ATP-dependent RNA helicase A-like protein

Overview
NameATP-dependent RNA helicase A-like protein
Smed IDSMED30003291
Length (bp)2334
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent RNA helicase A-like protein (SMED30003291) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent RNA helicase A-like protein (SMED30003291) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent RNA helicase A-like protein (SMED30003291) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent RNA helicase A-like protein (SMED30003291) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003291

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30003291SMESG000079969.1 SMESG000075593.1 SMESG000075584.1 Contig340newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003291SMESG000079969.1 SMESG000075593.1 SMESG000075584.1 Contig340uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003291SMESG000056009.1 Contig340newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003291SMESG000056009.1 Contig340uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30003291SMESG000079969.1 dd_Smed_v4_4815_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Human
Match: DHX9 (DExH-box helicase 9 [Source:HGNC Symbol;Acc:HGNC:2750])

HSP 1 Score: 78.1814 bits (191), Expect = 4.430e-14
Identity = 38/113 (33.63%), Postives = 67/113 (59.29%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTNRKR 1348
            IR R I  K M+++ PLQLL+F +KKV    +++++D+W+ L +  E AA I  LR A+E L+V+V   P I+   D  + +++ ++ + S P + G +N  + S  + +  R
Sbjct: 1049 IRTRAISAKGMTLVTPLQLLLFASKKVQSDGQIVLVDDWIKLQISHEAAACITGLRAAMEALVVEVTKQPAIISQLDPVNERMLNMIRQISRPSAAG-INLMIGSTRYGDGPR 1160          
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Celegans
Match: rha-1 (ATP-dependent RNA helicase A [Source:UniProtKB/Swiss-Prot;Acc:Q22307])

HSP 1 Score: 77.411 bits (189), Expect = 3.224e-14
Identity = 34/92 (36.96%), Postives = 61/92 (66.30%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMII-IDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFS 1282
            +R R I CKQMS+I+ +QLL+FG++KV  + + ++ IDE +++ M    AA ++ LRP +E L+VK C NP+ +   +  D+++ +++   S
Sbjct: 1064 VRTRCISCKQMSVISAIQLLVFGSRKVECVGEGLVRIDETITIRMNVSTAAALIGLRPCIEALLVKSCENPESLAGLNPSDAELRQLLRDIS 1155          
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Fly
Match: mle (gene:FBgn0002774 transcript:FBtr0086031)

HSP 1 Score: 86.6557 bits (213), Expect = 5.988e-17
Identity = 38/92 (41.30%), Postives = 64/92 (69.57%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYI-NKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFS 1282
            IR R + CKQ+SM++PLQ+++FG++K+    N ++ +D WL+ D+E ELAA+I AL+PALE L+   C NP  ++  ++  +Q++K+V    
Sbjct: 1056 IRTRAVSCKQLSMVSPLQVILFGSRKIDLAANNIVRVDNWLNFDIEPELAAKIGALKPALEDLITVACDNPSDILRLEEPYAQLVKVVKDLC 1147          
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Fly
Match: mle (gene:FBgn0002774 transcript:FBtr0100576)

HSP 1 Score: 85.1149 bits (209), Expect = 1.471e-16
Identity = 38/88 (43.18%), Postives = 64/88 (72.73%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYI-NKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIV 1270
            IR R + CKQ+SM++PLQ+++FG++K+    N ++ +D WL+ D+E ELAA+I AL+PALE L+   C NP  ++  ++  +Q++K+V
Sbjct:  699 IRTRAVSCKQLSMVSPLQVILFGSRKIDLAANNIVRVDNWLNFDIEPELAAKIGALKPALEDLITVACDNPSDILRLEEPYAQLVKVV 786          
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Zebrafish
Match: dhx9 (DEAH (Asp-Glu-Ala-His) box helicase 9 [Source:ZFIN;Acc:ZDB-GENE-070912-171])

HSP 1 Score: 77.7962 bits (190), Expect = 3.430e-14
Identity = 34/97 (35.05%), Postives = 63/97 (64.95%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFG 1300
            IR R I  K M++++PLQL++FG+KK+T   +++ +D+W+ L +  ++AA +  LR  LE L+V+V  +P+ + N D  + +++ ++   S P S G
Sbjct: 1055 IRTRAISAKSMTLVSPLQLILFGSKKITSNGEVVELDDWIKLQIPHDVAAGVAGLRAGLEALVVEVTKDPEYIRNLDPLNERLLNVIRLVSRPSSAG 1151          
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Xenopus
Match: prpf31 (pre-mRNA processing factor 31 [Source:Xenbase;Acc:XB-GENE-489336])

HSP 1 Score: 77.411 bits (189), Expect = 7.525e-14
Identity = 37/97 (38.14%), Postives = 61/97 (62.89%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFG 1300
            IR R I  K M+M++PLQLL+F +KKV    + I++D+W+ L +  + +A I ALR ALE L+V+V   P+I+   D  + +++ ++   S P + G
Sbjct: 1051 IRTRAISAKGMTMVSPLQLLLFASKKVMSDGEFILLDDWIRLSLPHDESACITALRAALEALVVEVTKEPEILSQLDPVNEKMLNMIRLISKPSTAG 1147          
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Xenopus
Match: prpf31 (pre-mRNA processing factor 31 [Source:Xenbase;Acc:XB-GENE-489336])

HSP 1 Score: 77.0258 bits (188), Expect = 9.157e-14
Identity = 37/97 (38.14%), Postives = 61/97 (62.89%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFG 1300
            IR R I  K M+M++PLQLL+F +KKV    + I++D+W+ L +  + +A I ALR ALE L+V+V   P+I+   D  + +++ ++   S P + G
Sbjct:  990 IRTRAISAKGMTMVSPLQLLLFASKKVMSDGEFILLDDWIRLSLPHDESACITALRAALEALVVEVTKEPEILSQLDPVNEKMLNMIRLISKPSTAG 1086          
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Xenopus
Match: prpf31 (pre-mRNA processing factor 31 [Source:Xenbase;Acc:XB-GENE-489336])

HSP 1 Score: 77.0258 bits (188), Expect = 9.628e-14
Identity = 37/97 (38.14%), Postives = 61/97 (62.89%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFG 1300
            IR R I  K M+M++PLQLL+F +KKV    + I++D+W+ L +  + +A I ALR ALE L+V+V   P+I+   D  + +++ ++   S P + G
Sbjct: 1016 IRTRAISAKGMTMVSPLQLLLFASKKVMSDGEFILLDDWIRLSLPHDESACITALRAALEALVVEVTKEPEILSQLDPVNEKMLNMIRLISKPSTAG 1112          
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Mouse
Match: Dhx9 (DEAH (Asp-Glu-Ala-His) box polypeptide 9 [Source:MGI Symbol;Acc:MGI:108177])

HSP 1 Score: 78.9518 bits (193), Expect = 2.040e-14
Identity = 40/113 (35.40%), Postives = 66/113 (58.41%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTNRKR 1348
            IR R I  K M+++ PLQLL+F +KKV    +++ ID+W+ L +  E AA I ALR A+E L+V+V   P+I+   D  +  ++  + + S P + G +N  + S  + +  R
Sbjct: 1051 IRTRAISAKGMTLVTPLQLLLFASKKVQSDGQIVFIDDWIRLQISHEAAACITALRAAMEALVVEVSKQPNIISQLDPVNEHMLNTIRQISRPSAAG-INLMIGSVRYGDGPR 1162          
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Mouse
Match: Dhx9 (DEAH (Asp-Glu-Ala-His) box polypeptide 9 [Source:MGI Symbol;Acc:MGI:108177])

HSP 1 Score: 78.9518 bits (193), Expect = 2.093e-14
Identity = 40/113 (35.40%), Postives = 66/113 (58.41%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTNRKR 1348
            IR R I  K M+++ PLQLL+F +KKV    +++ ID+W+ L +  E AA I ALR A+E L+V+V   P+I+   D  +  ++  + + S P + G +N  + S  + +  R
Sbjct: 1052 IRTRAISAKGMTLVTPLQLLLFASKKVQSDGQIVFIDDWIRLQISHEAAACITALRAAMEALVVEVSKQPNIISQLDPVNEHMLNTIRQISRPSAAG-INLMIGSVRYGDGPR 1163          
BLAST of ATP-dependent RNA helicase A-like protein vs. UniProt/SwissProt
Match: sp|P24785|MLE_DROME (Dosage compensation regulator OS=Drosophila melanogaster OX=7227 GN=mle PE=1 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 6.003e-16
Identity = 38/92 (41.30%), Postives = 64/92 (69.57%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYI-NKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFS 1282
            IR R + CKQ+SM++PLQ+++FG++K+    N ++ +D WL+ D+E ELAA+I AL+PALE L+   C NP  ++  ++  +Q++K+V    
Sbjct: 1056 IRTRAVSCKQLSMVSPLQVILFGSRKIDLAANNIVRVDNWLNFDIEPELAAKIGALKPALEDLITVACDNPSDILRLEEPYAQLVKVVKDLC 1147          
BLAST of ATP-dependent RNA helicase A-like protein vs. UniProt/SwissProt
Match: sp|Q28141|DHX9_BOVIN (ATP-dependent RNA helicase A OS=Bos taurus OX=9913 GN=DHX9 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.519e-13
Identity = 36/97 (37.11%), Postives = 60/97 (61.86%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFG 1300
            IR R I  K M+++ PLQLL+F +KKV    +++++D+W+ L +  E AA I ALR A+E L+V+V   P I+   D  + +++  + + S P + G
Sbjct: 1046 IRTRAISAKGMTLVTPLQLLLFASKKVQSDGQLVLVDDWIRLQISHEAAACITALRAAMEALVVEVTKQPGIISQLDPVNERMLNTIRQISRPSAAG 1142          
BLAST of ATP-dependent RNA helicase A-like protein vs. UniProt/SwissProt
Match: sp|Q68FK8|DHX9_XENLA (ATP-dependent RNA helicase A protein OS=Xenopus laevis OX=8355 GN=dhx9 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.561e-13
Identity = 50/143 (34.97%), Postives = 75/143 (52.45%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNS-YHHTNRKRKNVQANKPFNQQRGVPNKYRKFESHYNRG 1435
            IR R I  K M+M++PLQLL+F +KKV    + I +D+W+ L M  E +A I ALR ALE L+V+V   P+I+   D  + +++ ++   S P + G      NS +    R  K  + +  F   RG     R +   YN G
Sbjct: 1051 IRTRAISAKGMTMVSPLQLLLFASKKVMSDGEFIHLDDWIKLSMAHEESACITALRAALEALVVEVTKEPEILSQLDPVNEKMLNMIRVISKPSTAGISLVMGNSRFGDGPRPPKMARFDSGFQGNRG-----RGYHGGYNSG 1188          
BLAST of ATP-dependent RNA helicase A-like protein vs. UniProt/SwissProt
Match: sp|Q08211|DHX9_HUMAN (ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4)

HSP 1 Score: 78.1814 bits (191), Expect = 2.127e-13
Identity = 38/113 (33.63%), Postives = 67/113 (59.29%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTNRKR 1348
            IR R I  K M+++ PLQLL+F +KKV    +++++D+W+ L +  E AA I  LR A+E L+V+V   P I+   D  + +++ ++ + S P + G +N  + S  + +  R
Sbjct: 1049 IRTRAISAKGMTLVTPLQLLLFASKKVQSDGQIVLVDDWIKLQISHEAAACITGLRAAMEALVVEVTKQPAIISQLDPVNERMLNMIRQISRPSAAG-INLMIGSTRYGDGPR 1160          
BLAST of ATP-dependent RNA helicase A-like protein vs. UniProt/SwissProt
Match: sp|Q5R874|DHX9_PONAB (ATP-dependent RNA helicase A OS=Pongo abelii OX=9601 GN=DHX9 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.417e-13
Identity = 38/113 (33.63%), Postives = 67/113 (59.29%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTNRKR 1348
            IR R I  K M+++ PLQLL+F +KKV    +++++D+W+ L +  E AA I  LR A+E L+V+V   P I+   D  + +++ ++ + S P + G +N  + S  + +  R
Sbjct: 1049 IRTRAISAKGMTLVTPLQLLLFASKKVQSDGQIVLVDDWIKLQISHEAAACITGLRAAMEALVVEVTKQPAIISQLDPVNERMLNMIRQISRPSAAG-INLMIGSTRYGDGPR 1160          
BLAST of ATP-dependent RNA helicase A-like protein vs. TrEMBL
Match: A0A183VJJ2 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS176 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 8.214e-20
Identity = 68/222 (30.63%), Postives = 111/222 (50.00%), Query Frame = 2
Query:  998 FNI*IRAREIYCKQMSMINPLQLLMFGAKKVTYINK------MIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTN---RKRKNVQANKPFNQQRGVPNK-----------YRKFESHYNR--GP-VRFPSASQNSYEKRNTITEFGE----NSTSNRFPA---SQNSYEKRNTRGNF 1573
            F   IR + + CK +SM+NP+QL++FG +   + N        IIID+W+   M++  AA I ALRPALE L+V+ C+ P+ V +  + D +++ ++ +   P +  P NA  +    T+   +KR  V +N P    R   N            Y ++ + +NR  GP VR  S  Q+ Y + ++ T+F       + +NRFP       S+   N R N+
Sbjct:   10 FTFQIRTQAVSCKGLSMVNPIQLMLFGCRTAVWRNDDSGEKGTIIIDDWIPFRMDYTSAARIFALRPALEALLVRTCLRPEGVTDLQEEDQRVIDVLHQLCSPEALDP-NASFDGMTCTDSPPKKRFAVASNHPLLSGRSRRNTANEDPYSEKQNYGRYANQFNRFGGPDVR--SGGQSGYWQ-DSKTQFSNQRYYQAPTNRFPGNFMGMRSFGANNVRNNY 227          
BLAST of ATP-dependent RNA helicase A-like protein vs. TrEMBL
Match: A0A2R2MKU3 (ATP-dependent RNA helicase A protein OS=Lingula unguis OX=7574 GN=LOC106161283 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.442e-17
Identity = 43/93 (46.24%), Postives = 61/93 (65.59%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDP 1288
            IR R + CKQM+M++P+QLL+F A+ V   N MII+D WL+L M F  AA+I+ALRPALE L ++   +P+    P   D Q+M++    S P
Sbjct:  101 IRTRAVSCKQMTMVSPIQLLIFAARSVKAENGMIILDGWLNLKMPFSQAAKIVALRPALEALNIRATTDPEGTAQPMPLDEQLMQVFRALSRP 193          
BLAST of ATP-dependent RNA helicase A-like protein vs. TrEMBL
Match: A0A1S3IVV0 (ATP-dependent RNA helicase A protein-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106167437 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.525e-17
Identity = 43/93 (46.24%), Postives = 61/93 (65.59%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDP 1288
            IR R + CKQM+M++P+QLL+F A+ V   N MII+D WL+L M F  AA+I+ALRPALE L ++   +P+    P   D Q+M++    S P
Sbjct:  101 IRTRAVSCKQMTMVSPIQLLIFAARSVKAENGMIILDGWLNLKMPFSQAAKIVALRPALEALNIRATTDPEGTAQPMPLDEQLMQVFRALSRP 193          
BLAST of ATP-dependent RNA helicase A-like protein vs. TrEMBL
Match: A0A1S3IUC7 (ATP-dependent RNA helicase A protein-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106167437 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.645e-17
Identity = 43/93 (46.24%), Postives = 61/93 (65.59%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDP 1288
            IR R + CKQM+M++P+QLL+F A+ V   N MII+D WL+L M F  AA+I+ALRPALE L ++   +P+    P   D Q+M++    S P
Sbjct:  101 IRTRAVSCKQMTMVSPIQLLIFAARSVKAENGMIILDGWLNLKMPFSQAAKIVALRPALEALNIRATTDPEGTAQPMPLDEQLMQVFRALSRP 193          
BLAST of ATP-dependent RNA helicase A-like protein vs. TrEMBL
Match: K1QA98 (ATP-dependent RNA helicase A-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10017772 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.080e-17
Identity = 44/93 (47.31%), Postives = 64/93 (68.82%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDP 1288
            IR R + CKQMSM++PLQLLMF A+ VT     I++D+W++L +E+E AA+I+ALRP LE L+V++  NP+ + NP   +  +M  V   S P
Sbjct: 1049 IRTRAVSCKQMSMVSPLQLLMFAARNVTLEEGNIVLDKWINLKIEYEAAAKIVALRPPLEALIVRITNNPEGIQNPGPQEETLMSAVRSLSRP 1141          
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Nematostella
Match: EDO35813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKC8])

HSP 1 Score: 60.077 bits (144), Expect = 1.249e-10
Identity = 28/81 (34.57%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 1040 MSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFS 1282
            M+M+NPLQLL+F + +V     +I +D W+ L M     A ++A+R A++ L+++   NP  +  P   D QI+  V   S
Sbjct:    1 MTMVNPLQLLLFSSSRVLSSKDVICMDNWVQLRMPHAQGAMVVAMRQAIDMLLIRAASNPVSIAEPLPEDEQIINTVKSLS 81          
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Medaka
Match: dhx9 (DExH-box helicase 9 [Source:NCBI gene;Acc:101156199])

HSP 1 Score: 72.7886 bits (177), Expect = 1.088e-12
Identity = 32/97 (32.99%), Postives = 60/97 (61.86%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFG 1300
            IR R I  K M++++PLQLL+F  KK++   +++ +D+W+ L +  E+A  + ALR  LE L+V+V  +P+ +   D  +++++  +   S P + G
Sbjct: 1060 IRTRAISAKGMTLVSPLQLLLFACKKISSNGEIVELDDWIKLRIPHEVAGAVAALRAGLEALVVEVTKDPEYINQMDQSNTRLLNAIRYVSKPSAAG 1156          
BLAST of ATP-dependent RNA helicase A-like protein vs. Planmine SMEST
Match: SMESG000079969.1 (SMESG000079969.1)

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 338/392 (86.22%), Postives = 348/392 (88.78%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTNRKRKNVQANKPFNQQRGVPNKYRKFESHYNRGPVRFPSASQNSYEKRNTITEFGENSTSNRFPASQNSYEKRNTRGNFIPNRFPDSRDSYGKRDTRTEPRGNFTPNRFPASQKSYGNTNIRNESRENFTPYRNSSYARHYKAHNSSSNIPFVARPNSSFIRNQFIGNDNSLHSENYSNEDFN-----PPSN---SSGYSKTSSFDTCYHGNSFDSNHDDMPQYGSGMMYGNTNFQ--SQKSAP-FNNDRALLTGRNPSFDAISQYNRPQTSHTRDPKLLENY 2152
            IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTNRKRKNVQANKPFNQQRGVPNKYRKFESHYNRGPVRFPSASQNSYEKRNTITEFGENSTSNRFPASQNSYEKRNTRGNFIPNRFPDSRDSYGKRDTRTEPRGNFTPNRFPASQKSYGNTNIRNESRENFTPYRNSSYARHYKAHNSSSNIPFVARPNSSFIRNQFIGNDNSLHSENYSNE+FN     P +N   +SGYS T      Y  NSFDSNH +MP YGS M+Y N +       SAP F N+R  LTGR PSF  I+QYN+PQT+    PK  E Y
Sbjct: 1035 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTNRKRKNVQANKPFNQQRGVPNKYRKFESHYNRGPVRFPSASQNSYEKRNTITEFGENSTSNRFPASQNSYEKRNTRGNFIPNRFPDSRDSYGKRDTRTEPRGNFTPNRFPASQKSYGNTNIRNESRENFTPYRNSSYARHYKAHNSSSNIPFVARPNSSFIRNQFIGNDNSLHSENYSNEEFNEDYYTPRANNFLNSGYSNTH-----YQRNSFDSNHGNMPPYGSRMIYDNMDMHMPQMSSAPQFPNNRPFLTGRIPSFSIIAQYNKPQTNEPEAPKTYEMY 1421          
BLAST of ATP-dependent RNA helicase A-like protein vs. Planmine SMEST
Match: SMESG000079969.1 (SMESG000079969.1)

HSP 1 Score: 638.647 bits (1646), Expect = 0.000e+0
Identity = 328/382 (85.86%), Postives = 339/382 (88.74%), Query Frame = 2
Query: 1040 MSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTNRKRKNVQANKPFNQQRGVPNKYRKFESHYNRGPVRFPSASQNSYEKRNTITEFGENSTSNRFPASQNSYEKRNTRGNFIPNRFPDSRDSYGKRDTRTEPRGNFTPNRFPASQKSYGNTNIRNESRENFTPYRNSSYARHYKAHNSSSNIPFVARPNSSFIRNQFIGNDNSLHSENYSNEDFN-----PPSN---SSGYSKTSSFDTCYHGNSFDSNHDDMPQYGSGMMYGNTNFQ--SQKSAP-FNNDRALLTGRNPSFDAISQYNRPQTSHTRDPKLLENY 2152
            MSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTNRKRKNVQANKPFNQQRGVPNKYRKFESHYNRGPVRFPSASQNSYEKRNTITEFGENSTSNRFPASQNSYEKRNTRGNFIPNRFPDSRDSYGKRDTRTEPRGNFTPNRFPASQKSYGNTNIRNESRENFTPYRNSSYARHYKAHNSSSNIPFVARPNSSFIRNQFIGNDNSLHSENYSNE+FN     P +N   +SGYS     +T Y  NSFDSNH +MP YGS M+Y N +       SAP F N+R  LTGR PSF  I+QYN+PQT+    PK  E Y
Sbjct:    1 MSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTNRKRKNVQANKPFNQQRGVPNKYRKFESHYNRGPVRFPSASQNSYEKRNTITEFGENSTSNRFPASQNSYEKRNTRGNFIPNRFPDSRDSYGKRDTRTEPRGNFTPNRFPASQKSYGNTNIRNESRENFTPYRNSSYARHYKAHNSSSNIPFVARPNSSFIRNQFIGNDNSLHSENYSNEEFNEDYYTPRANNFLNSGYS-----NTHYQRNSFDSNHGNMPPYGSRMIYDNMDMHMPQMSSAPQFPNNRPFLTGRIPSFSIIAQYNKPQTNEPEAPKTYEMY 377          
BLAST of ATP-dependent RNA helicase A-like protein vs. Planmine SMEST
Match: SMESG000079969.1 (SMESG000079969.1)

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 326/380 (85.79%), Postives = 337/380 (88.68%), Query Frame = 2
Query: 1046 MINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTNRKRKNVQANKPFNQQRGVPNKYRKFESHYNRGPVRFPSASQNSYEKRNTITEFGENSTSNRFPASQNSYEKRNTRGNFIPNRFPDSRDSYGKRDTRTEPRGNFTPNRFPASQKSYGNTNIRNESRENFTPYRNSSYARHYKAHNSSSNIPFVARPNSSFIRNQFIGNDNSLHSENYSNEDFN-----PPSN---SSGYSKTSSFDTCYHGNSFDSNHDDMPQYGSGMMYGNTNFQ--SQKSAP-FNNDRALLTGRNPSFDAISQYNRPQTSHTRDPKLLENY 2152
            MINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTNRKRKNVQANKPFNQQRGVPNKYRKFESHYNRGPVRFPSASQNSYEKRNTITEFGENSTSNRFPASQNSYEKRNTRGNFIPNRFPDSRDSYGKRDTRTEPRGNFTPNRFPASQKSYGNTNIRNESRENFTPYRNSSYARHYKAHNSSSNIPFVARPNSSFIRNQFIGNDNSLHSENYSNE+FN     P +N   +SGYS     +T Y  NSFDSNH +MP YGS M+Y N +       SAP F N+R  LTGR PSF  I+QYN+PQT+    PK  E Y
Sbjct:    1 MINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTNRKRKNVQANKPFNQQRGVPNKYRKFESHYNRGPVRFPSASQNSYEKRNTITEFGENSTSNRFPASQNSYEKRNTRGNFIPNRFPDSRDSYGKRDTRTEPRGNFTPNRFPASQKSYGNTNIRNESRENFTPYRNSSYARHYKAHNSSSNIPFVARPNSSFIRNQFIGNDNSLHSENYSNEEFNEDYYTPRANNFLNSGYS-----NTHYQRNSFDSNHGNMPPYGSRMIYDNMDMHMPQMSSAPQFPNNRPFLTGRIPSFSIIAQYNKPQTNEPEAPKTYEMY 375          
BLAST of ATP-dependent RNA helicase A-like protein vs. Planmine SMEST
Match: SMESG000079975.1 (SMESG000079975.1)

HSP 1 Score: 484.182 bits (1245), Expect = 6.758e-154
Identity = 268/402 (66.67%), Postives = 285/402 (70.90%), Query Frame = 2
Query: 1010 IRAREIYCKQMSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTNRKRKNVQANKPFNQQRGVPNKYRKFESHYNRGPVRFPSASQNSYEKRNTITEFGENSTSNRFPASQNSYEKRNTRGNFIPNRFPDSRDSYGKRDTRTEPRGNFTPNRFP-ASQKSYGNTNIRNESRENFTPYRNSSYARHYKAHNSSSNIPFVARPNSSFIRNQFIGNDNSLHSENYSNEDFNPPSNSSGYSKTSSFDTCYHGNSFDSNHDDMPQYGSGMMYGNTNFQSQKSAPFNNDRALLTGRNPSFDAISQYNRPQTSHTRDPKLLENYRGNLSDFNPVAMPQNSSFNR 2212
            IR R I CKQMSMINPLQLLMFGA+KVTY NK+II+DEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDD+DSQIM IVTK SDP   G          H      N   N PFN++R            +N  P R                           P +QN       RG  +PN++     +Y         RG   P RFP ASQ S+ N NIR+E R NFTP RN +Y+R       +SNIPFV RPNSSFIRNQF GNDNS HSENYSNEDFNPPSNSSGYSKTSSFDTCYHGNSFDSNHDDMPQYGSGMMYGNTNFQSQKSAPFNNDRALLTGRNPSFDAISQYNRPQTSHTRDPKLLENYRGNLSDFNPVAMPQNSSFNR
Sbjct: 1036 IRTRAISCKQMSMINPLQLLMFGARKVTYTNKIIILDEWLSLDMEFELAAEILALRPALEGLMVKVCMNPDIVMNPDDNDSQIMNIVTKLSDPAVCG----------HGKAASSN---NLPFNRKR-----------QFNWQPNR---------------------------PFTQN-------RG--VPNKYRGFESNY--------TRG---PVRFPSASQNSFENRNIRSEPRGNFTPNRNFAYSRPL-----NSNIPFVERPNSSFIRNQFTGNDNSFHSENYSNEDFNPPSNSSGYSKTSSFDTCYHGNSFDSNHDDMPQYGSGMMYGNTNFQSQKSAPFNNDRALLTGRNPSFDAISQYNRPQTSHTRDPKLLENYRGNLSDFNPVAMPQNSSFNR 1361          
The following BLAST results are available for this feature:
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DHX94.430e-1433.63DExH-box helicase 9 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rha-13.224e-1436.96ATP-dependent RNA helicase A [Source:UniProtKB/Sw... [more]
back to top
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mle5.988e-1741.30gene:FBgn0002774 transcript:FBtr0086031[more]
mle1.471e-1643.18gene:FBgn0002774 transcript:FBtr0100576[more]
back to top
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dhx93.430e-1435.05DEAH (Asp-Glu-Ala-His) box helicase 9 [Source:ZFIN... [more]
back to top
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prpf317.525e-1438.14pre-mRNA processing factor 31 [Source:Xenbase;Acc:... [more]
prpf319.157e-1438.14pre-mRNA processing factor 31 [Source:Xenbase;Acc:... [more]
prpf319.628e-1438.14pre-mRNA processing factor 31 [Source:Xenbase;Acc:... [more]
back to top
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Dhx92.040e-1435.40DEAH (Asp-Glu-Ala-His) box polypeptide 9 [Source:M... [more]
Dhx92.093e-1435.40DEAH (Asp-Glu-Ala-His) box polypeptide 9 [Source:M... [more]
back to top
BLAST of ATP-dependent RNA helicase A-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P24785|MLE_DROME6.003e-1641.30Dosage compensation regulator OS=Drosophila melano... [more]
sp|Q28141|DHX9_BOVIN1.519e-1337.11ATP-dependent RNA helicase A OS=Bos taurus OX=9913... [more]
sp|Q68FK8|DHX9_XENLA1.561e-1334.97ATP-dependent RNA helicase A protein OS=Xenopus la... [more]
sp|Q08211|DHX9_HUMAN2.127e-1333.63ATP-dependent RNA helicase A OS=Homo sapiens OX=96... [more]
sp|Q5R874|DHX9_PONAB2.417e-1333.63ATP-dependent RNA helicase A OS=Pongo abelii OX=96... [more]
back to top
BLAST of ATP-dependent RNA helicase A-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183VJJ28.214e-2030.63Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A2R2MKU31.442e-1746.24ATP-dependent RNA helicase A protein OS=Lingula un... [more]
A0A1S3IVV01.525e-1746.24ATP-dependent RNA helicase A protein-like isoform ... [more]
A0A1S3IUC71.645e-1746.24ATP-dependent RNA helicase A protein-like isoform ... [more]
K1QA984.080e-1747.31ATP-dependent RNA helicase A-like protein OS=Crass... [more]
back to top
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO358131.249e-1034.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent RNA helicase A-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dhx91.088e-1232.99DExH-box helicase 9 [Source:NCBI gene;Acc:10115619... [more]
back to top
BLAST of ATP-dependent RNA helicase A-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000079969.10.000e+086.22SMESG000079969.1[more]
SMESG000079969.10.000e+085.86SMESG000079969.1[more]
SMESG000079969.10.000e+085.79SMESG000079969.1[more]
SMESG000079975.16.758e-15466.67SMESG000079975.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003291 ID=SMED30003291|Name=ATP-dependent RNA helicase A-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2334bp
GGAAAGGTATTTTCGAAATAAATTTTATAATCGAATGATTTTTATTTGTT
TTTTTCTGTTGTGAGAATTGAATTTTTTTATTCATTTTATCTATCTTTAT
TTAAACAAAAAATCAATTCATTTAAACAAAAGTTTAATTTTTACCCCCAT
CTCAATAAAAAGAAAAATAATTTACTCCTCGATGTTAACACTATAATTAG
GGATATTTAGGTTGGGATAATGTGTCGGTTTGTCACTAATAGCTATAGTA
ATTTAATATTTAAAAGAGATTTTTTATCCTCAAATAGTCGGGAAATGTGA
TATGATTAAGATGTCATCCTTCATTGCCCATTAATTTAATAAATAGATGG
TTTCGTTTTCCGGAACATTCCCCCATTAGTCACACAGGGTCATAAGCCAT
AAAAATAATCAATGTTTATAAAACAATGTGGTCGTCTAATATACCGAAGT
GTTCAGTGATTATAACGTGTTATTGTTTTATAGAATATCAGGTGACGTCA
CATTTCTAAAATACCCGTCCACACAGATTTTTGACCCTCTTATCTTTATG
CGTGTGACGTGGATTTATGAATATGGATTCTAAGTAAAGTCAATAATATT
TTCAAACTATTCTGGCATATTTTAAAAAATATGACCGATAATGATTTCTT
TTAGCTTTTCCGATATTTTTCACTACGTTCCAAAATATTATGATTCCTTA
TATAAGCTCTACACTACAATTCATCAACCAGTGTTTTATTATAACAATCG
AAGAACAATATTTATTTTAATTAAGTTTTTTCCACATAATATAAAAATCG
ATATTGCACATTTTTCTTTGTTTTTATTATGGAATTTTTAAACGCTGCTG
ATAAATTTTTACATCGCGTGGAATTTGCTACACGGGCTTGGGCGAAAATA
AATCATTTCTTTATCTGCAAACTGATTATTGCTACCTTTGTTGTCAATGA
TCTGTCGAAAACTTTTCTCAAGAGTGATTATTGATTGTTAGAAATATTTT
AATATTTAGATCAGAGCTCGAGAAATATATTGCAAGCAAATGTCCATGAT
TAATCCACTTCAGCTTCTTATGTTTGGAGCCAAAAAAGTTACTTATATCA
ATAAAATGATTATTATCGATGAATGGTTGTCATTGGATATGGAATTTGAA
TTGGCTGCAGAAATTCTAGCTCTCAGACCAGCCTTAGAGGGATTAATGGT
GAAAGTTTGTATGAATCCAGATATAGTTATGAATCCCGATGATCACGATA
GTCAAATCATGAAAATAGTTACAAAATTCAGTGATCCTATTAGTTTTGGG
CCTGTAAATGCCCCTCTCAATAGTTATCATCATACAAACAGAAAGAGGAA
AAATGTGCAAGCTAATAAACCATTTAATCAACAACGAGGTGTCCCAAATA
AATATAGGAAATTCGAATCCCATTATAATCGAGGTCCAGTTCGTTTTCCA
TCAGCTTCTCAAAATTCCTACGAAAAAAGAAATACCATAACTGAATTTGG
AGAAAATTCCACTTCAAATCGATTTCCAGCCTCTCAAAATTCCTATGAAA
AAAGAAATACCAGAGGAAATTTCATTCCAAATCGATTTCCAGATTCTCGA
GATTCCTATGGCAAAAGAGATACCAGAACTGAACCAAGAGGAAATTTCAC
TCCAAATCGATTCCCAGCTTCTCAAAAGTCCTATGGAAATACAAATATCA
GAAATGAATCTAGAGAAAATTTTACTCCTTATAGAAACTCTTCTTATGCG
CGTCATTACAAAGCACATAATTCCAGTAGTAACATCCCGTTTGTCGCTAG
GCCAAATTCCAGTTTCATTAGAAATCAATTTATTGGCAATGATAACAGCT
TACATTCTGAAAATTACTCAAATGAAGATTTTAATCCCCCGTCAAACAGT
TCGGGTTATTCAAAAACTAGTTCATTTGACACTTGCTATCATGGAAATTC
ATTTGATTCTAATCATGACGATATGCCACAATATGGATCTGGTATGATGT
ATGGTAATACGAATTTTCAATCTCAAAAATCAGCTCCTTTTAATAATGAT
CGCGCACTCCTAACCGGTAGAAATCCATCATTTGATGCAATATCTCAATA
CAACAGGCCCCAGACAAGTCATACACGAGACCCCAAGCTCCTAGAAAACT
ATCGGGGAAATTTGTCTGATTTTAATCCTGTTGCTATGCCGCAAAATTCT
AGTTTCAATAGAAATCAATTTATTGGCGGTGATAATAATGATTTTAATGG
TGGGCAAACTGATTTATAAATTCTGTGTACTCAGAAGCAAACTTAGTTTT
AATTGTTATTTTGTTATTAATTACATATTATTCA
back to top

protein sequence of SMED30003291-orf-1

>SMED30003291-orf-1 ID=SMED30003291-orf-1|Name=SMED30003291-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=410bp
MSMINPLQLLMFGAKKVTYINKMIIIDEWLSLDMEFELAAEILALRPALE
GLMVKVCMNPDIVMNPDDHDSQIMKIVTKFSDPISFGPVNAPLNSYHHTN
RKRKNVQANKPFNQQRGVPNKYRKFESHYNRGPVRFPSASQNSYEKRNTI
TEFGENSTSNRFPASQNSYEKRNTRGNFIPNRFPDSRDSYGKRDTRTEPR
GNFTPNRFPASQKSYGNTNIRNESRENFTPYRNSSYARHYKAHNSSSNIP
FVARPNSSFIRNQFIGNDNSLHSENYSNEDFNPPSNSSGYSKTSSFDTCY
HGNSFDSNHDDMPQYGSGMMYGNTNFQSQKSAPFNNDRALLTGRNPSFDA
ISQYNRPQTSHTRDPKLLENYRGNLSDFNPVAMPQNSSFNRNQFIGGDNN
DFNGGQTDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
GO:0004386helicase activity
GO:0005524ATP binding
GO:0008026ATP-dependent helicase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 151..172