKLKAHIRTHTAEN-PFLCDICKKVFVSLRNLTYHMKTH-----TGERPYSCKVCQKCFIQPSHLNIHMRTHTGERPYSCDICKKSFIYANRLT-------CHMRTHTGERPYACEVCEKQFSYKSSFNVHMRIH-TGERPFTCEVCGKSFTRGSDLKAHIGT-HTTEKLFPCKMCKKVFASFRNLTCHMRTHTGLRHFTCELCQKGF 769          

HSP 2 Score: 148.673 bits (374), Expect = 1.071e-35
Identity = 189/854 (22.13%), Postives = 314/854 (36.77%), Query Frame = 1
Query:  193 SFINNSNVFQTVEDDCGEIYYACIGANDNDINHQDQVLQLIPQNQISNYI--ISDKDYSNVTYVNESVINGTNYYDSQNTTYNQNKYQYDNLDPTVYKTINGTGKQ--TCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHI------AIIHTNECTVVNDS-----------NQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQT-IKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSH------QGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            SF   S++   +    GE  ++C   N   IN       +        Y   +  K ++  +Y+N   I+  ++   +  + +  K  + + +   Y     TG++  +C++C+  F   +    HM  H  +R F C  C  ++     L  HI       +   + C  V  S             E  Y C +C   F +      H  +H  +    C+ C   F     L  H+  H  GE             CK+C   F     +  H +R H        +   M     ER                   +C+  +K + Q  S       +V+  I    RP             C VCGK+F T   L+ H  THTG K + C +C+K FTQK S+K+HM +H   + F C+ C K F    N+  H++  H +      Q  +    +S            R  KI     T + P    E+ +  ++   +   H       +  T       +NF +    K+H      +   L +  +++      +  H  +K   TG R + C+ C K + +   L  H+R HT ++P+ C +C KSF   + L  H ++H   + ++CE+C K F+ K +  VH ++H  ++  F C++C + F  G  L+ H  T                                  T     P  +   ++    N    +     R  +  R F C  C K +   + LN H++ H        C+ C K F    S+  H+R  H   R F+C  C   F T + L  H   H+  K + C +C + F
Sbjct:  108 SFTKGSDLKMHIRIHTGERPFSCDICNKGFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLN---IHMRSHTGERPYSCDICKKTFIHANSLTYHMRTHTGERPYSCKLCQKGFLQSKDLKVHMRTHTGERPFICEVCGKNFLQSTKLKAHIRTHTATKLFSCDICKKVFVSLRNLTYHMKTHTGERPYSCKVCQKCFIQPSHLNIHMRLHTGERPYSCDICKKTFIHASRLTYHMRIH-TGER---------PYSCKVCQKCFTQSSCLIVH-MRIHTVFVSLRNLTYHMKTHTGER-----------------PYSCKICLKRFTQKSSL------NVHMRIHTGERPFT-----------CEVCGKSFTTGRDLKAHMRTHTGEKPYSCKVCEKHFTQKYSLKVHMRIHTGERLFTCEVCRKFFASLRNLTCHVRT-HTSLRPFTCQLCQKGFMQS------------RDLKIHMRIHTGERPYS-CEVCEKQFSYKSSLNIHMGTHTGERPFTCEVC--GKNFSQRSKLKAHIRTHTAENPFLCDICKKVFVSLRNLTYH--MKTH-TGERPYSCKVCQKCFIQPSHLNIHMRTHTGERPYSCDICKKSFIYANRLTCHMRTHTGERPYACEVCEKQFSYKSSFNVHMRIHTGER-PFTCEVCGKSFTRGSDLKAHIGTH---------------------------------TTEKLFPCKMCKKVFASFRNLTCHM-----RTHTGLRHFTCELCQKGFMDSRALNVHMRIH--TGEKPYCKVCEKKFAHNSSLNVHMRI-HTGERPFTCEVCGKSFTTGSDLKVHIRTHTAGKIFPCDICKKVF 852          

HSP 3 Score: 123.635 bits (309), Expect = 6.008e-28
Identity = 89/290 (30.69%), Postives = 139/290 (47.93%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDV--KPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDR 2694
            TG R + C+ C K + +   L  H+RIHT ++PF C +C KSF     LK H ++H   K +SC++C K F  K +LKVH ++H  ++L F C++C + F +  +L     T H R+  +  P   Q         +  +      T       +V  K   +   LN       I     +  R F C  CGK++  +  L  H++ H +A N  +C  C K FV+ R++  H++T H   R +SC  C   FI  + L  H   H+  +PY+C +C + F   IY +R
Sbjct:  391 TGERPYSCKICLKRFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGRDLKAHMRTHTGEKPYSCKVCEKHFTQKYSLKVHMRIHTGERL-FTCEVCRKFFASLRNL-----TCHVRTHTSLRPFTCQLCQKGFMQSRDLKIHMRIHTGERPYSCEVCEKQFSYKSSLN-------IHMGTHTGERPFTCEVCGKNFSQRSKLKAHIRTH-TAENPFLCDICKKVFVSLRNLTYHMKT-HTGERPYSCKVCQKCFIQPSHLNIHMRTHTGERPYSCDICKKSF---IYANR 662          

HSP 4 Score: 109.768 bits (273), Expect = 1.181e-23
Identity = 84/283 (29.68%), Postives = 126/283 (44.52%), Query Frame = 1
Query: 1822 DQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            D VT  + F C  C K+     +LT H+RIHT ++PF C +C KSF   S LK H + H   + FSC+ICNK F     L  H + H  ++  + CK+C + F    +L  H      RS     P                    +  T     P   K      L ++ +   ++  R  +  R F C  CGK++     L  H++ H +A     C  C K FV+ R++  H++T H   R +SC  C   FI  + L  H  +H+  +PY+C +C + F
Sbjct:   66 DAVT--KLFSCEICKKVLISLRNLTYHMRIHTGERPFTCEVCGKSFTKGSDLKMHIRIHTGERPFSCDICNKGFINSGALTCHMRTHTGER-PYSCKVCQKSFTQSSYLNIHM-----RSHTGERPYSCDICKKTFIHANSLTY--HMRTHTGERPYSCKLCQKGFLQSKDL---KVHMRTHTGERPFICEVCGKNFLQSTKLKAHIRTH-TATKLFSCDICKKVFVSLRNLTYHMKT-HTGERPYSCKVCQKCFIQPSHLNIHMRLHTGERPYSCDICKKTF 333          

HSP 5 Score: 105.531 bits (262), Expect = 2.287e-22
Identity = 82/295 (27.80%), Postives = 129/295 (43.73%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNE----LLNQPIPIAEIDKRKL-------SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKI 2682
            TG R + C+ C K + +S DL  H+R HT ++PF C +C K+F   + LK H ++H   K FSC+IC K+F   + L  H + H  ++  + CK+C + F    HL  H      R      P              +        T        V    + +    +++  I    +  R L       +  R + C  C K +  K  LN H++ H +      C+ C KSF T R ++ H+RT H   + +SC  C   F  K SL  H  +H+  + + C +C R+F A +
Sbjct:  207 TGERPYSCKLCQKGFLQSKDLKVHMRTHTGERPFICEVCGKNFLQSTKLKAHIRTHTATKLFSCDICKKVFVSLRNLTYHMKTHTGER-PYSCKVCQKCFIQPSHLNIHM-----RLHTGERPYSCDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCFTQSSCLIVHMRIHTVFVSLRNLTYHMKTHTGERPYSCKICLKRFTQKSSLNVHMRIH-TGERPFTCEVCGKSFTTGRDLKAHMRT-HTGEKPYSCKVCEKHFTQKYSLKVHMRIHTGERLFTCEVC-RKFFASL 492          

HSP 6 Score: 104.375 bits (259), Expect = 5.749e-22
Identity = 83/306 (27.12%), Postives = 128/306 (41.83%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSF----------RLKSV------LKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            TG R + C  C K +  +  LT H+RIHT ++P+ C +C K F          R+ +V      L  H K+H   + +SC+IC K F  K +L VH ++H  ++  F C++C + F TG  L+ H  T                                        P   K  +  +   Q   + ++  R  +  RLF C  C K +   + L  H++ H S      CQ C K F+  R ++ H+R  H   R +SC  C   F  K+SL  H   H+  +P+ C +C + F  +     HI
Sbjct:  319 TGERPYSCDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCFTQSSCLIVHMRIHTVFVSLRNLTYHMKTHTGERPYSCKICLKRFTQKSSLNVHMRIHTGER-PFTCEVCGKSFTTGRDLKAHMRTH-----------------------------------TGEKPYSCK--VCEKHFTQKYSL-KVHMRIHTGERLFTCEVCRKFFASLRNLTCHVRTHTSLRPFT-CQLCQKGFMQSRDLKIHMRI-HTGERPYSCEVCEKQFSYKSSLNIHMGTHTGERPFTCEVCGKNFSQRSKLKAHI 583          

HSP 7 Score: 99.3673 bits (246), Expect = 2.157e-20
Identity = 82/322 (25.47%), Postives = 131/322 (40.68%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRF----NTGFHLRYH-----YSTS--------------HHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHS----------------NSKPYACPLCLRRFKAK 2679
            TG R F C  C K + K  DL  HIRIHT ++PF C +C+K F     L  H ++H   + +SC++C K F     L +H + H  ++  + C IC + F    +  +H+R H     YS                H R+     P   +          + ++     TA      D+   ++  L N    +     +  +  R + C  C K +    +LN H++ H +      C  C K+F+    +  H+R  H   R +SC  C   F   + LI H  +H+                  +PY+C +CL+RF  K
Sbjct:   95 TGERPFTCEVCGKSFTKGSDLKMHIRIHTGERPFSCDICNKGFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMRSHTGER-PYSCDICKKTFIHANSLTYHMRTHTGERPYSCKLCQKGFLQSKDLKVHMRTHTGERPFICEVCGKNFLQSTKLKAHIRTHTATKLFSCDICKKVFVSLRNLTYHM-----KTHTGERPYSCKVCQKCFIQPSHLNIHMRLH-TGERPYSCDICKKTFIHASRLTYHMRI-HTGERPYSCKVCQKCFTQSSCLIVHMRIHTVFVSLRNLTYHMKTHTGERPYSCKICLKRFTQK 408          

HSP 8 Score: 77.0258 bits (188), Expect = 1.530e-13
Identity = 82/328 (25.00%), Postives = 114/328 (34.76%), Query Frame = 1
Query:  478 KTINGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKT-SG--HWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            KT  G    +C++C+  F        HM  H  +R + C  CK S+ Y   L  H+   HT E            Y C +C   FS K +   H  IH  +    CE C   F     L  H+  H           T     CK+C  +F +  N+      CH +T +G  H+  E                              CQ        +  +D    +V+  I    +P             C VC K F     L  H   HTG + F C +C K FT  S +K+H+  H   K F C  C K F    N+  H++ 
Sbjct:  612 KTHTGERPYSCKVCQKCFIQPSHLNIHMRTHTGERPYSCDICKKSFIYANRLTCHMRT-HTGE----------RPYACEVCEKQFSYKSSFNVHMRIHTGERPFTCEVCGKSFTRGSDLKAHIGTHT----------TEKLFPCKMCKKVFASFRNLT-----CHMRTHTGLRHFTCE-----------------------------LCQ--------KGFMDSRALNVHMRIHTGEKPY------------CKVCEKKFAHNSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKVHIRTHTAGKIFPCDICKKVFVSLRNLTCHMRT 864          

HSP 9 Score: 73.559 bits (179), Expect = 1.582e-12
Identity = 45/113 (39.82%), Postives = 58/113 (51.33%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRF----NTGFHLRYH 2157
            TG R F C  C K +  S  L  H+RIHT +KP+ C +C K F   S L  H + H   + F+CE+C K F     LKVH + H   K+ F C IC + F    N   H+R H
Sbjct:  755 TGLRHFTCELCQKGFMDSRALNVHMRIHTGEKPY-CKVCEKKFAHNSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKVHIRTHTAGKI-FPCDICKKVFVSLRNLTCHMRTH 865          

HSP 10 Score: 67.3958 bits (163), Expect = 1.121e-10
Identity = 55/238 (23.11%), Postives = 88/238 (36.97%), Query Frame = 1
Query: 2008 KEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSK 2721
            K FSCEIC K+    + L  H ++H  ++  F C++C + F  G  L+ H                                       ++   P    +     +N       +  R  +  R + C  C KS+    YLN H++ H +      C  C K+F+   S+  H+RT H   R +SC  C   F+    L  H   H+  +P+ C +C + F        HI     +K
Sbjct:   70 KLFSCEICKKVLISLRNLTYHMRIHTGER-PFTCEVCGKSFTKGSDLKMHIR------------------------------------IHTGERPFSCDICNKGFINSGALTCHM--RTHTGERPYSCKVCQKSFTQSSYLNIHMRSH-TGERPYSCDICKKTFIHANSLTYHMRT-HTGERPYSCKLCQKGFLQSKDLKVHMRTHTGERPFICEVCGKNFLQSTKLKAHIRTHTATK 266          

HSP 11 Score: 56.9954 bits (136), Expect = 1.676e-7
Identity = 33/107 (30.84%), Postives = 53/107 (49.53%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            P++C +C KGF ++ +L+ H+ +HT  RPY C  C K+F ++ SL  H  T                  RS+  L+ H++ H  E    C +C K F    +L+ H+
Sbjct:  507 PFTCQLCQKGFMQSRDLKIHMRIHTGERPYSCEVCEKQFSYKSSLNIHMGTHTGERPFTCEVCGKNFSQRSK--LKAHIRTHTAENPFLCDICKKVFVSLRNLTYHM 611          

HSP 12 Score: 56.6102 bits (135), Expect = 2.455e-7
Identity = 63/271 (23.25%), Postives = 88/271 (32.47%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGF----DLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIF-------------NTKAKYDNHFCVGLKAEKSHLN------------RC--CDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PYSC +C K F ++S L  H+  HT  RPY C  C K F H                                +L  H++ H  E    CK+C KGF    DL+  +  H  E+      C +   +  K    + +                          KL  C  C  +F               +  Y    C     + SHLN             C  C KTF   S+  YH++ +H     Y+C  C   F Q S  + H +
Sbjct:  155 PYSCKVCQKSFTQSSYLNIHMRSHTGERPYSCDICKKTFIH------------------------------ANSLTYHMRTHTGERPYSCKLCQKGFLQSKDLKVHMRTHTGERPFICEVCGKNFLQSTKLKAHIRT----------------------HTATKLFSCDICKKVFVSLRNLTYHMKTHTGERPYSCKVCQKCFIQPSHLNIHMRLHTGERPYSCDICKKTFIHASRLTYHMR-IHTGERPYSCKVCQKCFTQSSCLIVHMR 372          

HSP 13 Score: 55.8398 bits (133), Expect = 4.048e-7
Identity = 37/115 (32.17%), Postives = 54/115 (46.96%), Query Frame = 1
Query: 3556 HGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVS 3900
            + C  C  +F    SL  H++  H   R FTC VC K+F+    L AH +TH   + + C V   C + F    SL  H+R+   +   L+ C  C K + + R L  HV+   S
Sbjct:  396 YSCKICLKRFTQKSSLNVHMRI-HTGERPFTCEVCGKSFTTGRDLKAHMRTHTGEKPYSCKV---CEKHFTQKYSLKVHMRIHTGE--RLFTCEVCRKFFASLRNLTCHVRTHTS 504          

HSP 14 Score: 55.4546 bits (132), Expect = 5.977e-7
Identity = 34/112 (30.36%), Postives = 50/112 (44.64%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRF----RHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVD 4560
            PYSC +C K F + S+L  H+  HT  RPY C  C K F    R  C ++TH   +  +     +          + +   H+++H  E    C+VC K F    DL  H+ 
Sbjct:  619 PYSCKVCQKCFIQPSHLNIHMRTHTGERPYSCDICKKSFIYANRLTCHMRTHTGERPYACEVCEKQFSY------KSSFNVHMRIHTGERPFTCEVCGKSFTRGSDLKAHIG 724          

HSP 15 Score: 54.6842 bits (130), Expect = 1.037e-6
Identity = 39/107 (36.45%), Postives = 55/107 (51.40%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            PYSC IC K F + S+L  H+ +HT  RP+ C  C K F     LK H  T   +  K   C +C K    + +L+ H+++H  E    C+VC K F    +L+ HV
Sbjct:  395 PYSCKICLKRFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGRDLKAHMRTH--TGEKPYSCKVCEKHFTQKYSLKVHMRIHTGERLFTCEVCRKFFASLRNLTCHV 499          

HSP 16 Score: 54.299 bits (129), Expect = 1.303e-6
Identity = 41/124 (33.06%), Postives = 56/124 (45.16%), Query Frame = 1
Query: 3517 LQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            +++H  + P      C  C   F  S+ L  H++  H   R ++C VC K FS K SL  H  TH   R F C V   C + F     L  H+R    +N  L  C  C KV+ + R L  H+K
Sbjct:  499 VRTHTSLRPFT----CQLCQKGFMQSRDLKIHMRI-HTGERPYSCEVCEKQFSYKSSLNIHMGTHTGERPFTCEV---CGKNFSQRSKLKAHIRTHTAENPFL--CDICKKVFVSLRNLTYHMK 612          

HSP 17 Score: 52.7582 bits (125), Expect = 3.634e-6
Identity = 61/248 (24.60%), Postives = 93/248 (37.50%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRN---HLKLHVREYSVHCKVCYKGF----DLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            P++C +C K F    +L+ H+  HT  +PY C  C K F  + SLK      H  +    R   C    +   +LRN   H++ H       C++C KGF    DL+  +  H  E+  +   C            + S   + + H      ++P              C  C   F+ ++K   H      AE   L   C K F S     YH++  H     Y+C  C   F Q S    H ++
Sbjct:  423 PFTCEVCGKSFTTGRDLKAHMRTHTGEKPYSCKVCEKHFTQKYSLKV-----HMRIHTGERLFTCEVCRKFFASLRNLTCHVRTHTSLRPFTCQLCQKGFMQSRDLKIHMRIHTGERPYSCEVC----------EKQFSYKSSLNIHMGTHTGERP------------FTCEVCGKNFSQRSKLKAHI-RTHTAENPFLCDICKKVFVSLRNLTYHMK-THTGERPYSCKVCQKCFIQPSHLNIHMRT 641          

HSP 18 Score: 52.7582 bits (125), Expect = 3.989e-6
Identity = 43/143 (30.07%), Postives = 63/143 (44.06%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSL----KTHEATKHSS-------VTXXXXXXXXXXXXXSQVALRN---HLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPEGR 4611
            PYSC +C K F + S+L  H+ +HT  RPY C  C K F H   L    + H   +  S        T+     + +++    V+LRN   H+K H  E    CK+C K F  +  L+ H+     E+      C +    GR
Sbjct:  295 PYSCKVCQKCFIQPSHLNIHMRLHTGERPYSCDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCFTQSSCLIVHMRIHTVFVSLRNLTYHMKTHTGERPYSCKICLKRFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGR 437          

HSP 19 Score: 52.7582 bits (125), Expect = 4.232e-6
Identity = 38/129 (29.46%), Postives = 51/129 (39.53%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGF----DLQEDLSRHVDEKHAASSSCIEGLPEGR 4611
            PYSC IC K F  A+ L  H+  HT  RPY C  C K+F ++ S   H                      S   L+ H+  H  E    CK+C K F    +L   +  H   +H     C +G  + R
Sbjct:  647 PYSCDICKKSFIYANRLTCHMRTHTGERPYACEVCEKQFSYKSSFNVHMRIHTGERPFTCEVCGKSFTRGSD--LKAHIGTHTTEKLFPCKMCKKVFASFRNLTCHMRTHTGLRHFTCELCQKGFMDSR 773          
BLAST of Zinc finger, C2H2 type vs. Ensembl Medaka
Match: ENSORLT00000035130.1 (pep primary_assembly:ASM223467v1:17:11263917:11382711:-1 gene:ENSORLG00000007097.2 transcript:ENSORLT00000035130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.206 bits (365), Expect = 4.900e-35
Identity = 129/492 (26.22%), Postives = 205/492 (41.67%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYL-WNENPTN----ENHFSYQPN-----HQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C VCGK F     L+ H  THTG + F C +C+K FT+ S + +HM  H   K F C+FCG++FT    +  HIK  H   T    Q    +   + +     +        +  + E     S   ++   +   E P N    E  +S         H ++   ++ +             +G + S+D++        ++ H       TG R F C  C K +    DL  HIR HT +K F C +C K+F   + L +H ++H   K FSC+IC K+F   + L  H + H  D+  + CK+C + F     L  H  T       + D      +H  + +L        +P          K  + +  LN       +  R  +  + + C  C K +  K  LN H++ H +      C+ C KSF T   ++ H+R  H   R +SC  C   FI  + L  H  +H+  +PY+C +C + F
Sbjct:  168 CDVCGKGFMQSANLQVHMRTHTGERPFTCKVCEKSFTKSSILNVHMRTHTGEKPFSCEFCGQSFTTRSVLKVHIKT-HTGETPFSCQICTKIFTYARNLTYHMRTHTGERPFLCQVCEKGFITSSHLKVHMRIHTGERPFNCEVCERPYSCDICKKTFIHANSLTYHMRTHTGERPYSCKLCQKGFMQSKDLKV------HMRTH-------TGERPFTCEVCGKSFTTGSDLKVHIRTHTAKKLFPCDICKKTFIHVNSLTSHMRTHTAKKLFSCDICKKVFVSSRNLTYHMRTHT-DERPYSCKVCKKCFTQHSCLNVHMRTHTGERPYSCDICRKTFIHSNNLTLHMRTHTGERPFTCELCQ---KGFMHSRALN-------VHMRNHTGEKPYSCKVCEKHFTQKSSLNVHMRIH-TGERPFTCEVCGKSFTTGSDLKIHMRI-HTGERPYSCDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCF 632          

HSP 2 Score: 144.436 bits (363), Expect = 9.620e-35
Identity = 126/493 (25.56%), Postives = 200/493 (40.57%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCD-----------LTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            C  CGK F     L+ H   HTG + F C +C+K FT+ S + +HM  H   K   C  CGK F    N+  H++  H        +  E    +S+      +      +K  S     QS +  + +  ++  +  T E  FS Q             A N        + +   L +  E+    +  +++H  I    TG R F C  C + Y  SCD           LT H+R HT ++P+ C +C K F     LK H ++H   + F+CE+C K F     LKVH + H   KL F C IC + F     L  H  T   + + + D      +   + +         +P +        K    +  LN       +  R  +  R + C+ C K++     L  H++ H +      C+ C K F+  R++  H+R  H   + +SC  C   F  K+SL  H  +H+  +P+ C +C + F
Sbjct:  112 CGPCGKVFTRRSNLKTHMRIHTGDRPFTCKVCEKQFTKSSILNVHMRTHTGEKAVSCDVCGKGFMQSANLQVHMRT-HTGERPFTCKVCEKSFTKSSILNVHMRTHTG--EKPFSCEFCGQSFTTRSVLKVHI--KTHTGETPFSCQI-----CTKIFTYARNLTYHMRTHTGERPFLCQVCEKGFITSSHLKVHMRIH---TGERPFNCEVCERPY--SCDICKKTFIHANSLTYHMRTHTGERPYSCKLCQKGFMQSKDLKVHMRTHTGERPFTCEVCGKSFTTGSDLKVHIRTHTAKKL-FPCDICKKTFIHVNSLTSHMRTHTAKKLFSCDICKKVFVSSRNLTYHMRTHTDERPYSCKVCK---KCFTQHSCLN-------VHMRTHTGERPYSCDICRKTFIHSNNLTLHMRTH-TGERPFTCELCQKGFMHSRALNVHMR-NHTGEKPYSCKVCEKHFTQKSSLNVHMRIHTGERPFTCEVCGKSF 576          

HSP 3 Score: 100.908 bits (250), Expect = 5.055e-21
Identity = 73/283 (25.80%), Postives = 116/283 (40.99%), Query Frame = 1
Query: 1846 FRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNV--------CQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            F C  C K++ +  +L  H+RIHT  +PF C +C K F   S+L  H ++H   K  SC++C K F     L+VH + H  ++  F CK+C++ F     L  H      R+     P   +       +    +      T  +     +   I+    N    +     R  +  R F C  C K +    +L  H++ H      N         C  C K+F+   S+  H+RT H   R +SC  C   F+    L  H   H+  +P+ C +C + F
Sbjct:  110 FWCGPCGKVFTRRSNLKTHMRIHTGDRPFTCKVCEKQFTKSSILNVHMRTHTGEKAVSCDVCGKGFMQSANLQVHMRTHTGER-PFTCKVCEKSFTKSSILNVHM-----RTHTGEKPFSCEFCGQSFTTRSVLKVHIKTHTGETPFSCQICTKIFTYARNLTYHM-----RTHTGERPFLCQVCEKGFITSSHLKVHMRIHTGERPFNCEVCERPYSCDICKKTFIHANSLTYHMRT-HTGERPYSCKLCQKGFMQSKDLKVHMRTHTGERPFTCEVCGKSF 380          

HSP 4 Score: 90.1225 bits (222), Expect = 1.009e-17
Identity = 70/278 (25.18%), Postives = 112/278 (40.29%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIA---EIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPL 2655
            T  + F C  C K++  S +LT H+R HT ++P+ C +C K F   S L  H ++H   + +SC+IC K F     L +H + H  ++  F C++C + F     L  H      R+     P   +                   T         +P    E+  +        +I  R  +  R + C+ C K++     L  H++ H +      C+ C K F     +  H+R  H   R +SC  C   FI    L  H   H+  +PY+C L
Sbjct:  422 TAKKLFSCDICKKVFVSSRNLTYHMRTHTDERPYSCKVCKKCFTQHSCLNVHMRTHTGERPYSCDICRKTFIHSNNLTLHMRTHTGER-PFTCELCQKGFMHSRALNVHM-----RNHTGEKPYSCKVCEKHFTQKSSLNVHMRIHTGE-------RPFTC-EVCGKSFTTGSDLKIHMRIHTGERPYSCDICKKTFIHASRLTYHMRIH-TGERPYSCKVCQKCFTQSSCLIVHMRI-HTGERPYSCHICKKVFIHSGGLTLHMRTHTGERPYSCKL 683          

HSP 5 Score: 84.7297 bits (208), Expect = 5.667e-16
Identity = 79/316 (25.00%), Postives = 118/316 (37.34%), Query Frame = 1
Query:  505 TCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            TC++CE +F        HM  H  ++   C  C   +    NL VH+   HT           E  + C +C   F++      H   H  ++   CE C   F  + +L  H+  H  GE             C+IC  IF    N+  H +R H   +G  P                                CQ  +      S L      V+  I    RP   + +  +   +C +C K F     L  H  THTG + + C +C+KGF Q   +K+HM  H   + F C+ CGK+FT   ++  HI+ 
Sbjct:  139 TCKVCEKQFTKSSILNVHMRTHTGEKAVSCDVCGKGFMQSANLQVHMR-THTG----------ERPFTCKVCEKSFTKSSILNVHMRTHTGEKPFSCEFCGQSFTTRSVLKVHIKTH-TGE---------TPFSCQICTKIFTYARNLTYH-MRTH---TGERP------------------------------FLCQVCEKGFITSSHL-----KVHMRIHTGERP--FNCEVCERPYSCDICKKTFIHANSLTYHMRTHTGERPYSCKLCQKGFMQSKDLKVHMRTHTGERPFTCEVCGKSFTTGSDLKVHIRT 392          

HSP 6 Score: 83.5741 bits (205), Expect = 1.014e-15
Identity = 65/251 (25.90%), Postives = 99/251 (39.44%), Query Frame = 1
Query: 1930 FQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKI 2682
            F C  C K F  +S LK H + H   + F+C++C K F     L VH + H  +K    C +C + F    +L+ H      R+     P   +                             K    + +LN       +  R  +  + F C  CG+S+  +  L  H+K H +      CQ C K F   R++  H+RT H   R F C  C   FIT + L  H  +H+  +P+ C +C R +   I
Sbjct:  110 FWCGPCGKVFTRRSNLKTHMRIHTGDRPFTCKVCEKQFTKSSILNVHMRTHTGEKA-VSCDVCGKGFMQSANLQVHM-----RTHTGERPFTCKVCE--------------------------KSFTKSSILN-------VHMRTHTGEKPFSCEFCGQSFTTRSVLKVHIKTH-TGETPFSCQICTKIFTYARNLTYHMRT-HTGERPFLCQVCEKGFITSSHLKVHMRIHTGERPFNCEVCERPYSCDI 319          

HSP 7 Score: 80.4925 bits (197), Expect = 1.013e-14
Identity = 82/325 (25.23%), Postives = 118/325 (36.31%), Query Frame = 1
Query:  478 KTINGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            +T  G    TC++CE  F        HM  H  ++ F C +C  S+     L VHI   HT           E  + C IC+ +F+  +    H   H  +    C+ C   F     L  H+  H  GE   + ++      C IC   F +  ++  H +R H   +G  P                                  + KL  +G  Q  ++K  +     +R                C VCGK+F T   L+ H  THT  K F C ICKK F   +S+  HM  H   K F C  C K F    N+  H++ 
Sbjct:  186 RTHTGERPFTCKVCEKSFTKSSILNVHMRTHTGEKPFSCEFCGQSFTTRSVLKVHIK-THTG----------ETPFSCQICTKIFTYARNLTYHMRTHTGERPFLCQVCEKGFITSSHLKVHMRIH-TGERPFNCEVCERPYSCDICKKTFIHANSLTYH-MRTH---TGERPY---------------------------------SCKLCQKGFMQSKDLKVHMRTHTGER-------------PFTCEVCGKSFTTGSDLKVHIRTHTAKKLFPCDICKKTFIHVNSLTSHMRTHTAKKLFSCDICKKVFVSSRNLTYHMRT 448          

HSP 8 Score: 73.9442 bits (180), Expect = 1.014e-12
Identity = 82/342 (23.98%), Postives = 127/342 (37.13%), Query Frame = 1
Query:  478 KTINGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHI----------------AIIHTNECTV-VNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            +T  G    +C++C+  F   +    HM  H  +R F C  C  S+    +L VHI                  IH N  T  +     +  + C IC  +F   +    H   H  +    C+ C   F     L+ H+  H  GE             C IC   F +  N+  H +R H   +G  P    +  K    + +        N       +C+  + +   +S L+     V+  I    RP             C VCGK+F T   L+ H   HTG + + C ICKK F   S +  HM +H   + + C+ C K FT    +  H+++
Sbjct:  335 RTHTGERPYSCKLCQKGFMQSKDLKVHMRTHTGERPFTCEVCGKSFTTGSDLKVHIRTHTAKKLFPCDICKKTFIHVNSLTSHMRTHTAKKLFSCDICKKVFVSSRNLTYHMRTHTDERPYSCKVCKKCFTQHSCLNVHMRTH-TGER---------PYSCDICRKTFIHSNNLTLH-MRTH---TGERPFTCELCQKGF--MHSRALNVHMRNHTGEKPYSCKVCEKHFTQKSSLN-----VHMRIHTGERPFT-----------CEVCGKSFTTGSDLKIHMRIHTGERPYSCDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCFTQSSCLIVHMRI 644          

HSP 9 Score: 68.1662 bits (165), Expect = 5.787e-11
Identity = 74/316 (23.42%), Postives = 110/316 (34.81%), Query Frame = 1
Query:  505 TCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            +C+IC+  F S R    HM  H ++R + C  CK  +     L VH+   HT E            Y C IC   F        H   H  +    CE C   F     L+ H+ +H  GE+            CK+C   F    ++  H +R H   +G  P                                C+       G+S        ++  I    RP             C +C K F     L  H   HTG + + C +C+K FTQ S + +HM +H   + + C  C K F +   +  H++ 
Sbjct:  428 SCDICKKVFVSSRNLTYHMRTHTDERPYSCKVCKKCFTQHSCLNVHMRT-HTGE----------RPYSCDICRKTFIHSNNLTLHMRTHTGERPFTCELCQKGFMHSRALNVHMRNH-TGEK---------PYSCKVCEKHFTQKSSLNVH-MRIH---TGERPF------------------------------TCEVC-----GKSFTTGSDLKIHMRIHTGERPYS-----------CDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCFTQSSCLIVHMRIHTGERPYSCHICKKVFIHSGGLTLHMRT 672          

HSP 10 Score: 58.9214 bits (141), Expect = 4.450e-8
Identity = 37/111 (33.33%), Postives = 57/111 (51.35%), Query Frame = 1
Query: 3556 HGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVK 3888
            + C  C   F  S+ L  H+++ H   R FTC VC K+F+    L  H +TH   + F C +   C + FI V SL+ H+R   +    L+ C  C KV+ ++R L  H++
Sbjct:  343 YSCKLCQKGFMQSKDLKVHMRT-HTGERPFTCEVCGKSFTTGSDLKVHIRTHTAKKLFPCDI---CKKTFIHVNSLTSHMRT--HTAKKLFSCDICKKVFVSSRNLTYHMR 447          

HSP 11 Score: 57.7658 bits (138), Expect = 9.331e-8
Identity = 33/111 (29.73%), Postives = 50/111 (45.05%), Query Frame = 1
Query: 2368 SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI 2700
            + +R F C  C K +     LN H++ H      + C  C K F+   ++Q H+RT H   R F+C  C   F   + L  H   H+  KP++C  C + F  +     HI
Sbjct:  133 TGDRPFTCKVCEKQFTKSSILNVHMRTHTGEKAVS-CDVCGKGFMQSANLQVHMRT-HTGERPFTCKVCEKSFTKSSILNVHMRTHTGEKPFSCEFCGQSFTTRSVLKVHI 241          

HSP 12 Score: 56.9954 bits (136), Expect = 1.609e-7
Identity = 61/240 (25.42%), Postives = 86/240 (35.83%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQK 4956
            PYSC +C K F + S L  H+  HT  RPY C  C K F H  +L  H  T H+              + S+ AL  H++ H  E    CKVC K F  +  L+ H+             +  G +P                                    C  C   F T +    H  +    E+ +    C KTF   S+  YH++ +H     Y+C  C   F Q S  + H +
Sbjct:  454 PYSCKVCKKCFTQHSCLNVHMRTHTGERPYSCDICRKTFIHSNNLTLHMRT-HTGERPFTCELCQKGFMHSR-ALNVHMRNHTGEKPYSCKVCEKHFTQKSSLNVHMR------------IHTGERP----------------------------------FTCEVCGKSFTTGSDLKIHMRIHT-GERPYSCDICKKTFIHASRLTYHMR-IHTGERPYSCKVCQKCFTQSSCLIVHMR 643          

HSP 13 Score: 54.299 bits (129), Expect = 1.054e-6
Identity = 30/101 (29.70%), Postives = 48/101 (47.52%), Query Frame = 1
Query: 2368 SNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            S+  LF C  CGK +  +  L  H++ H + +    C+ C K F     +  H+RT H   +  SC  C   F+  A+L  H   H+  +P+ C +C + F
Sbjct:  105 SHKSLFWCGPCGKVFTRRSNLKTHMRIH-TGDRPFTCKVCEKQFTKSSILNVHMRT-HTGEKAVSCDVCGKGFMQSANLQVHMRTHTGERPFTCKVCEKSF 203          

HSP 14 Score: 53.9138 bits (128), Expect = 1.586e-6
Identity = 35/105 (33.33%), Postives = 52/105 (49.52%), Query Frame = 1
Query: 4243 SCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            SC +C KGF +++NLQ H+  HT  RP+ C  C K F     L  H  T   +  K   C  C +   ++  L+ H+K H  E    C++C K F    +L+ H+
Sbjct:  167 SCDVCGKGFMQSANLQVHMRTHTGERPFTCKVCEKSFTKSSILNVHMRTH--TGEKPFSCEFCGQSFTTRSVLKVHIKTHTGETPFSCQICTKIFTYARNLTYHM 269          

HSP 15 Score: 52.7582 bits (125), Expect = 3.001e-6
Identity = 33/107 (30.84%), Postives = 49/107 (45.79%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            P++C +C K F ++S L  H+  HT  +P+ C  C + F  R  LK H  T H+  T             ++  L  H++ H  E    C+VC KGF     L  H+
Sbjct:  193 PFTCKVCEKSFTKSSILNVHMRTHTGEKPFSCEFCGQSFTTRSVLKVHIKT-HTGETPFSCQICTKIFTYAR-NLTYHMRTHTGERPFLCQVCEKGFITSSHLKVHM 297          

HSP 16 Score: 51.9878 bits (123), Expect = 6.674e-6
Identity = 37/116 (31.90%), Postives = 53/116 (45.69%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTK---------LRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            P+ C +C KGF  +S+L+ H+ +HT           RPY C  C K F H  SL  H  T H+              ++S+  L+ H++ H  E    C+VC K F    DL  H+
Sbjct:  277 PFLCQVCEKGFITSSHLKVHMRIHTGERPFNCEVCERPYSCDICKKTFIHANSLTYHMRT-HTGERPYSCKLCQKGFMQSK-DLKVHMRTHTGERPFTCEVCGKSFTTGSDLKVHI 390          
BLAST of Zinc finger, C2H2 type vs. Ensembl Medaka
Match: ENSORLT00000042917.1 (pep primary_assembly:ASM223467v1:2:5044890:5319561:1 gene:ENSORLG00000028323.1 transcript:ENSORLT00000042917.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 143.28 bits (360), Expect = 3.299e-34
Identity = 136/515 (26.41%), Postives = 215/515 (41.75%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQS-QEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPT---NENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTA--NSNNPPDVKPLIWNELLN----QPIPIAEIDK--RK---LSNNRL-------FKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHIS 2703
            C  C K++     L+RH  THTG + + C  C+KGF    S+K HM +H   K F C+ C K+F+ + N+  H++  HK G  +  ++  +H+ N S+      +K     KK      T + P    E  +    ++        H   +P      D       N I      + +     ++ ++   +  +I+ H       TG + F C+ C   + +   L  H+RIHT +KP+ C  C K F  KS +  H  SH   K +SC+ CNK F     L  H   H  +K  + CK C++ F    HL  H  T       +            H +         KP +    N     + ++ + +L     +P    E +K  RK   LS++ L       + C  C KS+  + +L  H+  H +      C+ CNK F  YRS+  H    H   + +SC +C   F  K +L  H L H+  KPY+C  C + F  +    RHI+
Sbjct:  171 CKECDKSYSYVSHLKRHMRTHTGERPYWCMECRKGFMDLFSLKTHMRIHTGKKPFSCKECKKSFSQKGNLKIHMRT-HKTGINLRIKTLNQHVQNGSDKRYCASKKC---VKKFIERPHTGEKPFICNECDKRFSRKSKLITHMRTHTGEKPFTCKECDKRFSQTSNLITHMRTHTGEKPFTCKECDKRFSQKSKIKTHMRTH---TGEKLFTCKECDSSFIQKYHLKTHMRIHTGEKPYSCKKCGKRFVQKSHVTCHMLSHTGEKPYSCKECNKCFRYSSVLTHHMYTHTGEKP-YSCKECNKDFRNKTHLSSHMLTHTGEKPYSCKECSKSFTQRSHLTSHMLTHTGEKPYSCKECNKCFRYRSVLTHHMLTHTGEKPYSCKECNKDFRKKYNLSSHMLTHTGEKPYSCKECSKSFTQRSHLTSHMLTH-TGEKPYSCKECNKCF-RYRSVLTHHMLTHTGEKPYSCKECNKDFRKKYNLSSHMLTHTGEKPYSCKKCSKGFTQRSLVTRHIT 675          

HSP 2 Score: 129.413 bits (324), Expect = 6.697e-30
Identity = 123/550 (22.36%), Postives = 222/550 (40.36%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNH-QSNTDSYIPSAENFIKLDWDKSHQG---ILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTA------NSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRL------------FKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHI---------SAKKCSKKKRNRFQQNDLMTGIINRNP 2781
            C  CGK+F      + H   H   K + C  C+K F+  S++  HM+ H  VK F C+ C K+++Y  ++  H++           + ++  +   +    +     +  KK  S  E  +S S    +  ++                H Q+ +D    +++  +K   ++ H G    + +E  +R  +++  I          TG + F C+ C K + ++ +L  H+R HT +KPF C  C K F  KS +K H ++H   K F+C+ C+  F  K  LK H ++H  +K  + CK C +RF    H+  H  +       +         +    +   +     KP +      +  N   +   +      +P    E  K     + L            + C  C K ++++  L  H+  H +      C+ CNK F    ++  H+ T H   + +SC +C   F  ++ L  H L H+  KPY+C  C + F+ +     H+         S K+C+K  R ++  +  M       P
Sbjct:  115 CKECGKSFGNISQFKIHARIHAKDKRYSCKECEKSFSSTSNLDRHMMTHRGVKPFSCKECDKSYSYVSHLKRHMRTHTGERPYWCMECRKGFM---DLFSLKTHMRIHTGKKPFSCKECKKSFSQKGNLKIHMRTHKTGINLRIKTLNQHVQNGSDKRYCASKKCVKKFIERPHTGEKPFICNECDKRFSRKSKLITHMRT----HTGEKPFTCKECDKRFSQTSNLITHMRTHTGEKPFTCKECDKRFSQKSKIKTHMRTHTGEKLFTCKECDSSFIQKYHLKTHMRIHTGEKP-YSCKKCGKRFVQKSHVTCHMLSHTGEKPYSCKECNKCFRYSSVLTHHMYTHTGEKPYSCKECNKDFRNKTHLSSHMLTHTGEKPYSCKECSKSFTQRSHLTSHMLTHTGEKPYSCKECNKCFRYRSVLTHHMLTH-TGEKPYSCKECNKDFRKKYNLSSHMLT-HTGEKPYSCKECSKSFTQRSHLTSHMLTHTGEKPYSCKECNKCFRYRSVLTHHMLTHTGEKPYSCKECNKDFRKKYNLSSHMLTHTGEKP 654          

HSP 3 Score: 93.9745 bits (232), Expect = 6.892e-19
Identity = 74/283 (26.15%), Postives = 118/283 (41.70%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAK 2679
            TG + + C+ C K + +   LT H+  HT +KP+ C  C+K FR +SVL +H  +H   K +SC+ CNK F  K  L  H   H  +K  + CK C + F    HL     TSH  +     P                           N     + ++ + +L              +  + + C  C K ++ K  L+ H+  H +      C+ C+K F     + +H+   H   + FSC +C   F   ASL +H  +H+  KP++C  C   F  +
Sbjct:  482 TGEKPYSCKECSKSFTQRSHLTSHMLTHTGEKPYSCKECNKCFRYRSVLTHHMLTHTGEKPYSCKECNKDFRKKYNLSSHMLTHTGEKP-YSCKECSKSFTQRSHL-----TSHMLTHTGEKPYS---------------------CKECNKCFRYRSVLTHHMLTH------------TGEKPYSCKECNKDFRKKYNLSSHMLTH-TGEKPYSCKKCSKGFTQRSLVTRHI--THTGEKPFSCKECDTSFRHAASLKKHMRIHTGEKPFSCQECDSSFSCR 722          

HSP 4 Score: 87.8113 bits (216), Expect = 6.528e-17
Identity = 81/311 (26.05%), Postives = 129/311 (41.48%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYH 2157
            C  C K F+   +L  H  THTG K + C  C K F  K+ +  HM+ H   K + C+ C K+FT   ++ +H+          L+ + E                     K  S  E N+     + +T ++     T E  +S +  ++     Y  S+ + +    +K +     S+   +    T  +  H       TG + + C+ C K +R    LT H+  HT +KP+ C  C+K FR K  L +H  +H   K +SC+ C+K F   Q   V R +    +  F CK CD  F     L+ H
Sbjct:  433 CKECNKCFRYSSVLTHHMYTHTGEKPYSCKECNKDFRNKTHLSSHMLTHTGEKPYSCKECSKSFTQRSHLTSHM----------LTHTGE---------------------KPYSCKECNKCFRYRSVLTHHMLTH--TGEKPYSCKECNKDFRKKYNLSS-HMLTHTGEKPYSCKECSKSFTQRSHLTSHMLTH-------TGEKPYSCKECNKCFRYRSVLTHHMLTHTGEKPYSCKECNKDFRKKYNLSSHMLTHTGEKPYSCKKCSKGFT--QRSLVTRHITHTGEKPFSCKECDTSFRHAASLKKH 700          

HSP 5 Score: 76.2554 bits (186), Expect = 1.958e-13
Identity = 69/282 (24.47%), Postives = 121/282 (42.91%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVH 2070
            C  C K+F     L  H +THTG K + C  C K F  +S +  HM+ H   K + C+ C K F  ++N+++                  H+L  +              +K  S  E ++S +  + +T ++     T E  +S +  ++      + +  + +    +K +     ++D  +    +  +  H       TG + + C+ C K + +   +TRHI  HT +KPF C  C  SFR  + LK H + H   K FSC+ C+  F+ +  L+ H
Sbjct:  489 CKECSKSFTQRSHLTSHMLTHTGEKPYSCKECNKCFRYRSVLTHHMLTHTGEKPYSCKECNKDFRKKYNLSS------------------HMLTHTG-------------EKPYSCKECSKSFTQRSHLTSHMLTH--TGEKPYSCKECNKCFRYRSVLT-HHMLTHTGEKPYSCKECNKDFRKKYNLSSHMLTH-------TGEKPYSCKKCSKGFTQRSLVTRHI-THTGEKPFSCKECDTSFRHAASLKKHMRIHTGEKPFSCQECDSSFSCRSILQTH 728          

HSP 6 Score: 62.7734 bits (151), Expect = 2.712e-9
Identity = 61/242 (25.21%), Postives = 104/242 (42.98%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVI--PEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKS 4959
            YSC  C K F+  SNL +H+  H  ++P+ C +C K + +   LK H  T   +  +   C  C K      +L+ H+++H  +    CK C K F  + +L  H+       +  I+ L +  +   +            +   +K +K+ I  P   +K   C  C   F+ K+K   H       EK    + CDK F  TS  + H++  H     + C +C+  F+Q+S    H ++
Sbjct:  141 YSCKECEKSFSSTSNLDRHMMTHRGVKPFSCKECDKSYSYVSHLKRHMRT--HTGERPYWCMECRKGFMDLFSLKTHMRIHTGKKPFSCKECKKSFSQKGNLKIHMRTHKTGINLRIKTLNQHVQNGSD----------KRYCASKKCVKKFIERPHTGEKPFICNECDKRFSRKSKLITHMRTHT-GEKPFTCKECDKRFSQTSNLITHMR-THTGEKPFTCKECDKRFSQKSKIKTHMRT 368          

HSP 7 Score: 58.5362 bits (140), Expect = 5.788e-8
Identity = 44/119 (36.97%), Postives = 59/119 (49.58%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIE 4593
            PYSC  C K F + S+L  H+  HT  +PY C +C K FR+R S+ TH    H+   K   C  C K  R +  L +H+  H  E    CK C KGF  +  ++RH+        SC E
Sbjct:  570 PYSCKECSKSFTQRSHLTSHMLTHTGEKPYSCKECNKCFRYR-SVLTHHMLTHTG-EKPYSCKECNKDFRKKYNLSSHMLTHTGEKPYSCKKCSKGFTQRSLVTRHITHTGEKPFSCKE 686          

HSP 8 Score: 56.9954 bits (136), Expect = 1.839e-7
Identity = 61/271 (22.51%), Postives = 102/271 (37.64%), Query Frame = 1
Query: 1888 DLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDK--RKLSNNRLFKCNHCGKSYKFKKYLNEHLKEH-------LSANNTNVCQFCNKSF-VTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            +L+ ++   + ++ + C  C KSF   S  K H + H K K +SC+ C K F+    L  H   H   K  F CK CD+ ++   HL+ H  T                                            +P    E     + +  +    R  +  + F C  C KS+  K  L  H++ H       +   N +V    +K +  + + +++ +   H   + F C +C   F  K+ LI H   H+  KP+ C  C +RF
Sbjct:   99 NLSDYMETGSDERCYICKECGKSFGNISQFKIHARIHAKDKRYSCKECEKSFSSTSNLDRHMMTHRGVKP-FSCKECDKSYSYVSHLKRHMRTH----------------------------------------TGERPYWCMECRKGFMDLFSLKTHMRIHTGKKPFSCKECKKSFSQKGNLKIHMRTHKTGINLRIKTLNQHVQNGSDKRYCASKKCVKKFIERPHTGEKPFICNECDKRFSRKSKLITHMRTHTGEKPFTCKECDKRF 328          

HSP 9 Score: 56.225 bits (134), Expect = 2.765e-7
Identity = 63/242 (26.03%), Postives = 96/242 (39.67%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLS----RHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 4950
            P++C  C K F++ SNL  H+  HT  +P+ C +C KRF  +  +KTH  T   +  KL  C  C      +  L+ H+++H  E    CK C K F  +  ++     H  EK  +   C +            SS  TH               +     +K   C  C+  F  K    +H  +    EK +  + C K+F   S    H+   H     Y+C +CN  F   S   +H
Sbjct:  318 PFTCKECDKRFSQTSNLITHMRTHTGEKPFTCKECDKRFSQKSKIKTHMRT--HTGEKLFTCKECDSSFIQKYHLKTHMRIHTGEKPYSCKKCGKRFVQKSHVTCHMLSHTGEKPYSCKECNKCF--------RYSSVLTH--------------HMYTHTGEKPYSCKECNKDFRNKTHLSSHM-LTHTGEKPYSCKECSKSFTQRSHLTSHML-THTGEKPYSCKECNKCFRYRSVLTHH 533          

HSP 10 Score: 55.4546 bits (132), Expect = 4.926e-7
Identity = 63/239 (26.36%), Postives = 96/239 (40.17%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV-DEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNH 4950
            PYSC  C+K F  +S L  H+  HT  +PY C +C K FR++  L +H  T         +        RS   L +H+  H  E    CK C K F  +  L+ H+         SC E   + RK    LSS                   ++    +K   C  CS  F  ++   +H  +    EK +  + C+K F   S   +H+   H     Y+C +CN  F ++ +  +H
Sbjct:  430 PYSCKECNKCFRYSSVLTHHMYTHTGEKPYSCKECNKDFRNKTHLSSHMLTHTGEKPYSCKECSKSFTQRSH--LTSHMLTHTGEKPYSCKECNKCFRYRSVLTHHMLTHTGEKPYSCKECNKDFRKKYN-LSS------------------HMLTHTGEKPYSCKECSKSFTQRSHLTSHM-LTHTGEKPYSCKECNKCFRYRSVLTHHML-THTGEKPYSCKECNKDFRKKYNLSSH 645          

HSP 11 Score: 53.5286 bits (127), Expect = 2.160e-6
Identity = 40/127 (31.50%), Postives = 55/127 (43.31%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV----DEKHAASSSCIEGLPE 4605
            PYSC  C+K F +  NL  H+  HT  +PY C +C K F  R  L +H  T H+                  V L +H+  H  E    CK C K F  + +LS H+     EK  +   C +G  +
Sbjct:  542 PYSCKECNKDFRKKYNLSSHMLTHTGEKPYSCKECSKSFTQRSHLTSHMLT-HTGEKPYSCKECNKCFRYRSV-LTHHMLTHTGEKPYSCKECNKDFRKKYNLSSHMLTHTGEKPYSCKKCSKGFTQ 666          
BLAST of Zinc finger, C2H2 type vs. Planmine SMEST
Match: SMESG000038394.1 (SMESG000038394.1)

HSP 1 Score: 2942.53 bits (7627), Expect = 0.000e+0
Identity = 1619/1652 (98.00%), Postives = 1621/1652 (98.12%), Query Frame = 1
Query:   16 MSEISLQPLVETAINVVMDSNNLNLSYKVNDQRENNFSSSEERVDNNTIQCYVNQDNTLSFINNSNVFQTVEDDCGEIYYACIGANDNDINHQDQVLQLIPQNQISNYIISDKDYSNVTYVNESVINGTNYYDSQNTTYNQNKYQYDNLDPTVYKTINGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLMTGIINRNPIGSLTNQIGQSDLEANDQSETFTAFRLEDLDMNSAQSSNILVTNYVNEFSSFPSTEKYMIVSLDNPNSKDQSGSSQQNYYASNIXXXXXXXXXXARNQIESQTDQSENIMSLLDSGQMGVTPVDIGSLFAVQGFNGNIATQLVDHGNIQSNDIDYSQPQENIYYYQALNEIPTVECPIECPSKSSLADKFPILKASLFSDDELTSNPKESNPFTNSSMVTNSNGSQFXXXXXXXXXXXXXXXXXXLQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSDYDALIINSNQFVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVYFPNLHNSQIVTELETVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPDLNKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVHHL 4971
            MSEISLQPLVETAINVVMDSNNLNLSYKVNDQRENNFSSSEERVDNNTIQCYVNQDNTLSFINNSNVFQTVEDDCGEIYYACIGANDNDINHQDQVLQLIPQNQISNYIISDKDYSNVTYVNESVINGTNYYDSQNTTYNQNKYQYDNLDPTVYKTINGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIEEEEKSNKRKSSKIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPKKTDNKSTKTNSNCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNDDEEEDQKDPNRFKKIASLAETNQSP+DDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPSPHQSLHLEHQSLQQHESLKNKPTANSNNPP                          NNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLMTGIINRNPIGSL NQIGQSDLEANDQSETFTAFRLEDLDMNSAQSSNILVTNYVNEFSSFPSTEKYMIVSLDNPNSKDQSGSSQQNYYASNILLDDSSLLDLARNQIESQTDQSENIMSLLD+GQMGVTPVDIGSLFAVQGFNGNIATQLVDHGNIQSNDIDYSQPQENIYYYQALNEIPTVECPIECPSKSSLADKFPILKASLFSDDELTSN KESNPFTNSSMVTNSNGSQFIITSSASVTASSSTASAILQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSDYDALIINSNQFVENTNQNTVTNDNNNNNNNINFTKIKSDIDIDIDRVYFPNLHNSQIVTELETVTNSNTSGNTSKLSLKELLSTKESILSTKSTK PD NKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTKLLRCHLCLKLLRSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSST THHHHYHHQQQQKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVHHL
Sbjct:    1 MSEISLQPLVETAINVVMDSNNLNLSYKVNDQRENNFSSSEERVDNNTIQCYVNQDNTLSFINNSNVFQTVEDDCGEIYYACIGANDNDINHQDQVLQLIPQNQISNYIISDKDYSNVTYVNESVINGTNYYDSQNTTYNQNKYQYDNLDPTVYKTINGTGKQTCEICEVEFPSKRTYLKHMSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIEEEEKSNKRKSSKIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPKKTDNKSTKTNSNCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNDDEEEDQKDPNRFKKIASLAETNQSPTDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPSPHQSLHLEHQSLQQHESLKNKPTANSNNPP-------------------------INNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLMTGIINRNPIGSLANQIGQSDLEANDQSETFTAFRLEDLDMNSAQSSNILVTNYVNEFSSFPSTEKYMIVSLDNPNSKDQSGSSQQNYYASNILLDDSSLLDLARNQIESQTDQSENIMSLLDNGQMGVTPVDIGSLFAVQGFNGNIATQLVDHGNIQSNDIDYSQPQENIYYYQALNEIPTVECPIECPSKSSLADKFPILKASLFSDDELTSNHKESNPFTNSSMVTNSNGSQFIITSSASVTASSSTASAILQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSDYDALIINSNQFVENTNQNTVTNDNNNNNNNINFTKIKSDIDIDIDRVYFPNLHNSQIVTELETVTNSNTSGNTSKLSLKELLSTKESILSTKSTKTPDFNKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTKLLRCHLCLKLLRSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTTTHHHHYHHQQQQKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVHHL 1627          
BLAST of Zinc finger, C2H2 type vs. Planmine SMEST
Match: SMESG000054710.1 (SMESG000054710.1)

HSP 1 Score: 2526.51 bits (6547), Expect = 0.000e+0
Identity = 1412/1471 (95.99%), Postives = 1424/1471 (96.80%), Query Frame = 1
Query:  559 MSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKICHDIFENVGNVKKHYVRCHPKTSGHWPIEDGMPVKPVERVPTPIXXXXXXXXXXXXXIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPXXXXXXXXXXXXXCAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNXXXXXXQKDPNRFKKIASLAETNQSPSDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPXXXXXXXXXXXXXXXXXXXKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLMTGIINRNPIGSLTNQIGQSDLEANDQSETFTAFRLEDLDMNSAQSSNILVTNYVNEFSSFPSTEKYMIVSLDNPNSKDQSGSSQQNYYASNIXXXXXXXXXXARNQIESQTDQSENIMSLLDSGQMGVTPVDIGSLFAVQGFNGNIATQLVDHGNIQSNDIDYSQPQENIYYYQALNEIPTVECPIECPSKSSLADKFPILKASLFSDDELTSNPKESNPFTNSSMVTNSNGSQFXXXXXXXXXXXXXXXXXXLQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSDYDALIINSNQFVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVYFPNLHNSQIVTELETVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPDLNKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSTPTXXXXXXXXXXXKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVHHL 4971
            MSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKI         +  K  +    + +G         ++  E+          SNKRKSSKIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPKKTDNKSTK+NSNCAVCGK FKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNDDEE+ QKDPNRFKKIASLAETNQSP+DDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPSPHQSLHLEHQSLQQHESLKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLMTGIINRNPIGSL NQIGQSDLEANDQSETFTAFRLEDLDMNSAQSSNILVTNYVNEFSSFPSTEKYMIVSLDNPNSKDQSGSSQQNYYASNILLDDSSLLDLARNQIESQTDQSENIMSLLD+GQMGVTPVDIGSLFAVQGFNGNIATQLVDHGNIQSNDIDYSQPQENIYYYQALNEIPTVECPIECPSKSSLADKFPILKASLFSDDELTSN KESNPFTNSSMVTNSNGSQFIITSSASVTASSSTASAILQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSDYDALIINSNQFVEN NQNTVTNDNNNNNNNINFTKIKSDIDIDIDRVYFPNLHNSQIVTELETVTNSNTSGNTSKLSLKELLSTKESILSTKSTK PD NKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTKLLRCHLCLKLLRSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSS+ THHHHYHHQQQQKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVHHL
Sbjct:    1 MSIHENDREFKCSWCKLSYNYEVNLLVHIAIIHTNECTVVNDSNQEMNYKCVICSCLFSRKKAHQAHCLIHQVDEELPCEHCPALFKCKVLLDKHLNDHKIGEECDDRKLTTNYLKCKI-------YASKNKRPLANRRRDAGETSRTSSDSIEEEEK----------SNKRKSSKIACQTIKLYAQGRSQLDEMKPDVNRSISKRGRPKKTDNKSTKSNSNCAVCGKEFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKNGTEVLSQSQEHLLNESNDDEED-QKDPNRFKKIASLAETNQSPTDDAEITQYLWNENPTNENHFSYQPNHQSNTDSYIPSAENFIKLDWDKSHQGILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSHHRSIANPDPSPHQSLHLEHQSLQQHESLKNKPTANSNNPPDVKPLIWNELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRFKAKIYCDRHISAKKCSKKKRNRFQQNDLMTGIINRNPIGSLANQIGQSDLEANDQSETFTAFRLEDLDMNSAQSSNILVTNYVNEFSSFPSTEKYMIVSLDNPNSKDQSGSSQQNYYASNILLDDSSLLDLARNQIESQTDQSENIMSLLDNGQMGVTPVDIGSLFAVQGFNGNIATQLVDHGNIQSNDIDYSQPQENIYYYQALNEIPTVECPIECPSKSSLADKFPILKASLFSDDELTSNHKESNPFTNSSMVTNSNGSQFIITSSASVTASSSTASAILQSHPEISPIKFYHGCANCDHQFKDSQSLVEHVKSQHKIRRDFTCNVCHKAFSAKLSLWAHSKTHIDSRSFGCFVCIACNQRFISVPSLSRHVRMQHNDNLNLYRCTHCNKVYKTTRELDSHVKQLVSDYDALIINSNQFVENNNQNTVTNDNNNNNNNINFTKIKSDIDIDIDRVYFPNLHNSQIVTELETVTNSNTSGNTSKLSLKELLSTKESILSTKSTKTPDFNKTPAIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTKLLRCHLCLKLLRSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHAASSSCIEGLPEGRKPAGELSSSITHHHHYHHQQQQKPIKEVIPEIPKKLIKCLSCSFIFNTKAKYDNHFCVGLKAEKSHLNRCCDKTFESTSQFLYHVQEVHNQLIQYNCAQCNIMFAQESSYVNHQKSVHHL 1453          
BLAST of Zinc finger, C2H2 type vs. Planmine SMEST
Match: SMESG000058261.1 (SMESG000058261.1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.021e-15
Identity = 44/112 (39.29%), Postives = 62/112 (55.36%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            TG R F C+ C K +R++  L RH  IHT ++P  C  C+KSF   S L  H + H   K + CEIC K F+ K   K H+  H  +K +F C IC + F+  ++L +H  T
Sbjct:  107 TGARPFICKVCGKGFRQASTLCRHKIIHTSERPHICKTCNKSFNRSSTLNTHMRIHQGYKPYKCEICGKGFHQKGNYKNHKLTHNIEK-QFKCPICTKAFHQIYNLTFHMHT 217          

HSP 2 Score: 70.0922 bits (170), Expect = 5.878e-12
Identity = 42/114 (36.84%), Postives = 56/114 (49.12%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            T  R   C+ C K + +S  L  H+RIH   KP++C +C K F  K   KNH  +H   K+F C IC K F+    L  H   H  DK  +VC+ C + F   F L+ H    H
Sbjct:  135 TSERPHICKTCNKSFNRSSTLNTHMRIHQGYKPYKCEICGKGFHQKGNYKNHKLTHNIEKQFKCPICTKAFHQIYNLTFHMHTHT-DKKPYVCQHCSKGFCRNFDLKKHIRKLH 247          

HSP 3 Score: 67.3958 bits (163), Expect = 3.486e-11
Identity = 30/80 (37.50%), Postives = 45/80 (56.25%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKN 1464
            C +CGK F      + H++TH   K+F+CPIC K F Q  ++  HM  H + K ++CQ C K F    ++  HI+ +H N
Sbjct:  170 CEICGKGFHQKGNYKNHKLTHNIEKQFKCPICTKAFHQIYNLTFHMHTHTDKKPYVCQHCSKGFCRNFDLKKHIRKLHAN 249          

HSP 4 Score: 67.0106 bits (162), Expect = 5.053e-11
Identity = 39/107 (36.45%), Postives = 56/107 (52.34%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHY 2160
            + F C  C K +    +LTRH+ +HT  +PF C +C K FR  S L  H   H   +   C+ CNK FN   TL  H ++H+  K  + C+IC +    GFH + +Y
Sbjct:   82 KVFSCPDCGKTFNAHYNLTRHMPVHTGARPFICKVCGKGFRQASTLCRHKIIHTSERPHICKTCNKSFNRSSTLNTHMRIHQGYK-PYKCEICGK----GFHQKGNY 183          

HSP 5 Score: 65.0846 bits (157), Expect = 2.388e-10
Identity = 28/76 (36.84%), Postives = 43/76 (56.58%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            C  CGK F     L RH   HTG + F C +C KGF Q S++  H ++H + +  +C+ C K+F     +NTH+++
Sbjct:   86 CPDCGKTFNAHYNLTRHMPVHTGARPFICKVCGKGFRQASTLCRHKIIHTSERPHICKTCNKSFNRSSTLNTHMRI 161          

HSP 6 Score: 61.2326 bits (147), Expect = 3.169e-9
Identity = 27/73 (36.99%), Postives = 38/73 (52.05%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTH 1443
            C VCGK F+    L RH++ HT  +   C  C K F + S++  HM +H   K + C+ CGK F  + N   H
Sbjct:  114 CKVCGKGFRQASTLCRHKIIHTSERPHICKTCNKSFNRSSTLNTHMRIHQGYKPYKCEICGKGFHQKGNYKNH 186          

HSP 7 Score: 58.151 bits (139), Expect = 3.555e-8
Identity = 29/74 (39.19%), Postives = 38/74 (51.35%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHI 1446
            C  C K+F     L  H   H G K ++C IC KGF QK + K H + H+  K F C  C KAF   +N+  H+
Sbjct:  142 CKTCNKSFNRSSTLNTHMRIHQGYKPYKCEICGKGFHQKGNYKNHKLTHNIEKQFKCPICTKAFHQIYNLTFHM 215          

HSP 8 Score: 57.3806 bits (137), Expect = 6.007e-8
Identity = 37/112 (33.04%), Postives = 57/112 (50.89%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKHA 4572
            P+ C  C+K FNR+S L  H+ +H   +PY+C  C K F  + + K H+ T   ++ K  +C +C K       L  H+  H  +    C+ C KGF    DL +H+ + HA
Sbjct:  139 PHICKTCNKSFNRSSTLNTHMRIHQGYKPYKCEICGKGFHQKGNYKNHKLTH--NIEKQFKCPICTKAFHQIYNLTFHMHTHTDKKPYVCQHCSKGFCRNFDLKKHIRKLHA 248          

HSP 9 Score: 51.9878 bits (123), Expect = 2.978e-6
Identity = 32/105 (30.48%), Postives = 47/105 (44.76%), Query Frame = 1
Query: 4240 YSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH 4554
            +SC  C K FN   NL +H+ VHT  RP+ C  C K FR   +L  H+    S    + +         S   L  H+++H       C++C KGF  + +   H
Sbjct:   84 FSCPDCGKTFNAHYNLTRHMPVHTGARPFICKVCGKGFRQASTLCRHKIIHTSERPHICKTCNKSFNRSS--TLNTHMRIHQGYKPYKCEICGKGFHQKGNYKNH 186          

HSP 10 Score: 50.8322 bits (120), Expect = 7.744e-6
Identity = 31/98 (31.63%), Postives = 46/98 (46.94%), Query Frame = 1
Query: 2377 RLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLCLRRF 2670
            R F C  CGK ++    L  H   H S    ++C+ CNKSF    ++  H+R  H   + + C  C   F  K +   H L H+  K + CP+C + F
Sbjct:  110 RPFICKVCGKGFRQASTLCRHKIIHTSER-PHICKTCNKSFNRSSTLNTHMRI-HQGYKPYKCEICGKGFHQKGNYKNHKLTHNIEKQFKCPICTKAF 205          
BLAST of Zinc finger, C2H2 type vs. Planmine SMEST
Match: SMESG000022971.1 (SMESG000022971.1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.057e-14
Identity = 36/102 (35.29%), Postives = 57/102 (55.88%), Query Frame = 1
Query: 1852 CRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYH 2157
            C FC  +  +   L RH+R+HT ++P +C  C+KSF   S LK H  +H   K + C IC++ F     L  H ++H P++ +  C+IC + F+T   L+ H
Sbjct:  177 CAFCDDVRNRPALLERHLRVHTGERPAKCQQCYKSFANSSTLKQHMNTHTGQKPYICSICDQGFAANSNLAFHMEIHYPERKKHKCRICSKMFSTPSELQSH 278          

HSP 2 Score: 58.5362 bits (140), Expect = 2.856e-8
Identity = 34/101 (33.66%), Postives = 53/101 (52.48%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHW-KLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRF 2130
            TG R  +C+ CYK +  S  L +H+  HT QKP+ C +C + F   S L  H + H+ + K+  C IC+K+F+    L+ H   H      + C+ CD  +
Sbjct:  198 TGERPAKCQQCYKSFANSSTLKQHMNTHTGQKPYICSICDQGFAANSNLAFHMEIHYPERKKHKCRICSKMFSTPSELQSHGYSH-TKVYPYQCEKCDSSY 297          

HSP 3 Score: 56.9954 bits (136), Expect = 9.371e-8
Identity = 26/76 (34.21%), Postives = 37/76 (48.68%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            CA C      P LL RH   HTG +  +C  C K F   S++K HM  H   K ++C  C + F    N+  H+++
Sbjct:  177 CAFCDDVRNRPALLERHLRVHTGERPAKCQQCYKSFANSSTLKQHMNTHTGQKPYICSICDQGFAANSNLAFHMEI 252          

HSP 4 Score: 53.9138 bits (128), Expect = 8.522e-7
Identity = 31/115 (26.96%), Postives = 51/115 (44.35%), Query Frame = 1
Query: 2314 NELLNQPIPIAEIDKRKLSNNRLFKCNHCGKSYKFKKYLNEHLKEHLSANNTNVCQFCNKSFVTYRSMQQHLRTQHLNRRKFSCLQCPAFFITKASLIRHGLVHSNSKPYACPLC 2658
            +++ N+P  + E   R  +  R  KC  C KS+     L +H+  H +     +C  C++ F    ++  H+   +  R+K  C  C   F T + L  HG  H+   PY C  C
Sbjct:  181 DDVRNRP-ALLERHLRVHTGERPAKCQQCYKSFANSSTLKQHMNTH-TGQKPYICSICDQGFAANSNLAFHMEIHYPERKKHKCRICSKMFSTPSELQSHGYSHTKVYPYQCEKC 293          

HSP 5 Score: 51.6026 bits (122), Expect = 4.840e-6
Identity = 26/74 (35.14%), Postives = 38/74 (51.35%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVH-DNVKGFLCQFCGKAFTYEHNMNTH 1443
            C  C K+F     L++H  THTG K + C IC +GF   S++  HM +H    K   C+ C K F+    + +H
Sbjct:  205 CQQCYKSFANSSTLKQHMNTHTGQKPYICSICDQGFAANSNLAFHMEIHYPERKKHKCRICSKMFSTPSELQSH 278          

HSP 6 Score: 50.8322 bits (120), Expect = 6.548e-6
Identity = 34/113 (30.09%), Postives = 52/113 (46.02%), Query Frame = 1
Query: 4219 DCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVH-CKVCYKGFDLQEDLSRH 4554
            +CL +    C+ C    NR + L++HL VHT  RP +C +C K F +  +LK H  T       +           S +A   H+++H  E   H C++C K F    +L  H
Sbjct:  168 NCLRNVLQHCAFCDDVRNRPALLERHLRVHTGERPAKCQQCYKSFANSSTLKQHMNTHTGQKPYICSICDQGFAANSNLAF--HMEIHYPERKKHKCRICSKMFSTPSELQSH 278          
BLAST of Zinc finger, C2H2 type vs. Planmine SMEST
Match: SMESG000079499.1 (SMESG000079499.1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.833e-14
Identity = 43/112 (38.39%), Postives = 61/112 (54.46%), Query Frame = 1
Query: 1831 TGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYST 2166
            TG R F C+ C K +R++  L RH  IHT ++P QC +C KSF   S L  H + H  +K + CE C K F+ K   K H+  H  +K R  C +C + F+  ++L  H  T
Sbjct:  119 TGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEK-RCKCFLCGKAFHQLYNLTSHMHT 229          

HSP 2 Score: 66.6254 bits (161), Expect = 2.091e-11
Identity = 44/138 (31.88%), Postives = 69/138 (50.00%), Query Frame = 1
Query: 1747 GILLSEDVERIDKETGQIQLHEMIKDQVTGFRRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHY 2160
            G L    V R  K +G     + +KDQ     +++C +C K +    +L RH+ +HT  +PF C +C K FR  S L  H   H   +   C++C K FN   TL  H ++H+  K+ + C+ C +    GFH + +Y
Sbjct:   70 GRLFQGSVGR--KGSGNYFSMDKMKDQ-----KYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKM-YHCESCGK----GFHQKGNY 195          

HSP 3 Score: 65.0846 bits (157), Expect = 7.875e-11
Identity = 28/76 (36.84%), Postives = 42/76 (55.26%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKV 1452
            C  C K F     L RH   HTG++ F C +C KGF Q S++  H ++H   +   C+ CGK+F     +NTH+++
Sbjct:   98 CFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRI 173          

HSP 4 Score: 63.1586 bits (152), Expect = 2.824e-10
Identity = 30/80 (37.50%), Postives = 46/80 (57.50%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIHKN 1464
            C VCGK F+    L RH++ HT  +  +C +C K F + S++  H+ +H +VK + C+ CGK F  + N   H K+ H N
Sbjct:  126 CKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNH-KLTHSN 204          

HSP 5 Score: 63.1586 bits (152), Expect = 3.214e-10
Identity = 39/111 (35.14%), Postives = 53/111 (47.75%), Query Frame = 1
Query: 1840 RRFRCRFCYKLYRKSCDLTRHIRIHTQQKPFQCYMCHKSFRLKSVLKNHFKSHWKLKEFSCEICNKIFNLKQTLKVHRQLHEPDKLRFVCKICDRRFNTGFHLRYHYSTSH 2172
            R  +C+ C K + +S  L  H+RIH   K + C  C K F  K   KNH  +H   K   C +C K F+    L  H   H   K  FVC++C++ F   F L+ H   SH
Sbjct:  150 RPHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAK-PFVCRLCNKGFCRNFDLKKHLRKSH 259          

HSP 6 Score: 59.6918 bits (143), Expect = 4.210e-9
Identity = 30/74 (40.54%), Postives = 39/74 (52.70%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHI 1446
            C VCGK+F     L  H   H  +K + C  C KGF QK + K H + H N K   C  CGKAF   +N+ +H+
Sbjct:  154 CKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHM 227          

HSP 7 Score: 53.5286 bits (127), Expect = 4.408e-7
Identity = 37/111 (33.33%), Postives = 55/111 (49.55%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHVDEKH 4569
            P+ C +C K FNR+S L  H+ +H  ++ Y C  C K F  + + K H+ T   S  K  +C LC K       L +H+  H       C++C KGF    DL +H+ + H
Sbjct:  151 PHQCKVCGKSFNRSSTLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNHKLTH--SNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 259          

HSP 8 Score: 53.1434 bits (126), Expect = 7.013e-7
Identity = 25/78 (32.05%), Postives = 40/78 (51.28%), Query Frame = 1
Query: 1225 CAVCGKAFKTPILLRRHEVTHTGIKEFECPICKKGFTQKSSVKIHMVVHDNVKGFLCQFCGKAFTYEHNMNTHIKVIH 1458
            C  CGK F      + H++TH+  K  +C +C K F Q  ++  HM  H+  K F+C+ C K F    ++  H++  H
Sbjct:  182 CESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHMHTHNEAKPFVCRLCNKGFCRNFDLKKHLRKSH 259          

HSP 9 Score: 52.7582 bits (125), Expect = 8.646e-7
Identity = 39/107 (36.45%), Postives = 54/107 (50.47%), Query Frame = 1
Query: 4237 PYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRHV 4557
            P++C +C KGF +AS L +H  +HT  RP+QC  C K F    +L TH    H SV K+  C  C K    +   +NH   H  E    C +C K F    +L+ H+
Sbjct:  123 PFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSSTLNTHVRI-HQSV-KMYHCESCGKGFHQKGNYKNHKLTHSNEKRCKCFLCGKAFHQLYNLTSHM 227          

HSP 10 Score: 50.447 bits (119), Expect = 4.512e-6
Identity = 33/114 (28.95%), Postives = 50/114 (43.86%), Query Frame = 1
Query: 4213 AIDCLLSFPYSCSICHKGFNRASNLQQHLSVHTKLRPYQCPKCPKRFRHRCSLKTHEATKHSSVTXXXXXXXXXXXXXSQVALRNHLKLHVREYSVHCKVCYKGFDLQEDLSRH 4554
            ++D +    Y C  C+K F    NL +HL VHT +RP+ C  C K FR   +L  H+    +      +         S   L  H+++H      HC+ C KGF  + +   H
Sbjct:   87 SMDKMKDQKYQCFYCNKEFTAQYNLARHLPVHTGVRPFTCKVCGKGFRQASTLCRHKIIHTTERPHQCKVCGKSFNRSS--TLNTHVRIHQSVKMYHCESCGKGFHQKGNYKNH 198          
The following BLAST results are available for this feature:
BLAST of Zinc finger, C2H2 type vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF2363.427e-5426.70zinc finger protein 236 [Source:HGNC Symbol;Acc:HG... [more]
ZNF2364.667e-5426.70zinc finger protein 236 [Source:HGNC Symbol;Acc:HG... [more]
ZNF2365.118e-5426.70zinc finger protein 236 [Source:HGNC Symbol;Acc:HG... [more]
ZNF911.927e-4323.77zinc finger protein 91 [Source:HGNC Symbol;Acc:HGN... [more]
ZNF914.631e-4323.77zinc finger protein 91 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y55F3AM.147.665e-2228.02pep chromosome:WBcel235:IV:1058845:1063187:-1 gene... [more]
Y55F3AM.147.665e-2228.02pep chromosome:WBcel235:IV:1058695:1067525:-1 gene... [more]
fezf-11.125e-1741.96FEZ Family zinc finger protein [Source:UniProtKB/... [more]
blmp-14.586e-1534.21B lymphocyte-induced maturation protein 1 homolog ... [more]
blmp-14.654e-1534.21B lymphocyte-induced maturation protein 1 homolog ... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crol3.401e-2825.39gene:FBgn0020309 transcript:FBtr0335476[more]
crol3.401e-2825.39gene:FBgn0020309 transcript:FBtr0305262[more]
crol3.401e-2825.39gene:FBgn0020309 transcript:FBtr0080261[more]
crol2.449e-2624.25gene:FBgn0020309 transcript:FBtr0080262[more]
jim3.130e-2528.45gene:FBgn0027339 transcript:FBtr0333213[more]
back to top
BLAST of Zinc finger, C2H2 type vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf2361.805e-5527.76zinc finger protein 236 [Source:ZFIN;Acc:ZDB-GENE-... [more]
znf2362.827e-5527.12zinc finger protein 236 [Source:ZFIN;Acc:ZDB-GENE-... [more]
znf10262.071e-3724.24zinc finger protein 1026 [Source:ZFIN;Acc:ZDB-GENE... [more]
BX248122.13.227e-3727.89gastrula zinc finger protein XlCGF57.1-like [Sourc... [more]
BX927193.29.533e-3726.56pep chromosome:GRCz11:4:46524666:46648979:-1 gene:... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpr89b3.375e-6526.55G protein-coupled receptor 89B [Source:Xenbase;Acc... [more]
gpr89b2.725e-3932.35G protein-coupled receptor 89B [Source:Xenbase;Acc... [more]
gpr89b2.805e-3932.35G protein-coupled receptor 89B [Source:Xenbase;Acc... [more]
gpr89b3.540e-3932.35G protein-coupled receptor 89B [Source:Xenbase;Acc... [more]
ENSXETT00000016954.12.220e-3624.30Small ubiquitin-related modifier 3 [Source:UniPro... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zfp2362.158e-5629.10zinc finger protein 236 [Source:MGI Symbol;Acc:MGI... [more]
Zfp2362.344e-4133.78zinc finger protein 236 [Source:MGI Symbol;Acc:MGI... [more]
Zfp780b4.115e-3728.21zinc finger protein 780B [Source:MGI Symbol;Acc:MG... [more]
Zfp780b4.115e-3728.21zinc finger protein 780B [Source:MGI Symbol;Acc:MG... [more]
Gm143261.222e-3625.00predicted gene 14326 [Source:MGI Symbol;Acc:MGI:37... [more]
back to top
BLAST of Zinc finger, C2H2 type vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UL36|ZN236_HUMAN2.458e-5326.70Zinc finger protein 236 OS=Homo sapiens OX=9606 GN... [more]
sp|Q05481|ZNF91_HUMAN9.255e-4323.77Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q9Y3M9|ZN337_HUMAN1.005e-3725.77Zinc finger protein 337 OS=Homo sapiens OX=9606 GN... [more]
sp|P08045|XFIN_XENLA1.366e-3423.21Zinc finger protein Xfin OS=Xenopus laevis OX=8355... [more]