alpha-1,2-Mannosidase

Overview
Namealpha-1,2-Mannosidase
Smed IDSMED30003288
Length (bp)1877
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of alpha-1,2-Mannosidase (SMED30003288) t-SNE clustered cells

Violin plots show distribution of expression levels for alpha-1,2-Mannosidase (SMED30003288) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of alpha-1,2-Mannosidase (SMED30003288) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for alpha-1,2-Mannosidase (SMED30003288) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of alpha-1,2-Mannosidase vs. Ensembl Human
Match: EDEM2 (ER degradation enhancing alpha-mannosidase like protein 2 [Source:HGNC Symbol;Acc:HGNC:15877])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 298/553 (53.89%), Postives = 389/553 (70.34%), Query Frame = 3
Query:  111 VKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQMSLDRNVADGVGLPEMAAPPNMPLSAAPSDGLSTFTVADRYSTLLSCPNSKFHFKFMIYGEM 1769
            VK MF  AYD+Y+++AFP DEL+PLTC G DTWGSFSL+L+D+LDTL+++GN +EF+R +++L   ++ + ++N SVFETNIRVVGGLLSAHLLSK+AGVE+E GWPCSGPLLRM+E  ARKLLPAF T TGMP+GTVNL  GV  GET +TCTAG+ TF++EF  L+ LTGDPVFE VA  AL  +W  RS +GLVGNHIDV+ GKW A D+GIGAGVDSYFEYL+KG++L +  +L  MF EY + I  Y R DDW+ WV M K +VSMPVFQSLEA+WPGL ++ GD++ A+RT  NY+ VWKQFG  PEF+++ +G  +++R  YPLRPELIES MY+YRAT DP +L++G D + SI+ ++K  CG+ATI D+R H+L+NRMESFFLAET KYLYLLFD  NF+H   +           +   GEC++  GGYIFNTEAHPIDP AL+CC  +  ++  +++ + R +          Y +  ++    +N     G  E  A P    S    D       A +   LLSCP+  F  K  + G++
Sbjct:   39 VKAMFYHAYDSYLENAFPFDELRPLTCDGHDTWGSFSLTLIDALDTLLILGNVSEFQRVVEVLQDSVDFDIDVNASVFETNIRVVGGLLSAHLLSKKAGVEVEAGWPCSGPLLRMAEEAARKLLPAFQTPTGMPYGTVNLLHGVNPGETPVTCTAGIGTFIVEFATLSSLTGDPVFEDVARVALMRLWESRSDIGLVGNHIDVLTGKWVAQDAGIGAGVDSYFEYLVKGAILLQDKKLMAMFLEYNKAIRNYTRFDDWYLWVQMYKGTVSMPVFQSLEAYWPGLQSLIGDIDNAMRTFLNYYTVWKQFGGLPEFYNIPQGYTVEKREGYPLRPELIESAMYLYRATGDPTLLELGRDAVESIEKISKVECGFATIKDLRDHKLDNRMESFFLAETVKYLYLLFDPTNFIHNNGSTFD------AVITPYGECILGAGGYIFNTEAHPIDPAALHCCQ-RLKEEQWEVEDLMREF----------YSLKRSRSKFQKNTVSS-GPWEPPARPGTLFSPENHDQARERKPAKQKVPLLSCPSQPFTSKLALLGQV 573          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Human
Match: EDEM2 (ER degradation enhancing alpha-mannosidase like protein 2 [Source:HGNC Symbol;Acc:HGNC:15877])

HSP 1 Score: 543.502 bits (1399), Expect = 0.000e+0
Identity = 265/504 (52.58%), Postives = 346/504 (68.65%), Query Frame = 3
Query:  258 MGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQMSLDRNVADGVGLPEMAAPPNMPLSAAPSDGLSTFTVADRYSTLLSCPNSKFHFKFMIYGEM 1769
            +GN +EF+R +++L   ++ + ++N SVFETNIRVVGGLLSAHLLSK+AGVE+E GWPCSGPLLRM+E  ARKLLPAF T TGMP+GTVNL  GV  GET +TCTAG+ TF++EF  L+ LTGDPVFE VA  AL  +W  RS +GLVGNHIDV+ GKW A D+GIGAGVDSYFEYL+KG++L +  +L  MF EY + I  Y R DDW+ WV M K +VSMPVFQSLEA+WPGL ++ GD++ A+RT  NY+ VWKQFG  PEF+++ +G  +++R  YPLRPELIES MY+YRAT DP +L++G D + SI+ ++K  CG+ATI D+R H+L+NRMESFFLAET KYLYLLFD  NF+H   +           +   GEC++  GGYIFNTEAHPIDP AL+CC  +  ++  +++ + R +          Y +  ++    +N     G  E  A P    S    D       A +   LLSCP+  F  K  + G++
Sbjct:   51 LGNVSEFQRVVEVLQDSVDFDIDVNASVFETNIRVVGGLLSAHLLSKKAGVEVEAGWPCSGPLLRMAEEAARKLLPAFQTPTGMPYGTVNLLHGVNPGETPVTCTAGIGTFIVEFATLSSLTGDPVFEDVARVALMRLWESRSDIGLVGNHIDVLTGKWVAQDAGIGAGVDSYFEYLVKGAILLQDKKLMAMFLEYNKAIRNYTRFDDWYLWVQMYKGTVSMPVFQSLEAYWPGLQSLIGDIDNAMRTFLNYYTVWKQFGGLPEFYNIPQGYTVEKREGYPLRPELIESAMYLYRATGDPTLLELGRDAVESIEKISKVECGFATIKDLRDHKLDNRMESFFLAETVKYLYLLFDPTNFIHNNGSTFD------AVITPYGECILGAGGYIFNTEAHPIDPAALHCCQ-RLKEEQWEVEDLMREF----------YSLKRSRSKFQKNTVSS-GPWEPPARPGTLFSPENHDQARERKPAKQKVPLLSCPSQPFTSKLALLGQV 536          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Human
Match: EDEM1 (ER degradation enhancing alpha-mannosidase like protein 1 [Source:HGNC Symbol;Acc:HGNC:18967])

HSP 1 Score: 317.39 bits (812), Expect = 7.399e-99
Identity = 195/450 (43.33%), Postives = 277/450 (61.56%), Query Frame = 3
Query:   90 MKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLL---SKRAGVELEPGWPCSGPLLRMSEAFARKLLPAF-NTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSK-LGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMR---------HDDWHFWVNMDKASVSM--PVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTT 1352
            M+ LA   + MF F YDNY+ HAFP DEL P+ C G+             D  G++SL+LVD+LDTL +MGN +EF++A+KL++  ++ +K+  V VFE  IRV+G LLSAH +   SK+   ++         LL M+   A +LLPAF NT TG+P+  VNL++GVP    + TCTAG  + ++EFG L++L GD  FE VA RA+ A+WN RS   GL+GN +++  G W    SG+GAG+DS++EYLLK  +LF   E  EMF+   + I  Y+R           D   +VN++  S  +      SL+AF+PGL  + GD+E A+     Y+ +WK++G  PE ++     P      YPLRPEL+ES   +Y+AT++P  L +G+DI++S++   K  CGYAT++ V     E+RMESFFL+ET KYLYLLFDEDN +H   T
Sbjct:  130 MRDLA---RGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQPFGDMTIK-DYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDTNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERYNWQLQAP--DVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSTEDRMESFFLSETCKYLYLLFDEDNPVHKSGT 573          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Human
Match: EDEM1 (ER degradation enhancing alpha-mannosidase like protein 1 [Source:HGNC Symbol;Acc:HGNC:18967])

HSP 1 Score: 276.559 bits (706), Expect = 1.225e-86
Identity = 155/369 (42.01%), Postives = 225/369 (60.98%), Query Frame = 3
Query:  258 MGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLL---SKRAGVELEPGWPCSGPLLRMSEAFARKLLPAF-NTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSK-LGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDD-----------WHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLL 1316
            MGN +EF++A+KL++  ++ +K+  V VFE  IRV+G LLSAH +   SK+   ++         LL M+   A +LLPAF NT TG+P+  VNL++GVP    + TCTAG  + ++EFG L++L GD  FE VA RA+ A+WN RS   GL+GN +++  G W    SG+GAG+DS++EYLLK  +LF   E  EMF+   + I  Y+R               +  VNM    +      SL+AF+PGL  + GD+E A+     Y+ +WK++G  PE ++     P      YPLRPEL+ES   +Y+AT++P  L +G+DI++S++   K  CGYAT++ V     E+RMESFFL+ET KYLYL+
Sbjct:    1 MGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQPFGDMTIK-DYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDTNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERYNWQLQAP--DVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSTEDRMESFFLSETCKYLYLV 366          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Human
Match: EDEM3 (ER degradation enhancing alpha-mannosidase like protein 3 [Source:HGNC Symbol;Acc:HGNC:16787])

HSP 1 Score: 275.789 bits (704), Expect = 4.222e-81
Identity = 185/479 (38.62%), Postives = 268/479 (55.95%), Query Frame = 3
Query:   78 NQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLS---KRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVP-----IGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLG-LVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVF-QSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH 1448
            ++ + + L  +V EMF  AY NY++HA+P DEL PLTC G+            D  G FSL+L+DSLDTLVV+    EF  A++ +++ +N + ++ VSVFETNIRV+GGLL  H L+   K  G  ++  W  +  LL+M++    KLLPAFNT++G+P+  +NL+ G+       G  + TCTA   T +LEF AL++ TG  +FE  A +AL  +W  R +   LVG  I++  G W   DSG+GAG+DSY+EYLLK  VL       E F+ +   I +Y+        V++ K  ++   +  +L AF+PGL  + GD+  A+ T    +QV K+  F PE F+        Q   +PLRPE  ES  ++Y+AT DP  L++G  ++ ++   A+  CG+A + DVRT   E+RM+SFFLAE  KYLYLLF                           + + D   YIF TEAH
Sbjct:    2 SREEKQKLGNQVLEMFDHAYGNYMEHAYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNKTKEFEDAVRKVLRDVNLDNDVVVSVFETNIRVLGGLLGGHSLAIMLKEKGEYMQ--W-YNDELLQMAKQLGYKLLPAFNTTSGLPYPRINLKFGIRKPEARTGTETDTCTACAGTLILEFAALSRFTGATIFEEYARKALDFLWEKRQRSSNLVGVTINIHTGDWVRKDSGVGAGIDSYYEYLLKAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDALLAFFPGLQVLKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQ---HPLRPEFAESTYFLYKATGDPYYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLF-----------------------ADKEDIIFDIEDYIFTTEAH 451          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Celegans
Match: F10C2.5 (alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:P90830])

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 274/468 (58.55%), Postives = 363/468 (77.56%), Query Frame = 3
Query:  108 EVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAG---VELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDY-QVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKD 1499
            +V++MF  AY+ Y+ HAFPLDEL+P+TC GQDTWGSFSLSL+D+LDTL+VMGN TEFRRA+ L++++   + N+NVSVFETNIRVVGGL+SAH+L+ R     V+ E G+PC  PLL+++   A +L+PAFNT TGMP+GTVNL+ GV   ET ITCTAGV TF++EFG L++LTGD  +E VAL+AL A+W+ RS +GLVGNHI+V  G+WTATDSGIGAGVDSYFEYL KG+ LFRRP L + F E+   INK++R  +W  WV+M K SVS+P+FQSLEAFWPG LTM GD++ A R +  Y +V +++GF PEF+++   EP ++R ++PLRPE++ES+MY+YRAT+D   L++G +++ +I++ A+T CGYATI +V+ H +E+RMESFFLAETTKYLYLLFD  NF+      HS+ D  +++       CVI GGGYIFNTEAHP+DPG L CCS +  +D
Sbjct:   45 KVQKMFYHAYNGYLDHAFPLDELKPITCVGQDTWGSFSLSLIDALDTLLVMGNTTEFRRAVSLVLEKARDDANVNVSVFETNIRVVGGLISAHMLAGRHKDLVVDWE-GYPCDSPLLKLAVKMADRLMPAFNTETGMPYGTVNLKYGVHKDETPITCTAGVGTFLIEFGTLSRLTGDDKYEKVALKALDALWSTRSPIGLVGNHINVQTGQWTATDSGIGAGVDSYFEYLAKGAYLFRRPSLMKQFHEHATSINKHVRKGEWFMWVSMAKGSVSLPIFQSLEAFWPGTLTMVGDVQDASRIMLTYSEVIRKYGFPPEFYNIHNEEPGEKRAAFPLRPEMVESLMYLYRATKDETWLELGAEMIDAIESSARTKCGYATINNVKEHSIEDRMESFFLAETTKYLYLLFDPTNFI------HSKGDQARILTSPKNLTCVIYGGGYIFNTEAHPVDPGMLDCCSVQAKRD 505          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Celegans
Match: C47E12.3 (alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:Q18679])

HSP 1 Score: 320.087 bits (819), Expect = 3.067e-102
Identity = 182/443 (41.08%), Postives = 275/443 (62.08%), Query Frame = 3
Query:   87 DMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCS--GPLLRMSEAFARKLLPAFN-TSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKL-GLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMR---------HDDWHFWVNMDK--ASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDN 1331
            D++    + +EMFQF +DNY++HAFP DEL P+ C G+             D  G +SL L+D+LD+LVV G+  EF+RA+ L++K ++  KN  V VFE+ IRV+GGLL+AH+++        P +     G LL ++   A +LLPAF+ T+TG+P+  +NLQ G+  G T+ TCT+G  + +LEFG L++L GD  +E +A R    +WN R+++ GL GN ID+  G+W    +G+GAG+DS++EY+LK  +LF      +M++E   RI  YMR           D   +VN+D    S S     SL+A + G+L +AG+++ AV     Y+ +WK++G  PE F+     P    + YPLRPE +ES   +Y AT++P    +G++I+ S++T+ +  CG+AT++DV    LE+RMESFFL+ET KYLYLLFD D+
Sbjct:   43 DLQYGLAKTREMFQFGWDNYMEHAFPADELDPIHCRGRGHDHDNPDNINVNDVLGDYSLGLIDTLDSLVVFGDADEFKRAVNLVIKTVSFEKNTTVQVFESTIRVMGGLLAAHMIAADKTNRFGPFYMSDYGGELLTLAHDLAGRLLPAFDGTATGIPYTRINLQKGILPGTTNSTCTSGAGSLLLEFGVLSKLLGDDTYERLARRVNEKLWNLRNEVTGLHGNLIDIQTGEWLGHLAGLGAGIDSFYEYMLKSYILFGNQRDLDMYNESFARITTYMRRGRSRCSSLEGDIPIYVNVDSRDGSTSNTWIDSLQASFAGVLVLAGEVDEAVCHHALYYAIWKKYGVLPERFNWQLQAP--DVSFYPLRPEFVESTYLLYTATKNPFYQHVGLEILDSLETITRVKCGFATVHDVIDGSLEDRMESFFLSETLKYLYLLFDVDH 483          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Celegans
Match: C47E12.3 (alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:Q18679])

HSP 1 Score: 318.546 bits (815), Expect = 9.228e-101
Identity = 182/443 (41.08%), Postives = 275/443 (62.08%), Query Frame = 3
Query:   87 DMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCS--GPLLRMSEAFARKLLPAFN-TSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKL-GLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMR---------HDDWHFWVNMDK--ASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDN 1331
            D++    + +EMFQF +DNY++HAFP DEL P+ C G+             D  G +SL L+D+LD+LVV G+  EF+RA+ L++K ++  KN  V VFE+ IRV+GGLL+AH+++        P +     G LL ++   A +LLPAF+ T+TG+P+  +NLQ G+  G T+ TCT+G  + +LEFG L++L GD  +E +A R    +WN R+++ GL GN ID+  G+W    +G+GAG+DS++EY+LK  +LF      +M++E   RI  YMR           D   +VN+D    S S     SL+A + G+L +AG+++ AV     Y+ +WK++G  PE F+     P    + YPLRPE +ES   +Y AT++P    +G++I+ S++T+ +  CG+AT++DV    LE+RMESFFL+ET KYLYLLFD D+
Sbjct:   43 DLQYGLAKTREMFQFGWDNYMEHAFPADELDPIHCRGRGHDHDNPDNINVNDVLGDYSLGLIDTLDSLVVFGDADEFKRAVNLVIKTVSFEKNTTVQVFESTIRVMGGLLAAHMIAADKTNRFGPFYMSDYGGELLTLAHDLAGRLLPAFDGTATGIPYTRINLQKGILPGTTNSTCTSGAGSLLLEFGVLSKLLGDDTYERLARRVNEKLWNLRNEVTGLHGNLIDIQTGEWLGHLAGLGAGIDSFYEYMLKSYILFGNQRDLDMYNESFARITTYMRRGRSRCSSLEGDIPIYVNVDSRDGSTSNTWIDSLQASFAGVLVLAGEVDEAVCHHALYYAIWKKYGVLPERFNWQLQAP--DVSFYPLRPEFVESTYLLYTATKNPFYQHVGLEILDSLETITRVKCGFATVHDVIDGSLEDRMESFFLSETLKYLYLLFDVDH 483          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Celegans
Match: ZC506.1 (alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:Q09641])

HSP 1 Score: 288.5 bits (737), Expect = 4.208e-86
Identity = 174/429 (40.56%), Postives = 255/429 (59.44%), Query Frame = 3
Query:   87 DMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCS--GPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVP--IGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLG-LVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVF-QSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLF 1319
            D K L  E  +MF   Y++Y+ +AFP DEL PL+C G+            D  G+FS++L+DSLDTLVVM    EF +A+ L++K +  + +  VSVFETNIRV+GGL+SAH+L++    E  P    +    LL+M+     +LLPAFNT++G+PF  +NL+ G+   +     TCTA   T +LEF ALT LTGDP++E  A +A+  +W  R +   L+G  ++V  G WT  +SGIGAG+DSY+EY LK  +L       + F+++   I +Y+        V+M + +V+   F  SL AFWPGL  + GD++ A+       QV ++  F PE F+    +       +P+RPE +ES  ++YRAT+DP  L +   IM SI    K  CG+A + D+RT   E++MESF L+ET KYLY++F
Sbjct:   25 DKKKLQKEAYDMFMHGYNSYMNYAFPADELMPLSCKGRIRGVTPSRGDVDDVLGNFSVTLLDSLDTLVVMNELDEFEKAIDLVIKHVRFDSDHVVSVFETNIRVLGGLISAHVLAELVK-EKYPNRLTTYDNQLLKMATEVGNRLLPAFNTTSGLPFSRINLKHGMQDHLKRQKDTCTACGGTMILEFAALTSLTGDPIYEKKARKAMDFLWQQRHRSSDLMGTVLNVHSGDWTRRESGIGAGIDSYYEYTLKAYILLGDESYLDRFNKHYEAIKRYINKGPIFVDVHMHRPTVATRGFMDSLLAFWPGLQVLKGDVKEAIEMHEMLFQVIQKHKFLPEAFT---HDFQVHWAEHPIRPEFVESTYFLYRATKDPHYLHVAKQIMDSINKYVKVPCGFAALKDIRTMVKEDQMESFVLSETFKYLYMIF 449          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Celegans
Match: ZC506.1 (alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:Q09641])

HSP 1 Score: 288.5 bits (737), Expect = 4.208e-86
Identity = 174/429 (40.56%), Postives = 255/429 (59.44%), Query Frame = 3
Query:   87 DMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCS--GPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVP--IGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLG-LVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVF-QSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLF 1319
            D K L  E  +MF   Y++Y+ +AFP DEL PL+C G+            D  G+FS++L+DSLDTLVVM    EF +A+ L++K +  + +  VSVFETNIRV+GGL+SAH+L++    E  P    +    LL+M+     +LLPAFNT++G+PF  +NL+ G+   +     TCTA   T +LEF ALT LTGDP++E  A +A+  +W  R +   L+G  ++V  G WT  +SGIGAG+DSY+EY LK  +L       + F+++   I +Y+        V+M + +V+   F  SL AFWPGL  + GD++ A+       QV ++  F PE F+    +       +P+RPE +ES  ++YRAT+DP  L +   IM SI    K  CG+A + D+RT   E++MESF L+ET KYLY++F
Sbjct:   25 DKKKLQKEAYDMFMHGYNSYMNYAFPADELMPLSCKGRIRGVTPSRGDVDDVLGNFSVTLLDSLDTLVVMNELDEFEKAIDLVIKHVRFDSDHVVSVFETNIRVLGGLISAHVLAELVK-EKYPNRLTTYDNQLLKMATEVGNRLLPAFNTTSGLPFSRINLKHGMQDHLKRQKDTCTACGGTMILEFAALTSLTGDPIYEKKARKAMDFLWQQRHRSSDLMGTVLNVHSGDWTRRESGIGAGIDSYYEYTLKAYILLGDESYLDRFNKHYEAIKRYINKGPIFVDVHMHRPTVATRGFMDSLLAFWPGLQVLKGDVKEAIEMHEMLFQVIQKHKFLPEAFT---HDFQVHWAEHPIRPEFVESTYFLYRATKDPHYLHVAKQIMDSINKYVKVPCGFAALKDIRTMVKEDQMESFVLSETFKYLYMIF 449          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Fly
Match: Edem1 (gene:FBgn0023511 transcript:FBtr0070354)

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 295/509 (57.96%), Postives = 381/509 (74.85%), Query Frame = 3
Query:   63 VSGKNNQHDMKALAV--EVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQ 1583
            VSG+      + L +  +V+ MFQ AYD Y++HA   DEL+PLTC G DTWGS+SL+L+D+LDTL  MGN+TEFRRA +LL ++++ +++INVSVFETNIR+VGGLLSAHLLSKRAGVELEPGWPC GPLLR++E  AR+LLPAF T+TGMP+GTVNL+ GVP GETSITCTAGV TF++EFG L++LTG  ++E VA++A+HA+W +RS +GL GNHIDV  G+WTA DSGIGAGVDS FEYL+K SVL  RPEL E+F E    I+KYMR +DW+ WV M+K  V++PVFQSLEAFWPG+L++ GD E A+RT+  Y  VWK++GF PEF+++A GE    R  YPLRPELIES MY+YRAT +  +L+ G  ++ +++  AKT CGYATI +V TH+ ENRMESFFLAET+KYLYLLFDE+NFLH   +G        +       CV+  G YIFNTEAHP+D  AL+CC   +++D+     + R  P   L      ++A+ +
Sbjct:   27 VSGQKQYSKARKLELREDVRRMFQHAYDGYLRHASNYDELRPLTCDGHDTWGSYSLTLIDALDTLATMGNFTEFRRAARLLEEKMDFDRDINVSVFETNIRIVGGLLSAHLLSKRAGVELEPGWPCKGPLLRLAEDVARRLLPAFVTNTGMPYGTVNLRYGVPKGETSITCTAGVGTFLIEFGTLSRLTGKTIYEDVAMKAVHALWAYRSPIGLFGNHIDVQSGRWTALDSGIGAGVDSLFEYLVKASVLLNRPELLELFHEARAAIDKYMRKEDWYVWVGMNKGRVTLPVFQSLEAFWPGILSIIGDTEPALRTISRYIGVWKKYGFLPEFYNIAAGEASPNREVYPLRPELIESAMYLYRATGNEYLLEFGEHMLETLEFSAKTKCGYATIRNVVTHEKENRMESFFLAETSKYLYLLFDEENFLHNDGSGGE------LLSTEDDVCVVQAGAYIFNTEAHPMDMSALHCCH-AHNEDIYTSLDLQRFSPRAILERSKKRQVAVQE 528          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Fly
Match: Edem1 (gene:FBgn0023511 transcript:FBtr0305583)

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 295/509 (57.96%), Postives = 381/509 (74.85%), Query Frame = 3
Query:   63 VSGKNNQHDMKALAV--EVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQ 1583
            VSG+      + L +  +V+ MFQ AYD Y++HA   DEL+PLTC G DTWGS+SL+L+D+LDTL  MGN+TEFRRA +LL ++++ +++INVSVFETNIR+VGGLLSAHLLSKRAGVELEPGWPC GPLLR++E  AR+LLPAF T+TGMP+GTVNL+ GVP GETSITCTAGV TF++EFG L++LTG  ++E VA++A+HA+W +RS +GL GNHIDV  G+WTA DSGIGAGVDS FEYL+K SVL  RPEL E+F E    I+KYMR +DW+ WV M+K  V++PVFQSLEAFWPG+L++ GD E A+RT+  Y  VWK++GF PEF+++A GE    R  YPLRPELIES MY+YRAT +  +L+ G  ++ +++  AKT CGYATI +V TH+ ENRMESFFLAET+KYLYLLFDE+NFLH   +G        +       CV+  G YIFNTEAHP+D  AL+CC   +++D+     + R  P   L      ++A+ +
Sbjct:   27 VSGQKQYSKARKLELREDVRRMFQHAYDGYLRHASNYDELRPLTCDGHDTWGSYSLTLIDALDTLATMGNFTEFRRAARLLEEKMDFDRDINVSVFETNIRIVGGLLSAHLLSKRAGVELEPGWPCKGPLLRLAEDVARRLLPAFVTNTGMPYGTVNLRYGVPKGETSITCTAGVGTFLIEFGTLSRLTGKTIYEDVAMKAVHALWAYRSPIGLFGNHIDVQSGRWTALDSGIGAGVDSLFEYLVKASVLLNRPELLELFHEARAAIDKYMRKEDWYVWVGMNKGRVTLPVFQSLEAFWPGILSIIGDTEPALRTISRYIGVWKKYGFLPEFYNIAAGEASPNREVYPLRPELIESAMYLYRATGNEYLLEFGEHMLETLEFSAKTKCGYATIRNVVTHEKENRMESFFLAETSKYLYLLFDEENFLHNDGSGGE------LLSTEDDVCVVQAGAYIFNTEAHPMDMSALHCCH-AHNEDIYTSLDLQRFSPRAILERSKKRQVAVQE 528          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Fly
Match: Edem1 (gene:FBgn0023511 transcript:FBtr0070353)

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 295/509 (57.96%), Postives = 381/509 (74.85%), Query Frame = 3
Query:   63 VSGKNNQHDMKALAV--EVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQ 1583
            VSG+      + L +  +V+ MFQ AYD Y++HA   DEL+PLTC G DTWGS+SL+L+D+LDTL  MGN+TEFRRA +LL ++++ +++INVSVFETNIR+VGGLLSAHLLSKRAGVELEPGWPC GPLLR++E  AR+LLPAF T+TGMP+GTVNL+ GVP GETSITCTAGV TF++EFG L++LTG  ++E VA++A+HA+W +RS +GL GNHIDV  G+WTA DSGIGAGVDS FEYL+K SVL  RPEL E+F E    I+KYMR +DW+ WV M+K  V++PVFQSLEAFWPG+L++ GD E A+RT+  Y  VWK++GF PEF+++A GE    R  YPLRPELIES MY+YRAT +  +L+ G  ++ +++  AKT CGYATI +V TH+ ENRMESFFLAET+KYLYLLFDE+NFLH   +G        +       CV+  G YIFNTEAHP+D  AL+CC   +++D+     + R  P   L      ++A+ +
Sbjct:   27 VSGQKQYSKARKLELREDVRRMFQHAYDGYLRHASNYDELRPLTCDGHDTWGSYSLTLIDALDTLATMGNFTEFRRAARLLEEKMDFDRDINVSVFETNIRIVGGLLSAHLLSKRAGVELEPGWPCKGPLLRLAEDVARRLLPAFVTNTGMPYGTVNLRYGVPKGETSITCTAGVGTFLIEFGTLSRLTGKTIYEDVAMKAVHALWAYRSPIGLFGNHIDVQSGRWTALDSGIGAGVDSLFEYLVKASVLLNRPELLELFHEARAAIDKYMRKEDWYVWVGMNKGRVTLPVFQSLEAFWPGILSIIGDTEPALRTISRYIGVWKKYGFLPEFYNIAAGEASPNREVYPLRPELIESAMYLYRATGNEYLLEFGEHMLETLEFSAKTKCGYATIRNVVTHEKENRMESFFLAETSKYLYLLFDEENFLHNDGSGGE------LLSTEDDVCVVQAGAYIFNTEAHPMDMSALHCCH-AHNEDIYTSLDLQRFSPRAILERSKKRQVAVQE 528          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Fly
Match: Edem1 (gene:FBgn0023511 transcript:FBtr0070352)

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 295/509 (57.96%), Postives = 381/509 (74.85%), Query Frame = 3
Query:   63 VSGKNNQHDMKALAV--EVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQ 1583
            VSG+      + L +  +V+ MFQ AYD Y++HA   DEL+PLTC G DTWGS+SL+L+D+LDTL  MGN+TEFRRA +LL ++++ +++INVSVFETNIR+VGGLLSAHLLSKRAGVELEPGWPC GPLLR++E  AR+LLPAF T+TGMP+GTVNL+ GVP GETSITCTAGV TF++EFG L++LTG  ++E VA++A+HA+W +RS +GL GNHIDV  G+WTA DSGIGAGVDS FEYL+K SVL  RPEL E+F E    I+KYMR +DW+ WV M+K  V++PVFQSLEAFWPG+L++ GD E A+RT+  Y  VWK++GF PEF+++A GE    R  YPLRPELIES MY+YRAT +  +L+ G  ++ +++  AKT CGYATI +V TH+ ENRMESFFLAET+KYLYLLFDE+NFLH   +G        +       CV+  G YIFNTEAHP+D  AL+CC   +++D+     + R  P   L      ++A+ +
Sbjct:   27 VSGQKQYSKARKLELREDVRRMFQHAYDGYLRHASNYDELRPLTCDGHDTWGSYSLTLIDALDTLATMGNFTEFRRAARLLEEKMDFDRDINVSVFETNIRIVGGLLSAHLLSKRAGVELEPGWPCKGPLLRLAEDVARRLLPAFVTNTGMPYGTVNLRYGVPKGETSITCTAGVGTFLIEFGTLSRLTGKTIYEDVAMKAVHALWAYRSPIGLFGNHIDVQSGRWTALDSGIGAGVDSLFEYLVKASVLLNRPELLELFHEARAAIDKYMRKEDWYVWVGMNKGRVTLPVFQSLEAFWPGILSIIGDTEPALRTISRYIGVWKKYGFLPEFYNIAAGEASPNREVYPLRPELIESAMYLYRATGNEYLLEFGEHMLETLEFSAKTKCGYATIRNVVTHEKENRMESFFLAETSKYLYLLFDEENFLHNDGSGGE------LLSTEDDVCVVQAGAYIFNTEAHPMDMSALHCCH-AHNEDIYTSLDLQRFSPRAILERSKKRQVAVQE 528          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Fly
Match: Edem1 (gene:FBgn0023511 transcript:FBtr0332580)

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 295/509 (57.96%), Postives = 381/509 (74.85%), Query Frame = 3
Query:   63 VSGKNNQHDMKALAV--EVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQ 1583
            VSG+      + L +  +V+ MFQ AYD Y++HA   DEL+PLTC G DTWGS+SL+L+D+LDTL  MGN+TEFRRA +LL ++++ +++INVSVFETNIR+VGGLLSAHLLSKRAGVELEPGWPC GPLLR++E  AR+LLPAF T+TGMP+GTVNL+ GVP GETSITCTAGV TF++EFG L++LTG  ++E VA++A+HA+W +RS +GL GNHIDV  G+WTA DSGIGAGVDS FEYL+K SVL  RPEL E+F E    I+KYMR +DW+ WV M+K  V++PVFQSLEAFWPG+L++ GD E A+RT+  Y  VWK++GF PEF+++A GE    R  YPLRPELIES MY+YRAT +  +L+ G  ++ +++  AKT CGYATI +V TH+ ENRMESFFLAET+KYLYLLFDE+NFLH   +G        +       CV+  G YIFNTEAHP+D  AL+CC   +++D+     + R  P   L      ++A+ +
Sbjct:   27 VSGQKQYSKARKLELREDVRRMFQHAYDGYLRHASNYDELRPLTCDGHDTWGSYSLTLIDALDTLATMGNFTEFRRAARLLEEKMDFDRDINVSVFETNIRIVGGLLSAHLLSKRAGVELEPGWPCKGPLLRLAEDVARRLLPAFVTNTGMPYGTVNLRYGVPKGETSITCTAGVGTFLIEFGTLSRLTGKTIYEDVAMKAVHALWAYRSPIGLFGNHIDVQSGRWTALDSGIGAGVDSLFEYLVKASVLLNRPELLELFHEARAAIDKYMRKEDWYVWVGMNKGRVTLPVFQSLEAFWPGILSIIGDTEPALRTISRYIGVWKKYGFLPEFYNIAAGEASPNREVYPLRPELIESAMYLYRATGNEYLLEFGEHMLETLEFSAKTKCGYATIRNVVTHEKENRMESFFLAETSKYLYLLFDEENFLHNDGSGGE------LLSTEDDVCVVQAGAYIFNTEAHPMDMSALHCCH-AHNEDIYTSLDLQRFSPRAILERSKKRQVAVQE 528          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Zebrafish
Match: edem2 (ER degradation enhancer, mannosidase alpha-like 2 [Source:ZFIN;Acc:ZDB-GENE-060519-1])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 297/571 (52.01%), Postives = 396/571 (69.35%), Query Frame = 3
Query:   63 VSGKN-NQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQMSLDRNVADGVGLPEMAAPPNMPLSAAPSDGLSTFTVADRYSTLLSCPNSKFHFKFMIYGEMI 1772
            V G++  + +M      VK MF  AY++Y+ +A+P DEL+PLTC GQDTWGSFSL+L+D+LDTL+++GN+TEF+R   LL   ++ + ++N SVFETNIRVVGGLLSAHLLSKRAG+++E GWPCSGPLLRM+E  ARKLLPAF T TGMP+GTVNL  GV  GET +TCTAGV TF+LEF  L++LTGDPVFE VA +AL A+W  RS +GLVGNHIDV+  KW A D+GIGAGVDSYFEYL+KG+++ +  +L  MF E+ + I  Y + DDW+ WV M K +VSMPVFQSLEAFWPG+ ++ GD+  A ++ HNY+ VW+QFG  PEF+S+ +G  + +R  YPLRPELIES MY+Y+AT DP+ +Q+G D + SI  +++ NCG+AT+ DVR H+L+NRMESFFLAET KYLYLLFD DNFLH   T     ++++  +   G+C++  GGY+FNTEAHP+DP AL+CCS          +Q  R         I D  ++ +Q             P+   PP    +    + ++      R + +LSCP   F  K  + G++ 
Sbjct:   22 VKGRDFTEQEMSHYRDRVKSMFYHAYNSYLDNAYPYDELRPLTCDGQDTWGSFSLTLIDALDTLLILGNHTEFQRVATLLQDTVDFDIDVNASVFETNIRVVGGLLSAHLLSKRAGMKVEEGWPCSGPLLRMAEDAARKLLPAFQTPTGMPYGTVNLLRGVNPGETPVTCTAGVGTFILEFSTLSRLTGDPVFENVARKALRALWRTRSDIGLVGNHIDVITSKWVAQDAGIGAGVDSYFEYLVKGAIMLQDEKLLTMFYEFDKSIKNYTKFDDWYLWVQMHKGTVSMPVFQSLEAFWPGMQSLIGDISSATKSFHNYYSVWRQFGGLPEFYSIPQGYTVDKREGYPLRPELIESAMYLYKATGDPSFIQLGRDAVESIDRISRVNCGFATVKDVRDHKLDNRMESFFLAETIKYLYLLFDPDNFLHNTGT-----EFELGGL--RGDCILSAGGYVFNTEAHPLDPAALHCCSR---------EQQDRR-------EIQDILLSFSQ-------------PQTEEPPRDQNAGGSPESIALKPGEQRKAPVLSCPTQPFSAKLAVMGQVF 556          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Zebrafish
Match: edem2 (ER degradation enhancer, mannosidase alpha-like 2 [Source:ZFIN;Acc:ZDB-GENE-060519-1])

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 297/571 (52.01%), Postives = 395/571 (69.18%), Query Frame = 3
Query:   63 VSGKN-NQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQMSLDRNVADGVGLPEMAAPPNMPLSAAPSDGLSTFTVADRYSTLLSCPNSKFHFKFMIYGEMI 1772
            V G++  + +M      VK MF  AY++Y+ +A+P DEL+PLTC GQDTWGSFSL+L+D+LDTL+++GN+TEF+R   LL   ++ + ++N SVFETNIRVVGGLLSAHLLSKRAG+++E GWPCSGPLLRM+E  ARKLLPAF T TGMP+GTVNL  GV  GET +TCTAGV TF+LEF  L++LTGDPVFE VA +AL A+W  RS +GLVGNHIDV+  KW A D+GIGAGVDSYFEYL+KG+++ +  +L  MF E+ + I  Y + DDW+ WV M K +VSMPVFQSLEAFWPG+ ++ GD+  A ++ HNY+ VW+QFG  PEF+S+ +G  + +R  YPLRPELIES MY+Y+AT DP+ +Q+G D + SI  +++ NCG+AT  DVR H+L+NRMESFFLAET KYLYLLFD DNFLH   T     ++++  +   G+C++  GGY+FNTEAHP+DP AL+CCS          +Q  R         I D  ++ +Q             P+   PP    +    + ++      R + +LSCP   F  K  + G++ 
Sbjct:   22 VKGRDFTEQEMSHYRDRVKSMFYHAYNSYLDNAYPYDELRPLTCDGQDTWGSFSLTLIDALDTLLILGNHTEFQRVATLLQDTVDFDIDVNASVFETNIRVVGGLLSAHLLSKRAGMKVEEGWPCSGPLLRMAEDAARKLLPAFQTPTGMPYGTVNLLRGVNPGETPVTCTAGVGTFILEFSTLSRLTGDPVFENVARKALRALWRTRSDIGLVGNHIDVITSKWVAQDAGIGAGVDSYFEYLVKGAIMLQDEKLLTMFYEFDKSIKNYTKFDDWYLWVQMHKGTVSMPVFQSLEAFWPGMQSLIGDISSATKSFHNYYSVWRQFGGLPEFYSIPQGYTVDKREGYPLRPELIESAMYLYKATGDPSFIQLGRDAVESIDRISRVNCGFAT--DVRDHKLDNRMESFFLAETIKYLYLLFDPDNFLHNTGT-----EFELGGL--RGDCILSAGGYVFNTEAHPLDPAALHCCSR---------EQQDRR-------EIQDILLSFSQ-------------PQTEEPPRDQNAGGSPESIALKPGEQRKAPVLSCPTQPFSAKLAVMGQVF 554          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Zebrafish
Match: edem1 (ER degradation enhancer, mannosidase alpha-like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-808])

HSP 1 Score: 320.472 bits (820), Expect = 1.284e-100
Identity = 201/492 (40.85%), Postives = 282/492 (57.32%), Query Frame = 3
Query:   90 MKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPC--------SGPLLRMSEAFARKLLPAF-NTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRS-KLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDD-----------WHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH--PID 1457
            M+A+A   ++MF F YDNY++ AFP DEL P+ C G+             D  G++SL+L+D+LDTL+V+GN TEF RA+KL++  ++ +K+  V VFE NIR++G L+SAH+L        +P  P            LL ++   A +LLPAF NTSTG+P+  VNL++GVP    + TCTAG  + ++EFG L++L GD  FE VA RA+ A+W  RS + GL+GN +++  G+W    SG+GAG+DS++EYLLK  +LF   E   MF      I  ++R               +  VNM    +      SL+AF+PGL  + GD+E A+     Y+ +WK+FG  PE ++     P      YPLRPEL+ES   +Y+AT++P  L +G+DI+ S++   K  CGYAT++ V     E+RMESFFL+ET KYLYLLFDEDN LH                            YIF TE H  PID
Sbjct:  115 MRAMA---RDMFYFGYDNYMKFAFPEDELNPIACEGRGPDVLNPSNININDVLGNYSLTLIDTLDTLLVLGNVTEFHRAVKLVIDTVSFDKDSTVQVFEANIRILGSLISAHILLT------DPRHPFGDVGLKDYDNELLHLAHDLAVRLLPAFENTSTGIPYPRVNLKNGVPPDSINETCTAGAGSLLVEFGILSRLIGDSTFEWVARRAVKALWKLRSNETGLLGNVVNIQTGQWVGKQSGLGAGMDSFYEYLLKSYILFGEKEDFRMFTAAYESIQSHLRRGREACNEGEGDPPLYVNVNMFNGQIMNTWIDSLQAFFPGLQVLNGDVENAICLHAFYYAIWKRFGALPERYNWQLQAP--DVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILESLEKNTKVRCGYATLHHVVDKSKEDRMESFFLSETCKYLYLLFDEDNPLHKSEN-----------------------KYIFTTEGHVVPID 572          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Zebrafish
Match: si:ch211-282j22.3 (si:ch211-282j22.3 [Source:ZFIN;Acc:ZDB-GENE-091113-49])

HSP 1 Score: 296.204 bits (757), Expect = 2.459e-89
Identity = 194/485 (40.00%), Postives = 276/485 (56.91%), Query Frame = 3
Query:   84 HDMKALAVEVK--------EMFQFAYDNYIQHAFPLDELQPLTCSGQ------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLS---KRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGV--PIGET---SITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSK-LGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVF-QSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH 1448
            HD +A+  E K        EMF  AY++Y+ +A+P DEL PL+C G+            D+ G FSL+L+D+LDTLV++    EF  A+K +M+ +  + +I VSVFETNIRV+GGLL AH+++   K+ G  ++  W     LL M++    +LLPAFNT++G+P+  VNL+ GV  P+  T   S TCTA   T +LEF AL++++GD +FE  A +A+  +W  R +   LVG  I++  G W   DSG+GAG+DSY+EYL+K  +L       E F+ +   I KY+        V+M   +V++  +  SL AF+PGL  + GDL+ A+ T    +QV KQ  F PE F+    E       +PLRPE  ES  ++Y+AT DP  L++G  I+  +   A+  CG+A + DVRT   E+RM+SFFLAE  KYLYLLF E + L                        ID   YIF TEAH
Sbjct:   35 HDGQAMTPEEKSEIRDQILEMFDHAYNSYMDYAYPADELMPLSCRGRVRGLEPNRGDVDDSLGKFSLTLIDTLDTLVLLNKLDEFEEAVKKIMRDVRLDNDIVVSVFETNIRVLGGLLGAHVMADVLKQRGQRMQ--W-YRDELLHMAKELGYRLLPAFNTTSGLPYPRVNLRYGVVNPLSRTGTESDTCTACAGTLILEFAALSRMSGDTIFEEHARKAMDVLWEKRQRGSDLVGTVINIHNGDWVRRDSGVGAGIDSYYEYLMKAYILLGDKVYLERFNTHYSAIMKYISQPPLLLNVHMHNPTVNVRSWMDSLLAFFPGLQVLRGDLKPAIETHEMLYQVTKQHNFLPEAFTT---EFRVHWGQHPLRPEFAESTYFLYKATGDPYYLKVGQSIVEKLNAHARVPCGFAAVQDVRTGTHEDRMDSFFLAEMFKYLYLLFSEKSQLP-----------------------IDIDDYIFTTEAH 490          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Zebrafish
Match: edem3 (ER degradation enhancer, mannosidase alpha-like 3 [Source:ZFIN;Acc:ZDB-GENE-070801-5])

HSP 1 Score: 281.952 bits (720), Expect = 6.573e-84
Identity = 180/444 (40.54%), Postives = 258/444 (58.11%), Query Frame = 3
Query:   63 VSGKNNQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGV-----PIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSK-LGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVF-QSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFL 1337
            +S   ++ +   L ++V EMF  AY NY+ HA+P DEL PLTC G+            D  G FSL+L+D+LDTL ++    EF  A++ ++K +  + +I VSVFETNIRV+GGLL  H ++       +  W     LL M++    +LLPAFNTS+G+P+  VNL+ GV       G  + TCTA   T +LEF AL++ TGDP FE  A RAL  +W  R +   LVG  I++  G+W   DSG+GAG+DSY+EYL+K  +L    +L   F+ +   I KY+        V++ K  +    +  SL AF+PGL  + GD+  A+ T    +QV K+  F PE F+        Q   +PLRPE  ES  ++Y+ATRDP  L++G  ++ ++   A+  CG+A + DVRT   E+RM+SFFLAE  KYL+LLF E+  L
Sbjct:   25 LSETMSRDEKSKLRIQVLEMFDHAYRNYMDHAYPADELMPLTCRGRVRGLEPSRGDVDDALGKFSLTLIDTLDTLALLNKTVEFEEAVRRVVKDVRLDNDIVVSVFETNIRVLGGLLGGHSMAVMLKENGQMVW-YQNELLHMAKDLGLRLLPAFNTSSGLPYPRVNLRHGVHGPETRTGTETETCTACAGTIILEFAALSRFTGDPTFEAHARRALDFLWEKRQRNSNLVGTTINIHSGEWVRRDSGVGAGIDSYYEYLMKAYILLGDDQLLLRFNTHYASIMKYISQPPLLLDVHIHKPLLPARTWMDSLLAFFPGLQVLKGDIRPAIETHEMLYQVTKKHNFLPEAFTTDFRVHWAQ---HPLRPEFAESTYFLYKATRDPYYLEVGRTVLENLNRFARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLFLLFAEEEDL 464          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Xenopus
Match: atp6v1a (ATPase H+ transporting V1 subunit A [Source:Xenbase;Acc:XB-GENE-479548])

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 284/468 (60.68%), Postives = 362/468 (77.35%), Query Frame = 3
Query:   78 NQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHA-GTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCC 1478
             + +M      VK MF  AY+NY+ HAFP DEL+PLTC GQDTWGSFSL+L+D+LDTL+++GN TEF+R + +L   L+ + ++N SVFETNIRVVGGLLSAHL SKRAG+ELEPGWPC+GPLLRM+E  ARKLLPAF+T+TGMP+GTVNL  GV   ET +TCTAGV TF++EF  L++LTGDP FE VA RAL  +W  RS +GLVGNH+DVM  KW A D+GIGAGVDSYFEYL+KG++L +  EL  MF EY + +  + ++DDW+ WV M K +V+MPVFQSLEAFWPGL ++ GD+   +R+  NY+ VW+QFG  PEF+S+ +G  +++R  YPLRPELIES MY+Y+ATRDP +L++G D + SI+ ++K +CG+ATI DVR H+L+NRMESFFLAET KYLYLLFD DNF+H  G+T         + +   GECV+  GGY+FNTEAHPIDP AL+CC
Sbjct:   29 TEEEMAQYRDRVKSMFYHAYNNYLDHAFPYDELRPLTCDGQDTWGSFSLTLIDALDTLLIIGNVTEFQRVVNVLQDTLDFDIDVNASVFETNIRVVGGLLSAHLFSKRAGLELEPGWPCTGPLLRMAEEAARKLLPAFDTATGMPYGTVNLLRGVNPTETPVTCTAGVGTFIVEFATLSRLTGDPQFEMVARRALRGLWESRSDIGLVGNHVDVMTSKWVAQDAGIGAGVDSYFEYLVKGAILLQDEELMSMFLEYNKALQNFTKYDDWYVWVQMYKGTVTMPVFQSLEAFWPGLQSLVGDIRSGMRSFLNYYTVWRQFGGLPEFYSIPQGFTVEKREGYPLRPELIESAMYLYKATRDPILLELGRDAVESIERISKVDCGFATIKDVRDHKLDNRMESFFLAETIKYLYLLFDPDNFIHNDGSTSD-------LVVTPYGECVMGAGGYVFNTEAHPIDPAALHCC 489          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Xenopus
Match: atp6v1a (ATPase H+ transporting V1 subunit A [Source:Xenbase;Acc:XB-GENE-479548])

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 283/457 (61.93%), Postives = 359/457 (78.56%), Query Frame = 3
Query:  111 VKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHA-GTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCC 1478
            VK MF  AY+NY+ HAFP DEL+PLTC GQDTWGSFSL+L+D+LDTL+++GN TEF+R + +L   L+ + ++N SVFETNIRVVGGLLSAHL SKRAG+ELEPGWPC+GPLLRM+E  ARKLLPAF+T+TGMP+GTVNL  GV   ET +TCTAGV TF++EF  L++LTGDP FE VA RAL  +W  RS +GLVGNH+DVM  KW A D+GIGAGVDSYFEYL+KG++L +  EL  MF EY + +  + ++DDW+ WV M K +V+MPVFQSLEAFWPGL ++ GD+   +R+  NY+ VW+QFG  PEF+S+ +G  +++R  YPLRPELIES MY+Y+ATRDP +L++G D + SI+ ++K +CG+ATI DVR H+L+NRMESFFLAET KYLYLLFD DNF+H  G+T         + +   GECV+  GGY+FNTEAHPIDP AL+CC
Sbjct:   39 VKSMFYHAYNNYLDHAFPYDELRPLTCDGQDTWGSFSLTLIDALDTLLIIGNVTEFQRVVNVLQDTLDFDIDVNASVFETNIRVVGGLLSAHLFSKRAGLELEPGWPCTGPLLRMAEEAARKLLPAFDTATGMPYGTVNLLRGVNPTETPVTCTAGVGTFIVEFATLSRLTGDPQFEMVARRALRGLWESRSDIGLVGNHVDVMTSKWVAQDAGIGAGVDSYFEYLVKGAILLQDEELMSMFLEYNKALQNFTKYDDWYVWVQMYKGTVTMPVFQSLEAFWPGLQSLVGDIRSGMRSFLNYYTVWRQFGGLPEFYSIPQGFTVEKREGYPLRPELIESAMYLYKATRDPILLELGRDAVESIERISKVDCGFATIKDVRDHKLDNRMESFFLAETIKYLYLLFDPDNFIHNDGSTSD-------LVVTPYGECVMGAGGYVFNTEAHPIDPAALHCC 488          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Xenopus
Match: edem1 (ER degradation enhancing alpha-mannosidase like protein 1 [Source:NCBI gene;Acc:395034])

HSP 1 Score: 328.176 bits (840), Expect = 8.274e-104
Identity = 206/492 (41.87%), Postives = 292/492 (59.35%), Query Frame = 3
Query:   81 QHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLL---SKRA-GVELEPGWPCSGPLLRMSEAFARKLLPAF-NTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSK-LGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDD-----------WHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH--PIDP 1460
            + +M+ +A   + MF F YD+Y+++AFP DEL P+ C G+             D  G++SL+L+D+LDTL VMGN TEF RA++L++  ++ +KN  V VFE  IR++G LLSAH++   SK+  G     G+     LL M+   A +LLPAF NT TGMP+  VNL+ GVP    + TCTAG  + ++EFG L++L GD  FE VA RA+ A+W+ RS   GL+GN +++  G+W    SG+GAG+DS+FEYLLK  +LF   E  EMF+E  + I  ++R               +  VNM    +      SL+AF+PGL  + GD+E A+     Y+ +WK++G  PE ++     P    + YPLRPEL+ES   +Y+AT++P  L +G+DI+ S++  AK  CGYAT++ V     E+RMESFFL+ET KYLYLLFDEDN LH       R D +                Y+F TE H  P+DP
Sbjct:   76 RKEMREMA---RGMFSFGYDSYMKYAFPEDELNPILCRGRGPDHGDPSNLNINDVLGNYSLTLIDALDTLAVMGNATEFHRAVRLVIDTVSFDKNSTVQVFEATIRILGSLLSAHIILTDSKQPFGNMTLSGY--DNELLHMARDLAVRLLPAFENTKTGMPYPRVNLKKGVPPDSRNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVRALWSLRSNDTGLLGNVVNIQTGQWVGKQSGLGAGLDSFFEYLLKSHILFGEEEDLEMFNEAYKSIQNHLRRGREACNEGEGDPPLYVNVNMLNGQLMNTWIDSLQAFFPGLQVLKGDIEDAICLHAFYYAIWKRYGALPERYNWQLQAP--DVSFYPLRPELVESTYLLYQATKNPFYLHVGMDILLSLEKHAKAKCGYATLHHVVDKSQEDRMESFFLSETCKYLYLLFDEDNPLH-------RVDNK----------------YLFTTEGHLIPLDP 537          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Xenopus
Match: edem1 (ER degradation enhancing alpha-mannosidase like protein 1 [Source:NCBI gene;Acc:395034])

HSP 1 Score: 328.561 bits (841), Expect = 9.362e-104
Identity = 206/492 (41.87%), Postives = 292/492 (59.35%), Query Frame = 3
Query:   81 QHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLL---SKRA-GVELEPGWPCSGPLLRMSEAFARKLLPAF-NTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSK-LGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDD-----------WHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH--PIDP 1460
            + +M+ +A   + MF F YD+Y+++AFP DEL P+ C G+             D  G++SL+L+D+LDTL VMGN TEF RA++L++  ++ +KN  V VFE  IR++G LLSAH++   SK+  G     G+     LL M+   A +LLPAF NT TGMP+  VNL+ GVP    + TCTAG  + ++EFG L++L GD  FE VA RA+ A+W+ RS   GL+GN +++  G+W    SG+GAG+DS+FEYLLK  +LF   E  EMF+E  + I  ++R               +  VNM    +      SL+AF+PGL  + GD+E A+     Y+ +WK++G  PE ++     P    + YPLRPEL+ES   +Y+AT++P  L +G+DI+ S++  AK  CGYAT++ V     E+RMESFFL+ET KYLYLLFDEDN LH       R D +                Y+F TE H  P+DP
Sbjct:   86 RKEMREMA---RGMFSFGYDSYMKYAFPEDELNPILCRGRGPDHGDPSNLNINDVLGNYSLTLIDALDTLAVMGNATEFHRAVRLVIDTVSFDKNSTVQVFEATIRILGSLLSAHIILTDSKQPFGNMTLSGY--DNELLHMARDLAVRLLPAFENTKTGMPYPRVNLKKGVPPDSRNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVRALWSLRSNDTGLLGNVVNIQTGQWVGKQSGLGAGLDSFFEYLLKSHILFGEEEDLEMFNEAYKSIQNHLRRGREACNEGEGDPPLYVNVNMLNGQLMNTWIDSLQAFFPGLQVLKGDIEDAICLHAFYYAIWKRYGALPERYNWQLQAP--DVSFYPLRPELVESTYLLYQATKNPFYLHVGMDILLSLEKHAKAKCGYATLHHVVDKSQEDRMESFFLSETCKYLYLLFDEDNPLH-------RVDNK----------------YLFTTEGHLIPLDP 547          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Xenopus
Match: edem1 (ER degradation enhancing alpha-mannosidase like protein 1 [Source:NCBI gene;Acc:395034])

HSP 1 Score: 328.176 bits (840), Expect = 1.465e-103
Identity = 206/492 (41.87%), Postives = 292/492 (59.35%), Query Frame = 3
Query:   81 QHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLL---SKRA-GVELEPGWPCSGPLLRMSEAFARKLLPAF-NTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSK-LGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDD-----------WHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH--PIDP 1460
            + +M+ +A   + MF F YD+Y+++AFP DEL P+ C G+             D  G++SL+L+D+LDTL VMGN TEF RA++L++  ++ +KN  V VFE  IR++G LLSAH++   SK+  G     G+     LL M+   A +LLPAF NT TGMP+  VNL+ GVP    + TCTAG  + ++EFG L++L GD  FE VA RA+ A+W+ RS   GL+GN +++  G+W    SG+GAG+DS+FEYLLK  +LF   E  EMF+E  + I  ++R               +  VNM    +      SL+AF+PGL  + GD+E A+     Y+ +WK++G  PE ++     P    + YPLRPEL+ES   +Y+AT++P  L +G+DI+ S++  AK  CGYAT++ V     E+RMESFFL+ET KYLYLLFDEDN LH       R D +                Y+F TE H  P+DP
Sbjct:   92 RKEMREMA---RGMFSFGYDSYMKYAFPEDELNPILCRGRGPDHGDPSNLNINDVLGNYSLTLIDALDTLAVMGNATEFHRAVRLVIDTVSFDKNSTVQVFEATIRILGSLLSAHIILTDSKQPFGNMTLSGY--DNELLHMARDLAVRLLPAFENTKTGMPYPRVNLKKGVPPDSRNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVRALWSLRSNDTGLLGNVVNIQTGQWVGKQSGLGAGLDSFFEYLLKSHILFGEEEDLEMFNEAYKSIQNHLRRGREACNEGEGDPPLYVNVNMLNGQLMNTWIDSLQAFFPGLQVLKGDIEDAICLHAFYYAIWKRYGALPERYNWQLQAP--DVSFYPLRPELVESTYLLYQATKNPFYLHVGMDILLSLEKHAKAKCGYATLHHVVDKSQEDRMESFFLSETCKYLYLLFDEDNPLH-------RVDNK----------------YLFTTEGHLIPLDP 553          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Mouse
Match: Edem2 (ER degradation enhancer, mannosidase alpha-like 2 [Source:MGI Symbol;Acc:MGI:1915540])

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 301/559 (53.85%), Postives = 392/559 (70.13%), Query Frame = 3
Query:  111 VKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLH-AGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQMSLDRNVADGVGLPE-----MAAPPNMPLSAAPSDGLSTFTVADRYSTLLSCPNSKFHFKFMIYGEM 1769
            VK MF  AYD+Y+++AFP DEL+PLTC G DTWGSFSL+L+D+LDTL+++GN +EF+R +++L   ++ + ++N SVFETNIRVVGGLLSAHLLSK+AGVE+E GWPCSGPLLRM+E  ARKLLPAF T TGMP+GTVNL  GV  GET +TCTAG+ TF++EF  L+ LTGDPVFE VA  AL  +W  RS +GLVGNHIDV+ GKW A D+GIGAGVDSYFEYL+KG++L +  +L  MF EY + I  Y   DDW+ WV M K +VSMPVFQSLEA+WPGL ++ GD++ A+RT  NY+ VWKQFG  PEF+++ +G  +++R  YPLRPELIES MY+YRAT DP +L++G D + SI+ ++K  CG+ATI D+R H+L+NRMESFFLAET KYLYLLF  +NF+H  G+T  S        M   GEC++  GGYIFNTEAHPIDP AL+CC     +     D +   Y L +         +  + +  + V  G   P+     +++P N P    P         A + + LLSCP+  F  K  + G++
Sbjct:   39 VKAMFYHAYDSYLENAFPYDELRPLTCDGHDTWGSFSLTLIDALDTLLILGNTSEFQRVVEVLQDNVDFDIDVNASVFETNIRVVGGLLSAHLLSKKAGVEVEAGWPCSGPLLRMAEEAARKLLPAFQTPTGMPYGTVNLLHGVNPGETPVTCTAGIGTFIVEFATLSSLTGDPVFEDVARVALMRLWESRSDIGLVGNHIDVLTGKWVAQDAGIGAGVDSYFEYLVKGAILLQDKKLMAMFLEYNKAIRNYTHFDDWYLWVQMYKGTVSMPVFQSLEAYWPGLQSLIGDIDNAMRTFLNYYTVWKQFGGLPEFYNIPQGYTVEKREGYPLRPELIESAMYLYRATGDPTLLELGRDAVESIEKISKVECGFATIKDLRDHKLDNRMESFFLAETVKYLYLLFHPNNFIHNNGSTFDS-------VMTPHGECILGAGGYIFNTEAHPIDPAALHCCRRLKEEQWEVEDLIKEFYSLKQ---------SRPKRAQRKTVRSGPWEPQSGPATLSSPANQPREKQP---------AQQRTPLLSCPSQPFTSKLALLGQV 572          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Mouse
Match: Edem1 (ER degradation enhancer, mannosidase alpha-like 1 [Source:MGI Symbol;Acc:MGI:2180139])

HSP 1 Score: 316.62 bits (810), Expect = 8.544e-99
Identity = 194/452 (42.92%), Postives = 275/452 (60.84%), Query Frame = 3
Query:   90 MKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLL---SKR--AGVELEPGWPCSGPLLRMSEAFARKLLPAF-NTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSK-LGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDD-----------WHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTT 1352
            M+ LA   + MF F YDNY+ HAFP DEL P+ C G+             D  G++SL+LVD+LDTL +MGN +EF++A+KL++  ++ +K+  V VFE  IRV+G LLSAH +   SK+    + +E        LL M+   A +LLPAF NT TG+P+  VNL++GVP    + TCTAG  + ++EFG L++L GD  FE VA RA+ A+WN RS   GL+GN +++  G W    SG+GAG+DS++EYLLK  +LF   E  EMF+   + I  Y+R               +  VNM    +      SL+AF+PGL  + GD+E A+     Y+ +WK++G  PE ++     P      YPLRPEL+ES   +Y+AT++P  L +G+DI++S++   K  CGYAT++ V     E+RMESFFL+ET KYLYLLFDE+N +H   T
Sbjct:  125 MRDLA---RGMFVFGYDNYMAHAFPQDELNPIYCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQPFGDMTIED---YDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQSYLRRGREACNEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERYNWQLQAP--DVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGT 568          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Mouse
Match: Edem3 (ER degradation enhancer, mannosidase alpha-like 3 [Source:MGI Symbol;Acc:MGI:1914217])

HSP 1 Score: 275.404 bits (703), Expect = 4.071e-81
Identity = 185/479 (38.62%), Postives = 268/479 (55.95%), Query Frame = 3
Query:   78 NQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLS---KRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVP-----IGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLG-LVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVF-QSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH 1448
            ++ + + L  +V EMF  AY NY++HA+P DEL PLTC G+            D  G FSL+L+DSLDTLVV+    EF  A++ +++ +N + ++ VSVFETNIRV+GGLL  H L+   K  G  ++  W  +  LL M++    KLLPAFNT++G+P+  +NL+ G+       G  + TCTA   T +LEF AL++ TG  +FE  A +AL  +W  R +   LVG  I++  G W   DSG+GAG+DSY+EYLLK  VL       E F+ +   I +Y+        V++ K  ++   +  +L AF+PGL  + GD+  A+ T    +QV K+  F PE F+        Q   +PLRPE  ES  ++Y+AT DP  L++G  ++ ++   A+  CG+A + DVRT   E+RM+SFFLAE  KYLYLLF +                         + + D   YIF TEAH
Sbjct:   46 SREEKQKLGNQVLEMFDHAYGNYMEHAYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNKTKEFEDAVRKVLRDVNLDNDVVVSVFETNIRVLGGLLGGHSLAIMLKEKGEHMQ--W-YNDELLHMAKQLGYKLLPAFNTTSGLPYPRINLKFGIRKPEARTGTETDTCTACAGTLILEFAALSRFTGATIFEEYARKALDFLWEKRQRSSNLVGVTINIHTGDWVRKDSGVGAGIDSYYEYLLKAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDALLAFFPGLQVLKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQ---HPLRPEFAESTYFLYKATGDPYYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLFADKE-----------------------DIIFDIEDYIFTTEAH 495          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Mouse
Match: Edem3 (ER degradation enhancer, mannosidase alpha-like 3 [Source:MGI Symbol;Acc:MGI:1914217])

HSP 1 Score: 275.404 bits (703), Expect = 4.903e-81
Identity = 185/479 (38.62%), Postives = 268/479 (55.95%), Query Frame = 3
Query:   78 NQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLS---KRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVP-----IGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLG-LVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVF-QSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH 1448
            ++ + + L  +V EMF  AY NY++HA+P DEL PLTC G+            D  G FSL+L+DSLDTLVV+    EF  A++ +++ +N + ++ VSVFETNIRV+GGLL  H L+   K  G  ++  W  +  LL M++    KLLPAFNT++G+P+  +NL+ G+       G  + TCTA   T +LEF AL++ TG  +FE  A +AL  +W  R +   LVG  I++  G W   DSG+GAG+DSY+EYLLK  VL       E F+ +   I +Y+        V++ K  ++   +  +L AF+PGL  + GD+  A+ T    +QV K+  F PE F+        Q   +PLRPE  ES  ++Y+AT DP  L++G  ++ ++   A+  CG+A + DVRT   E+RM+SFFLAE  KYLYLLF +                         + + D   YIF TEAH
Sbjct:   46 SREEKQKLGNQVLEMFDHAYGNYMEHAYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNKTKEFEDAVRKVLRDVNLDNDVVVSVFETNIRVLGGLLGGHSLAIMLKEKGEHMQ--W-YNDELLHMAKQLGYKLLPAFNTTSGLPYPRINLKFGIRKPEARTGTETDTCTACAGTLILEFAALSRFTGATIFEEYARKALDFLWEKRQRSSNLVGVTINIHTGDWVRKDSGVGAGIDSYYEYLLKAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDALLAFFPGLQVLKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQ---HPLRPEFAESTYFLYKATGDPYYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLFADKE-----------------------DIIFDIEDYIFTTEAH 495          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Mouse
Match: Edem3 (ER degradation enhancer, mannosidase alpha-like 3 [Source:MGI Symbol;Acc:MGI:1914217])

HSP 1 Score: 275.404 bits (703), Expect = 5.182e-81
Identity = 185/479 (38.62%), Postives = 268/479 (55.95%), Query Frame = 3
Query:   78 NQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLS---KRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVP-----IGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLG-LVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVF-QSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH 1448
            ++ + + L  +V EMF  AY NY++HA+P DEL PLTC G+            D  G FSL+L+DSLDTLVV+    EF  A++ +++ +N + ++ VSVFETNIRV+GGLL  H L+   K  G  ++  W  +  LL M++    KLLPAFNT++G+P+  +NL+ G+       G  + TCTA   T +LEF AL++ TG  +FE  A +AL  +W  R +   LVG  I++  G W   DSG+GAG+DSY+EYLLK  VL       E F+ +   I +Y+        V++ K  ++   +  +L AF+PGL  + GD+  A+ T    +QV K+  F PE F+        Q   +PLRPE  ES  ++Y+AT DP  L++G  ++ ++   A+  CG+A + DVRT   E+RM+SFFLAE  KYLYLLF +                         + + D   YIF TEAH
Sbjct:   46 SREEKQKLGNQVLEMFDHAYGNYMEHAYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNKTKEFEDAVRKVLRDVNLDNDVVVSVFETNIRVLGGLLGGHSLAIMLKEKGEHMQ--W-YNDELLHMAKQLGYKLLPAFNTTSGLPYPRINLKFGIRKPEARTGTETDTCTACAGTLILEFAALSRFTGATIFEEYARKALDFLWEKRQRSSNLVGVTINIHTGDWVRKDSGVGAGIDSYYEYLLKAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDALLAFFPGLQVLKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQ---HPLRPEFAESTYFLYKATGDPYYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLFADKE-----------------------DIIFDIEDYIFTTEAH 495          
BLAST of alpha-1,2-Mannosidase vs. UniProt/SwissProt
Match: sp|Q9BV94|EDEM2_HUMAN (ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens OX=9606 GN=EDEM2 PE=1 SV=2)

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 298/553 (53.89%), Postives = 389/553 (70.34%), Query Frame = 3
Query:  111 VKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQMSLDRNVADGVGLPEMAAPPNMPLSAAPSDGLSTFTVADRYSTLLSCPNSKFHFKFMIYGEM 1769
            VK MF  AYD+Y+++AFP DEL+PLTC G DTWGSFSL+L+D+LDTL+++GN +EF+R +++L   ++ + ++N SVFETNIRVVGGLLSAHLLSK+AGVE+E GWPCSGPLLRM+E  ARKLLPAF T TGMP+GTVNL  GV  GET +TCTAG+ TF++EF  L+ LTGDPVFE VA  AL  +W  RS +GLVGNHIDV+ GKW A D+GIGAGVDSYFEYL+KG++L +  +L  MF EY + I  Y R DDW+ WV M K +VSMPVFQSLEA+WPGL ++ GD++ A+RT  NY+ VWKQFG  PEF+++ +G  +++R  YPLRPELIES MY+YRAT DP +L++G D + SI+ ++K  CG+ATI D+R H+L+NRMESFFLAET KYLYLLFD  NF+H   +           +   GEC++  GGYIFNTEAHPIDP AL+CC  +  ++  +++ + R +          Y +  ++    +N     G  E  A P    S    D       A +   LLSCP+  F  K  + G++
Sbjct:   39 VKAMFYHAYDSYLENAFPFDELRPLTCDGHDTWGSFSLTLIDALDTLLILGNVSEFQRVVEVLQDSVDFDIDVNASVFETNIRVVGGLLSAHLLSKKAGVEVEAGWPCSGPLLRMAEEAARKLLPAFQTPTGMPYGTVNLLHGVNPGETPVTCTAGIGTFIVEFATLSSLTGDPVFEDVARVALMRLWESRSDIGLVGNHIDVLTGKWVAQDAGIGAGVDSYFEYLVKGAILLQDKKLMAMFLEYNKAIRNYTRFDDWYLWVQMYKGTVSMPVFQSLEAYWPGLQSLIGDIDNAMRTFLNYYTVWKQFGGLPEFYNIPQGYTVEKREGYPLRPELIESAMYLYRATGDPTLLELGRDAVESIEKISKVECGFATIKDLRDHKLDNRMESFFLAETVKYLYLLFDPTNFIHNNGSTFD------AVITPYGECILGAGGYIFNTEAHPIDPAALHCCQ-RLKEEQWEVEDLMREF----------YSLKRSRSKFQKNTVSS-GPWEPPARPGTLFSPENHDQARERKPAKQKVPLLSCPSQPFTSKLALLGQV 573          
BLAST of alpha-1,2-Mannosidase vs. UniProt/SwissProt
Match: sp|Q8BJT9|EDEM2_MOUSE (ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Mus musculus OX=10090 GN=Edem2 PE=1 SV=1)

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 301/559 (53.85%), Postives = 392/559 (70.13%), Query Frame = 3
Query:  111 VKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLH-AGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQMSLDRNVADGVGLPE-----MAAPPNMPLSAAPSDGLSTFTVADRYSTLLSCPNSKFHFKFMIYGEM 1769
            VK MF  AYD+Y+++AFP DEL+PLTC G DTWGSFSL+L+D+LDTL+++GN +EF+R +++L   ++ + ++N SVFETNIRVVGGLLSAHLLSK+AGVE+E GWPCSGPLLRM+E  ARKLLPAF T TGMP+GTVNL  GV  GET +TCTAG+ TF++EF  L+ LTGDPVFE VA  AL  +W  RS +GLVGNHIDV+ GKW A D+GIGAGVDSYFEYL+KG++L +  +L  MF EY + I  Y   DDW+ WV M K +VSMPVFQSLEA+WPGL ++ GD++ A+RT  NY+ VWKQFG  PEF+++ +G  +++R  YPLRPELIES MY+YRAT DP +L++G D + SI+ ++K  CG+ATI D+R H+L+NRMESFFLAET KYLYLLF  +NF+H  G+T  S        M   GEC++  GGYIFNTEAHPIDP AL+CC     +     D +   Y L +         +  + +  + V  G   P+     +++P N P    P         A + + LLSCP+  F  K  + G++
Sbjct:   39 VKAMFYHAYDSYLENAFPYDELRPLTCDGHDTWGSFSLTLIDALDTLLILGNTSEFQRVVEVLQDNVDFDIDVNASVFETNIRVVGGLLSAHLLSKKAGVEVEAGWPCSGPLLRMAEEAARKLLPAFQTPTGMPYGTVNLLHGVNPGETPVTCTAGIGTFIVEFATLSSLTGDPVFEDVARVALMRLWESRSDIGLVGNHIDVLTGKWVAQDAGIGAGVDSYFEYLVKGAILLQDKKLMAMFLEYNKAIRNYTHFDDWYLWVQMYKGTVSMPVFQSLEAYWPGLQSLIGDIDNAMRTFLNYYTVWKQFGGLPEFYNIPQGYTVEKREGYPLRPELIESAMYLYRATGDPTLLELGRDAVESIEKISKVECGFATIKDLRDHKLDNRMESFFLAETVKYLYLLFHPNNFIHNNGSTFDS-------VMTPHGECILGAGGYIFNTEAHPIDPAALHCCRRLKEEQWEVEDLIKEFYSLKQ---------SRPKRAQRKTVRSGPWEPQSGPATLSSPANQPREKQP---------AQQRTPLLSCPSQPFTSKLALLGQV 572          
BLAST of alpha-1,2-Mannosidase vs. UniProt/SwissProt
Match: sp|Q9FG93|MNS4_ARATH (Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 1.005e-129
Identity = 221/463 (47.73%), Postives = 295/463 (63.71%), Query Frame = 3
Query:   87 DMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELE-PGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGG--GYIFNTEAH--PIDP 1460
            + K L  EV+ MF  A+D Y+ +AFPLDEL+PL+C G+DT G ++L+L+DSLDTL ++G+   F  +++ + K L  N N  VSVFET IRV+GGLLSAHL++      +  P +  +  LL ++E  AR++LPAF+T TG+PFG+VNL  GV   E+ IT TAG  T  LEFG L++LT DPVFE VA  A+  +W  RS L LVG HI+V  G+WT  D+GIG  +DS++EYLLK  +LF   E   +F E  R   +Y+  D W+  VNMD A++  PVF SL+AFWPGL  +AGD++ A+RT   +  VWK++GFTPE F++A       + SYPLRPELIES  ++Y+ATRDP  L  G D + S+Q  AK  CGY  I DV  H+ E+ MESFFLAET KYL+LLFD                     +    + ++D G   YIF+TE H  PI P
Sbjct:   36 EAKQLRDEVRGMFYHAFDGYMNNAFPLDELRPLSCQGEDTLGGYALTLIDSLDTLALLGDRERFTSSVEWIGKNLQFNINKTVSVFETTIRVLGGLLSAHLIASDYATGMRIPSY--NNELLVLAENLARRMLPAFDTPTGIPFGSVNLMYGVDKHESKITSTAGGGTLSLEFGVLSRLTNDPVFEQVAKNAVRGLWARRSNLDLVGAHINVFTGEWTQKDAGIGTSIDSFYEYLLKAYILFGDEEYLYIFQEAYRSAMQYLHKDPWYVEVNMDSAAIVWPVFNSLQAFWPGLQVLAGDVDPAIRTHTAFFSVWKRYGFTPEGFNLATLSVQYGQKSYPLRPELIESTYWLYKATRDPRYLDAGRDFVASLQYGAKCPCGYCHITDVELHKQEDHMESFFLAETVKYLWLLFD---------------------LAVDSDNLVDNGPYKYIFSTEGHLLPITP 475          
BLAST of alpha-1,2-Mannosidase vs. UniProt/SwissProt
Match: sp|Q9SXC9|MNS5_ARATH (Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 2.883e-104
Identity = 193/478 (40.38%), Postives = 271/478 (56.69%), Query Frame = 3
Query:   66 SGKNNQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDT---------------WGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPI 1454
            S ++ +   K +  +V+EMF  AYDNY+ +AFP DEL+PLT S  D+               +   +++LV+SL +L ++GN TEF + +  L + L  + +  V++FE NIRV+GGL+SAHLL+      L  G   +  LLR++E   ++ LPAF T TG+P+  +NL++GV   ET+ T T+G  + VLE GAL++LTGDP FE  ALRAL  +W  RS L L+G  +DV+ G+W    S IGAGVDS++EYLLK  +LF + +   MF        KY RH  W+   NM     +     SL+AFWPGL  + GD+  A  +   +  VW++FG  PE + +           YPLRPEL ES  Y+Y+AT+DP  L +G  +++S+    K   G+A++ DV T QLE+   SFFLAET KYLYLLFD D+F                         +    YIF TE HPI
Sbjct:   26 SSQHIEVKKKQMREKVREMFYHAYDNYMTYAFPHDELKPLTKSFTDSLSELGNLKLEHLPTDYNGSAVTLVESLSSLAILGNSTEFEKGVLWLSENLTFDIDARVNLFECNIRVLGGLISAHLLAIDPNNRLIQG-SYNNQLLRLAEDLGKRFLPAFETPTGLPYAWINLKNGVMENETTETSTSGCGSLVLEMGALSRLTGDPRFESAALRALRQLWRMRSSLDLLGTTLDVVTGEWIEYSSSIGAGVDSFYEYLLKAYILFGKEDYWRMFHSAYLASQKYFRHGPWYHEANMWSGKPTYWQLTSLQAFWPGLQVLVGDIAAANSSHREFFHVWEKFGVLPERYLLDHQIIHPTMKYYPLRPELAESTFYLYQATKDPWYLDVGESMVKSLNLYTKVPGGFASVRDVTTMQLEDHQHSFFLAETCKYLYLLFD-DSF-------------------------VAKRNYIFTTEGHPI 476          
BLAST of alpha-1,2-Mannosidase vs. UniProt/SwissProt
Match: sp|Q92611|EDEM1_HUMAN (ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 3.553e-98
Identity = 195/450 (43.33%), Postives = 277/450 (61.56%), Query Frame = 3
Query:   90 MKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLL---SKRAGVELEPGWPCSGPLLRMSEAFARKLLPAF-NTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSK-LGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMR---------HDDWHFWVNMDKASVSM--PVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTT 1352
            M+ LA   + MF F YDNY+ HAFP DEL P+ C G+             D  G++SL+LVD+LDTL +MGN +EF++A+KL++  ++ +K+  V VFE  IRV+G LLSAH +   SK+   ++         LL M+   A +LLPAF NT TG+P+  VNL++GVP    + TCTAG  + ++EFG L++L GD  FE VA RA+ A+WN RS   GL+GN +++  G W    SG+GAG+DS++EYLLK  +LF   E  EMF+   + I  Y+R           D   +VN++  S  +      SL+AF+PGL  + GD+E A+     Y+ +WK++G  PE ++     P      YPLRPEL+ES   +Y+AT++P  L +G+DI++S++   K  CGYAT++ V     E+RMESFFL+ET KYLYLLFDEDN +H   T
Sbjct:  130 MRDLA---RGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQPFGDMTIK-DYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDTNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERYNWQLQAP--DVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSTEDRMESFFLSETCKYLYLLFDEDNPVHKSGT 573          
BLAST of alpha-1,2-Mannosidase vs. TrEMBL
Match: A0A1S3H7T5 (alpha-1,2-Mannosidase OS=Lingula unguis OX=7574 GN=LOC106152880 PE=3 SV=1)

HSP 1 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 307/487 (63.04%), Postives = 390/487 (80.08%), Query Frame = 3
Query:  108 EVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYE 1568
            +V  MF  AYD Y+Q+A+P DEL+P+TC G DTWGSFSL+L+D+LDTL +MGN TEFRR    L  +++ + +IN SVFETNIRVVGGLLSAHLL+KRA + LEPGWPCSGPLLR++E  AR+LLPAFNTSTGMP+GTVNL+ GVP GET++TCTAGV TF++EFG L++LTGDP+FE  A+RAL ++WN+RS++GLVGNHI+V  G+WTA DSGIGAGVDSYFEYL+KG++L ++PEL EMF  + + I  +++ DDW+ WV+M K  V++PVFQSLEAFWPGL ++ GD++ A++TLHNYHQVWKQ GFTPEF+++AK E  Q R  YPLRPELIES MY+YRAT+DP +L++G+DI+ SI+   KT CGYAT+ +V+TH LENRMESFFLAETTKYLYLLFD +NF+H  T GH       V     GEC+ID GGY+FNTEAHP+D  ALYCCS + H+D + +  M  +  LL LL++ D E
Sbjct:   63 KVVRMFHHAYDGYMQYAYPYDELRPITCDGHDTWGSFSLTLIDALDTLAIMGNMTEFRRVAYKLADEVDFDIDINASVFETNIRVVGGLLSAHLLTKRADMVLEPGWPCSGPLLRLAEDVARRLLPAFNTSTGMPYGTVNLRHGVPEGETAVTCTAGVATFIVEFGTLSKLTGDPIFEQTAMRALTSLWNYRSEIGLVGNHINVQTGQWTALDSGIGAGVDSYFEYLVKGAILLQKPELMEMFASFKQSIESHLKQDDWYMWVHMVKGQVTLPVFQSLEAFWPGLQSLIGDIDKAMKTLHNYHQVWKQHGFTPEFYNIAKSEVHQGREGYPLRPELIESTMYLYRATKDPYLLEVGVDILESIEHSTKTRCGYATVQNVKTHMLENRMESFFLAETTKYLYLLFDPENFIH-NTAGHG-----TVIQTPSGECIIDAGGYVFNTEAHPVDTAALYCCSAEKHQDDMLVQDMQDNVNLLSLLDLVDNE 543          
BLAST of alpha-1,2-Mannosidase vs. TrEMBL
Match: A0A1B6FVI3 (alpha-1,2-Mannosidase (Fragment) OS=Cuerna arida OX=1464854 GN=g.29649 PE=3 SV=1)

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 306/481 (63.62%), Postives = 392/481 (81.50%), Query Frame = 3
Query:   63 VSGKNNQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAG---TTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHK 1496
             S +  + D+  L  EV+EMF  AY  Y+++A+P DEL+PL+C G DTWGS+SL+L+D+LDTL VMGNY+EFRR + ++  + N + NINVSVFETNIR+VGGLLSAHLLS+RAGVELEPGWPC+GPLLR++E  A++L+ AF+T+TGMP+GTVNL+ GVP GETSITCTAGV TF+LEFG L++LTGDP++E VAL ALHA+++HRS +GL GNHIDVM G+WTA DSGIGAGVDSY EYL+KG++L +RPEL  +F+E  R I+K++R +DW+ WV+M K  V++PVFQSLEA+WPG+L++ GD+ G ++++HNYHQVWKQ+GFTPEF+++A+G+    R SYPLRPELIES MY+YRAT+DP +L +G DI+RSIQ  A+T CGYATI D R H LENRMESFFLAETTKYLYLLFD DNF+H      T H+ P        SG EC++D GGYIFNTEAHP+DPGAL CCS+ +++
Sbjct:   28 ASRQYTKEDLLKLREEVREMFNHAYSGYLKYAYPYDELRPLSCDGVDTWGSYSLTLIDALDTLAVMGNYSEFRRVVDIVTSKANFDANINVSVFETNIRIVGGLLSAHLLSQRAGVELEPGWPCNGPLLRLAEDVAQRLIAAFDTTTGMPYGTVNLRHGVPPGETSITCTAGVGTFILEFGTLSRLTGDPIYEEVALNALHALYHHRSSIGLYGNHIDVMTGRWTAQDSGIGAGVDSYLEYLVKGALLVQRPELMAIFNEGRRAIDKHLRRNDWYLWVSMHKGQVTLPVFQSLEAYWPGVLSLIGDISGGMKSMHNYHQVWKQYGFTPEFYNIAQGQVGTNRESYPLRPELIESTMYLYRATKDPFLLDVGTDILRSIQHSARTRCGYATIKDCRDHTLENRMESFFLAETTKYLYLLFDPDNFIHNDGRHGTLHTLP--------SGRECILDAGGYIFNTEAHPLDPGALLCCSENFNE 500          
BLAST of alpha-1,2-Mannosidase vs. TrEMBL
Match: A0A2P8XI18 (alpha-1,2-Mannosidase OS=Blattella germanica OX=6973 GN=C0J52_21317 PE=3 SV=1)

HSP 1 Score: 649.432 bits (1674), Expect = 0.000e+0
Identity = 301/480 (62.71%), Postives = 393/480 (81.88%), Query Frame = 3
Query:   72 KNNQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQL 1511
            K ++ D++ L  EV++MFQ AY +Y+++A+P DEL+PL+C G DTWGS+SL+L+D+LDTL VMGNYTEF+R + ++    N + NINVSVFETNIR++GGLLSAHLLS RAGV +EPGWPC+GPLL+++E  AR+LL AF+T+TGMP+GTVNL+ GVP+GETSITCTAGV TF+LEFG L++LTGDP+FE VA+ AL+A+++HRS +GLVGNHIDV  G+WTA D+GIGAGVDSY+EYL KG++L +RPEL  MF+E    I+KY++ DDWH WV+M K  V++PVFQSLEA+WPG+L++ GD+  A+++LHNYHQVWKQ+GFTPE++++ +GE    R  YPLRPEL+ES+MY+YRAT DP +L++G DI+RSIQ  A+T CGYATI DVR H+ E+RMESFFLAETTKYLYLLFD DNF+      H+R  + +V     GECV++ GGYIFNTEAHPIDPGAL+CCS     D+ ++
Sbjct:   28 KYDKKDLQNLREEVRQMFQHAYSSYLKYAYPYDELRPLSCDGVDTWGSYSLTLIDALDTLAVMGNYTEFQRVVDIITTNANFDANINVSVFETNIRIIGGLLSAHLLSYRAGVAVEPGWPCNGPLLQLAEDVARRLLAAFDTTTGMPYGTVNLRHGVPVGETSITCTAGVGTFILEFGTLSRLTGDPLFEEVAMNALYALYHHRSPIGLVGNHIDVQTGRWTAQDAGIGAGVDSYYEYLAKGAILLQRPELMHMFNEGRVAIDKYLKRDDWHLWVSMSKGQVTLPVFQSLEAYWPGVLSLIGDINKAIKSLHNYHQVWKQYGFTPEYYNIPQGEAGANREGYPLRPELVESVMYLYRATGDPYLLEVGKDILRSIQHSARTPCGYATIKDVRDHRKEDRMESFFLAETTKYLYLLFDTDNFI------HNRGQHGMVVKTPWGECVLEAGGYIFNTEAHPIDPGALHCCSGHRQADIQEV 501          
BLAST of alpha-1,2-Mannosidase vs. TrEMBL
Match: A0A1B6GCW2 (alpha-1,2-Mannosidase (Fragment) OS=Cuerna arida OX=1464854 GN=g.29651 PE=3 SV=1)

HSP 1 Score: 647.121 bits (1668), Expect = 0.000e+0
Identity = 306/481 (63.62%), Postives = 392/481 (81.50%), Query Frame = 3
Query:   63 VSGKNNQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAG---TTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHK 1496
             S +  + D+  L  EV+EMF  AY  Y+++A+P DEL+PL+C G DTWGS+SL+L+D+LDTL VMGNY+EFRR + ++  + N + NINVSVFETNIR+VGGLLSAHLLS+RAGVELEPGWPC+GPLLR++E  A++L+ AF+T+TGMP+GTVNL+ GVP GETSITCTAGV TF+LEFG L++LTGDP++E VAL ALHA+++HRS +GL GNHIDVM G+WTA DSGIGAGVDSY EYL+KG++L +RPEL  +F+E  R I+K++R +DW+ WV+M K  V++PVFQSLEA+WPG+L++ GD+ G ++++HNYHQVWKQ+GFTPEF+++A+G+    R SYPLRPELIES MY+YRAT+DP +L +G DI+RSIQ  A+T CGYATI D R H LENRMESFFLAETTKYLYLLFD DNF+H      T H+ P        SG EC++D GGYIFNTEAHP+DPGAL CCS+ +++
Sbjct:   28 ASRQYTKEDLLKLREEVREMFNHAYSGYLKYAYPYDELRPLSCDGVDTWGSYSLTLIDALDTLAVMGNYSEFRRVVDIVTSKANFDANINVSVFETNIRIVGGLLSAHLLSQRAGVELEPGWPCNGPLLRLAEDVAQRLIAAFDTTTGMPYGTVNLRHGVPPGETSITCTAGVGTFILEFGTLSRLTGDPIYEEVALNALHALYHHRSSIGLYGNHIDVMTGRWTAQDSGIGAGVDSYLEYLVKGALLVQRPELMAIFNEGRRAIDKHLRRNDWYLWVSMHKGQVTLPVFQSLEAYWPGVLSLIGDISGGMKSMHNYHQVWKQYGFTPEFYNIAQGQVGTNRESYPLRPELIESTMYLYRATKDPFLLDVGTDILRSIQHSARTRCGYATIKDCRDHTLENRMESFFLAETTKYLYLLFDPDNFIHNDGRHGTLHTLP--------SGRECILDAGGYIFNTEAHPLDPGALLCCSENFNE 500          
BLAST of alpha-1,2-Mannosidase vs. TrEMBL
Match: A0A1Y1K2H4 (alpha-1,2-Mannosidase OS=Photinus pyralis OX=7054 GN=PPYR_06963 PE=3 SV=1)

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 295/481 (61.33%), Postives = 390/481 (81.08%), Query Frame = 3
Query:   78 NQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQM 1520
            N+ ++     EV+EMF  AYD Y+++A+P DEL+PL+C G DTWGS+SL+L+D+LDTL +MGNYTEF+R +K+L  + N + NINVSVFETNIR++GGL+SAHLLS RAGV++EPGWPC+GPLLR++E  A++L+ AF+T +GMP+GTVNL+ GVP+GET++TCTAG+ TF+LEFG L++LTGDP++E VA+ A+++++  RS LGL GNHIDV+ G WTA D+GIGA VDSYFEYL+KGS+L ++PEL ++F E  R I+KY++ +DW+ WV+M K  V++PVFQSLEA+WPG+L++ GD   A++TLHNYHQVW+Q+GFTPEF+++A+ E    R +YPLRPELIESIMY+YRAT DP ++ MG+DI+RSIQ  AKT CGYATI DVR H+ E+RMESFFLAETTKYLYLLFD +NF+      H++ D+ VV     GEC+I+ GGYIFNTEAHPIDP ALYCC DK  + L   D +
Sbjct:   22 NKSEIIKFREEVREMFNHAYDGYLKYAYPYDELRPLSCDGVDTWGSYSLTLIDALDTLAIMGNYTEFQRVVKILTSKANFDANINVSVFETNIRIIGGLISAHLLSHRAGVDVEPGWPCNGPLLRLAEDVAKRLITAFDTRSGMPYGTVNLRHGVPVGETAVTCTAGIGTFILEFGTLSRLTGDPLYEEVAMNAIYSLYQQRSHLGLYGNHIDVLTGHWTAQDAGIGAAVDSYFEYLVKGSILLQKPELMKIFWEARRSIDKYLKREDWYLWVSMTKGQVTLPVFQSLEAYWPGVLSLIGDTSSAMKTLHNYHQVWQQYGFTPEFYNIAQAEAGADRENYPLRPELIESIMYLYRATGDPQLISMGVDILRSIQHSAKTPCGYATIKDVRDHRKEDRMESFFLAETTKYLYLLFDTENFI------HNQGDHGVVVNTPNGECIIEAGGYIFNTEAHPIDPSALYCCHDKPKEKLFNFDSL 496          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Cavefish
Match: edem2 (ER degradation enhancer, mannosidase alpha-like 2 [Source:ZFIN;Acc:ZDB-GENE-060519-1])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 289/556 (51.98%), Postives = 381/556 (68.53%), Query Frame = 3
Query:  120 MFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTT----GHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCC-SDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQMSLDRNVADGVGLPEMAAPPNMPLSAAPSDGLSTFTVADRYSTLLSCPNSKFHFKFMIYGEMI 1772
            MF  AY++Y+ +A+P DEL+PLTC GQDTWGSFSL+L+D+LDTL+++GN+TEF+R   LL   ++ + ++N SVFETNIRVVGGLLSAHLLSK+AG+E+E GWPCSGPLLRM+E  ARKLLPAF+T TGMP+GTVNL  GV   ET +TCTAGV TF+LEF  L+ LTGDPVFE VA +AL ++W  RS +GLVGNHIDV+  KW A D+GIGAGVDSYFEYL+KG+++ +  EL   F E+ + +  + + DDW+ WV M K +VSMPVFQSLEAFWPGL ++ GD+  A RT HNY+ VW+QFG  PEF+S+ +G  + +R  YPLRPELIES MY+Y+AT DP  L++G D + SI+ + +  CG+A+I D+R H+L+NRMESFFLAET KYLYLLFD DNF+H   T    G  R           G+C+++ GGYIFNTEAHP+DP AL+CC  D+  +  +Q   +    PL   ++ +       + S D   ++ + LP      N                      +LSCP   F  +  + G++ 
Sbjct:    1 MFYHAYNSYLDNAYPYDELRPLTCDGQDTWGSFSLTLIDALDTLLILGNHTEFQRVATLLQDTVDFDIDVNASVFETNIRVVGGLLSAHLLSKQAGMEVEEGWPCSGPLLRMAEDAARKLLPAFHTPTGMPYGTVNLLRGVNPTETPVTCTAGVGTFILEFSTLSHLTGDPVFENVARKALSSLWKTRSDIGLVGNHIDVITSKWVAQDAGIGAGVDSYFEYLVKGAIMLQDEELLTTFQEFDKSLKNFTKFDDWYLWVQMHKGTVSMPVFQSLEAFWPGLQSLIGDINSATRTFHNYYTVWRQFGGLPEFYSIPQGYTVDKREGYPLRPELIESAMYLYKATGDPTFLKLGRDAVESIEKITRVKCGFASIKDIRDHKLDNRMESFFLAETIKYLYLLFDPDNFIHNNGTRFELGGPR-----------GDCILNAGGYIFNTEAHPLDPAALHCCRKDQDERRELQDILLSLSEPLKSPIDQS------VEASGDTGSSESIALPPGERKKN---------------------PVLSCPTQPFSSRLAVMGQVF 518          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Cavefish
Match: edem3 (ER degradation enhancing alpha-mannosidase like protein 3 [Source:NCBI gene;Acc:103023678])

HSP 1 Score: 297.36 bits (760), Expect = 1.581e-89
Identity = 190/481 (39.50%), Postives = 266/481 (55.30%), Query Frame = 3
Query:   63 VSGKNNQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSI-----TCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSK-LGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVF-QSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH 1448
            +S    + +   L  +V EMF  AY NY+ HA+P DEL PLTC G+            D  G FSL+L+D+LDTLV++    EF  A+K ++K +  + +I VSVFETNIRV+GGLL  H ++       E        LL M++    +LLPAFNTS+G+P+  VNL+ GV   ET       TCTA   T +LEF AL++ TGDP+FE  A RAL  +W  R +   LVG  I++  G+W   DSG+GAG+DSY+EYLLK  VL    +  + F+ +   I KY+        V++ K  +    +  SL AF+PGL  + GD+  A+ T    +QV K+  F PE F+        Q   +PLRPE  ES  ++Y+ATRDP  L++G  ++ ++   A+  CG+A + DVRT   E+RM+SFFLAE  KYL+LLF E++                       +   D   Y+F TEAH
Sbjct:   18 ISKTMTRDEKHRLRNQVVEMFDHAYQNYMDHAYPADELMPLTCRGRVRGLEPSRGDVDDALGKFSLTLIDTLDTLVLLNKTEEFEEAVKRVLKDVRLDNDIVVSVFETNIRVLGGLLGGHSMAVMLKERGERMLWYQDELLNMAKDLGIRLLPAFNTSSGLPYPRVNLRHGVQGPETRTGTETDTCTACAGTIILEFAALSRFTGDPIFEAHARRALDFLWEKRQRNSNLVGTTINIHSGEWVRRDSGVGAGIDSYYEYLLKAYVLLGDDQFLQRFNVHYASIMKYISQPPLLLDVHIHKPLLPARTWMDSLLAFFPGLQVLKGDIRPAIETHEMLYQVTKKHNFLPEAFTTDFRVHWAQ---HPLRPEFAESTYFLYKATRDPYYLEVGRTVLENLNRFARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLFLLFAEED-----------------------DLPFDVEDYVFTTEAH 472          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Cavefish
Match: edem3 (ER degradation enhancing alpha-mannosidase like protein 3 [Source:NCBI gene;Acc:103023678])

HSP 1 Score: 296.975 bits (759), Expect = 2.294e-89
Identity = 190/481 (39.50%), Postives = 266/481 (55.30%), Query Frame = 3
Query:   63 VSGKNNQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSI-----TCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSK-LGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVF-QSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH 1448
            +S    + +   L  +V EMF  AY NY+ HA+P DEL PLTC G+            D  G FSL+L+D+LDTLV++    EF  A+K ++K +  + +I VSVFETNIRV+GGLL  H ++       E        LL M++    +LLPAFNTS+G+P+  VNL+ GV   ET       TCTA   T +LEF AL++ TGDP+FE  A RAL  +W  R +   LVG  I++  G+W   DSG+GAG+DSY+EYLLK  VL    +  + F+ +   I KY+        V++ K  +    +  SL AF+PGL  + GD+  A+ T    +QV K+  F PE F+        Q   +PLRPE  ES  ++Y+ATRDP  L++G  ++ ++   A+  CG+A + DVRT   E+RM+SFFLAE  KYL+LLF E++                       +   D   Y+F TEAH
Sbjct:   18 ISKTMTRDEKHRLRNQVVEMFDHAYQNYMDHAYPADELMPLTCRGRVRGLEPSRGDVDDALGKFSLTLIDTLDTLVLLNKTEEFEEAVKRVLKDVRLDNDIVVSVFETNIRVLGGLLGGHSMAVMLKERGERMLWYQDELLNMAKDLGIRLLPAFNTSSGLPYPRVNLRHGVQGPETRTGTETDTCTACAGTIILEFAALSRFTGDPIFEAHARRALDFLWEKRQRNSNLVGTTINIHSGEWVRRDSGVGAGIDSYYEYLLKAYVLLGDDQFLQRFNVHYASIMKYISQPPLLLDVHIHKPLLPARTWMDSLLAFFPGLQVLKGDIRPAIETHEMLYQVTKKHNFLPEAFTTDFRVHWAQ---HPLRPEFAESTYFLYKATRDPYYLEVGRTVLENLNRFARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLFLLFAEED-----------------------DLPFDVEDYVFTTEAH 472          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Cavefish
Match: edem1 (ER degradation enhancer, mannosidase alpha-like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-808])

HSP 1 Score: 285.034 bits (728), Expect = 2.208e-87
Identity = 185/476 (38.87%), Postives = 263/476 (55.25%), Query Frame = 3
Query:  114 KEMFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRS-KLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDD-----------WHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH--PIDP 1460
            K+MF F YDNY++HAFP DEL P+ C+G+             D  G++SL+L+D+LDTL+V+GN +EF RA+KL++  ++ +K+  V VFE NIR    +L    L     V+          +L M+          F+         VNL+ GVP    + TCTAG  + ++EFG L++L GD  FE VA RA+ A+WN RS + GL+GN +++  G+W    SG+GAG+DS++EYLLK  +LF   E  +MF      I  ++R               +  VNM    +      SL+AF+PGL  + GD+E A+     Y+ +W++FG  PE ++     P      YPLRPEL+ES   +Y+AT++P  L +G+DI++S++T  K  CGYAT++ V     E+RMESFFL+ET KYLYLLFDE+N LH                         G  YIF TE H  PIDP
Sbjct:  118 KDMFYFGYDNYMKHAFPEDELNPIDCAGRGPDTLNPSNININDVLGNYSLTLIDTLDTLLVLGNVSEFHRAVKLVIDTVSFDKDSTVQVFEANIRY--SVLCFLFLDLSIDVQF---------ILYMNLVLM-CFFVVFHKQ-------VNLKRGVPADSINETCTAGAGSLLVEFGILSRLIGDSTFEWVARRAVRALWNLRSNETGLLGNVVNIQTGQWVGKQSGLGAGMDSFYEYLLKSYILFGEKEDYKMFTAAYESIQSHLRRGREACNEGEGDPPLYVNVNMFNGQIMNTWIDSLQAFFPGLQVLNGDVENAICLHAFYYAIWRRFGALPERYNWQLQAP--DVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLETNTKVKCGYATLHHVVDKSKEDRMESFFLSETCKYLYLLFDEENPLHRS-----------------------GSRYIFTTEGHVVPIDP 549          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Cavefish
Match: si:ch211-282j22.3 (ER degradation-enhancing alpha-mannosidase-like protein 3 [Source:NCBI gene;Acc:103027400])

HSP 1 Score: 289.271 bits (739), Expect = 3.989e-87
Identity = 190/469 (40.51%), Postives = 268/469 (57.14%), Query Frame = 3
Query:  108 EVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLS---KRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGV--PIGETSI---TCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSK-LGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVF-QSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH 1448
            +V EMF  AY +Y+++A+P DEL PL+C G+            D+ G FSL+L+D+LDTLV++    EF  A+K  +K +  + +I VSVFETNIRV+GGLL AH+++   K+ G  ++  W     LL M++    +LLPAFNT++G+P+  VNL+ GV  P+  T     TCTA   T +LEF AL++L+G  VFE  A +AL  +W  R +   L+G  I++  G W   DSG+GAG+DSY+EYL+K  +L       E F+ +   I KY+        V+M   +V++  +  SL AF+PGL  + GDL+ A+ T    +QV KQ  F PE F+    E       +PLRPE  ES  ++Y+AT DP  L++G  I+  + T A+  CG+A + DVRT   E+RM+SFFLAE  KYLYLLF E + L                         D   YIF TEAH
Sbjct:   19 QVLEMFDHAYGSYMKYAYPADELMPLSCRGRVRGLEPNRGDIDDSLGKFSLTLIDTLDTLVLLNRLEEFEEAVKKTVKDVRLDNDIVVSVFETNIRVLGGLLGAHVMADLLKQRGERMQ--W-YRDELLHMAKDLGYRLLPAFNTTSGLPYPRVNLRYGVVNPLSRTGTETDTCTACAGTMILEFAALSRLSGVSVFEEHARKALDVLWEKRQRGSDLMGTVINIHNGDWVRRDSGVGAGIDSYYEYLMKAYILLGDNVYLERFNTHYSAIMKYISQPPLLLNVHMHNPTVNVRSWMDSLLAFFPGLQVLRGDLKPAIETHEMLYQVTKQHKFLPEAFTT---EFRVHWGQHPLRPEFAESTYFLYKATGDPYYLKVGQSIVEKLNTHARVPCGFAAVQDVRTGTHEDRMDSFFLAEMFKYLYLLFSEKSHL-----------------------PFDIDDYIFTTEAH 458          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006166.1 (pep scaffold:Pmarinus_7.0:GL476535:951795:959705:-1 gene:ENSPMAG00000005553.1 transcript:ENSPMAT00000006166.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 261/410 (63.66%), Postives = 321/410 (78.29%), Query Frame = 3
Query:  258 MGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSG--GECVIDGGGYIFNTEAHPIDPGALYCCS 1481
            +GN TEF+R    L   +N N+++NVSVFETNIRVVGGLLSAHLLSK+AGVELE GWPCSGPLLRM+E  ARKLLPAF T+TGMP+GTVNL+ GV   ETS+TCTAGV TF+LEF AL++LTGDPVFE  A RAL ++W  RS++GLVGNHIDV    W A D+GIGAG+DSYFEYL+KG++L   PE  EMF EY   I KYM+HDDW+ WV+M K +VSMPVFQSL+A+WPGL ++ G+++ A++TLHNYHQVW+QFG  PEF+++     + +R  YPLRPEL+ES MY+YRAT+DP +L++G DI+ +I+  A+  CGYAT+ +V+  +LENRMESFFLAETTKYLYLLFD DNFLH           +V   VS   GEC++  GGYIFNTEAHPIDP ALYCCS
Sbjct:    2 LGNTTEFQRVSLFLEDAINFNQDVNVSVFETNIRVVGGLLSAHLLSKQAGVELEDGWPCSGPLLRMAEQVARKLLPAFQTATGMPYGTVNLRHGVHPTETSVTCTAGVGTFILEFSALSRLTGDPVFEDTARRALLSLWTTRSEIGLVGNHIDVKTSAWVAQDAGIGAGIDSYFEYLVKGAILLHEPEYMEMFKEYSEAIEKYMKHDDWYVWVHMSKGTVSMPVFQSLDAYWPGLQSLVGNIDSAMKTLHNYHQVWRQFGGLPEFYNIPHSTTVDKREGYPLRPELVESAMYLYRATKDPFLLELGQDILEAIEKNARVECGYATVKNVQDQRLENRMESFFLAETTKYLYLLFDPDNFLHNSG--------EVSDSVSTPFGECILGAGGYIFNTEAHPIDPAALYCCS 403          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Sea Lamprey
Match: edem1 (ER degradation enhancer, mannosidase alpha-like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-808])

HSP 1 Score: 244.973 bits (624), Expect = 3.032e-73
Identity = 176/484 (36.36%), Postives = 256/484 (52.89%), Query Frame = 3
Query:   99 LAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNIN-----------VSVFETNIRVVGGLLSAHLL----SKRAGVELEPGWPCSGPLLRMSEAFARKLLPAF-NTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHR-SKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSM----PVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH 1448
            L  + + MF   YDNY+ HAFP DEL P+ C G+             D  G++SL+L+D+LDTL VMGN ++   A      Q + N +                     RV+G LLSAHL+    ++  G    P +     LL M+   A +LLPAF NT+TG+P+  VNL+ GVP+  +  TCTAG  + ++EFG L++L GDP +EG A RA+ ++W  R +  GL+GN I+V  G+W  + SG+GA +DS++EYLLK  V+F   +   +  +YLR    + R        N      S+    P   S     P +  +AGD+E A+     Y+ +W++F   PE ++     P    + YPLRPEL+ES   +Y+AT++P  L +G  I++SI+   +  CGYAT++ V     E+RMESFFL+ET KYL+LLFD +N +H G                       G  +IF TE H
Sbjct:   53 LREDARRMFYVGYDNYMSHAFPADELNPIDCRGRGPDVDNPSNININDVLGNYSLTLIDALDTLAVMGNASQNGDA----HTQCDDNTHFEHFGLFLCAHAAAHACPGACRVLGSLLSAHLIITDTAQPFGDMALPDY--EDELLHMAHELASRLLPAFENTNTGIPYPRVNLRRGVPLDVSEETCTAGAGSLLVEFGVLSRLLGDPTYEGAARRAVRSLWALRCNTTGLLGNVINVQSGQWVGSQSGLGAELDSFYEYLLKLKVIFFF-KFLILLFKYLR----FQRESSCLRLCNHGLVFPSLFENCPKVLSTSTITPLVQVLAGDVEEAICLHAFYYAIWQRFEALPERYNWQLKAP--DVHFYPLRPELVESTYLLYQATKNPFYLHVGQKILQSIEKHTRVRCGYATLHHVIDKSKEDRMESFFLSETCKYLFLLFDIENPVHVG-----------------------GRAFIFTTEGH 500          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Sea Lamprey
Match: edem3 (ER degradation enhancer, mannosidase alpha-like 3 [Source:ZFIN;Acc:ZDB-GENE-070801-5])

HSP 1 Score: 207.223 bits (526), Expect = 3.083e-58
Identity = 123/324 (37.96%), Postives = 177/324 (54.63%), Query Frame = 3
Query:  498 STGMPFGTVNLQSGV--PIGETSI---TCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSK-LGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVF-QSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH 1448
            S+G+P+  VNL+ G+  P   T +   TCTA   T +LEF AL++LTGD VFE  A RA+  +W+ R +   LVG  I++  G W   DSG+GAG+DSY+EYL K  +L       E F+ +   I KY+        V+M K +++   +  +L AF+PGL  + GD+  A+ T    +QV ++  F PE F+    +       +PLRPE  ES  ++++AT DP  L++G  I+ ++  +A+  CG+A + DVRT   E+RM+SFFLAE  KYLYLLF E   L                       V D   Y+F TEAH
Sbjct:    1 SSGLPYPRVNLKHGMVRPQSRTGVEVDTCTACAGTMLLEFAALSRLTGDSVFEDHARRAMDFLWDKRQRGSNLVGTVINIHTGDWVRRDSGVGAGIDSYYEYLFKAYILLGDDTFLERFNIHYEAIMKYISQPPLLLDVHMHKPTLNAKTWMDALLAFFPGLQVLKGDIRPAIETHEMLYQVTRRHNFLPEAFTT---DFRVHWGQHPLRPEFAESTYFLFKATGDPYYLEVGKSIVENLNKLARVPCGFAAMKDVRTSSHEDRMDSFFLAEMFKYLYLLFAEKEDL-----------------------VFDIEAYVFTTEAH 298          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Sea Lamprey
Match: edem3 (ER degradation enhancer, mannosidase alpha-like 3 [Source:ZFIN;Acc:ZDB-GENE-070801-5])

HSP 1 Score: 207.223 bits (526), Expect = 3.092e-58
Identity = 123/324 (37.96%), Postives = 177/324 (54.63%), Query Frame = 3
Query:  498 STGMPFGTVNLQSGV--PIGETSI---TCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSK-LGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVF-QSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH 1448
            S+G+P+  VNL+ G+  P   T +   TCTA   T +LEF AL++LTGD VFE  A RA+  +W+ R +   LVG  I++  G W   DSG+GAG+DSY+EYL K  +L       E F+ +   I KY+        V+M K +++   +  +L AF+PGL  + GD+  A+ T    +QV ++  F PE F+    +       +PLRPE  ES  ++++AT DP  L++G  I+ ++  +A+  CG+A + DVRT   E+RM+SFFLAE  KYLYLLF E   L                       V D   Y+F TEAH
Sbjct:    1 SSGLPYPRVNLKHGMVRPQSRTGVEVDTCTACAGTMLLEFAALSRLTGDSVFEDHARRAMDFLWDKRQRGSNLVGTVINIHTGDWVRRDSGVGAGIDSYYEYLFKAYILLGDDTFLERFNIHYEAIMKYISQPPLLLDVHMHKPTLNAKTWMDALLAFFPGLQVLKGDIRPAIETHEMLYQVTRRHNFLPEAFTT---DFRVHWGQHPLRPEFAESTYFLFKATGDPYYLEVGKSIVENLNKLARVPCGFAAMKDVRTSSHEDRMDSFFLAEMFKYLYLLFAEKEDL-----------------------VFDIEAYVFTTEAH 298          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Sea Lamprey
Match: man1b1a (mannosidase, alpha, class 1B, member 1a [Source:ZFIN;Acc:ZDB-GENE-091116-34])

HSP 1 Score: 159.844 bits (403), Expect = 4.615e-42
Identity = 149/479 (31.11%), Postives = 238/479 (49.69%), Query Frame = 3
Query:  111 VKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGV--PIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKL-GLVGNHIDVMKGKWTATDS-GIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRH-------DDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAG-------DLEGAVRTLHNYHQVWKQF--GFTPEF--FSVAKG-------EPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNC-GYATIYDVRT---HQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH 1448
            V E F  A+  Y + A+  DEL+PL+ S  + W    L+++D+LDT+ +MG   EF  A + +  +LN  KN++V++FE+ IR++GGLL    L+   G +L          L  +     +L+PAFNT + +P+  VNL++G   P   TS +  A VT+  LEF  L+ LTGDP ++G A    H +     KL GLV   I+   G+++ +    +GA  DSY+EYLLK  +   + E + + + YL  ++   +H       +   F   +   ++  P    L  F PG L +          +E A + L   +Q+++Q   G +PE   F++  G       +P  + N   LRPE +ES+ Y++R T        G +I +S Q   +    GY++I +VR+    +  ++MESFFL ET KY +LLF ++  L +       PD                  ++FNTEAH
Sbjct:  193 VVEAFLHAWRGYREFAWGHDELKPLSHSFSE-WFGLGLTILDALDTMWIMGLENEFEEARQWVSTKLNFAKNVDVNLFESTIRIMGGLLGTFHLT---GDKL---------FLDKAVDLGNRLMPAFNTPSKVPYSDVNLRTGQAHPPKWTSDSSVAEVTSIQLEFRELSHLTGDPKYKGAADAVTHHVLGLSGKLDGLVPMFINTHSGQFSRSGVYTMGARADSYYEYLLKQWLQGGKRE-KHLLNSYLEAMSGMQKHLLGTSQPNHLTFIGELISGALK-PKMDHLVCFLPGTLALGARHGLDPSHMELAEKLLETCYQMYQQMETGLSPEISHFNMQAGSTHDIEVKPADRHNL--LRPETVESLFYLHRFTDKVKYQDWGWEIFQSFQRYTRVATGGYSSINNVRSPSNPEPRDKMESFFLGETLKYFFLLFSDNKALLS-------PD-----------------KHVFNTEAH 630          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Yeast
Match: MNL1 (Alpha-1,2-specific exomannosidase of the endoplasmic reticulum; involved in glycan trimming of both folded and misfolded glycoproteins; complexes with Pdi1p, and trims a mannose from Man8GlcNac2 glycans to generate Man7GlcNac2, an oligosaccharide signal on glycoproteins destined for ER-associated protein degradation; requires Pdi1p for stability and substrate recognition; human homolog EDEM1 can complement yeast null mutant [Source:SGD;Acc:S000001247])

HSP 1 Score: 257.299 bits (656), Expect = 3.720e-76
Identity = 167/495 (33.74%), Postives = 266/495 (53.74%), Query Frame = 3
Query:   87 DMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVS----VFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGE-----TSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFW-VNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGE-----PMQQRNS-----------YPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPI 1454
            ++KA   EVKE+F F +DNY++H +P DE++P++C  +             D  G+F+++L+DSL T+ ++ +  +F +A++L+ +   P+ N ++     VFE  IRV+G LLS+HL +      +  G    G LLR+++  A +LLPA+ TSTG+P    N++    + E      +    A + + + EF  L+ LTGDP +E V   A    W+ R+ L L+       K       +GIGA +DS FEY LKG++LF   EL E+++     +    + +DW F  V  D   + +P   SL AF+ GL  +AGDL+ A+     + ++W  FG  PE ++ +  E     P+++  +           YPLRPE  ES  ++YRAT+DP  L +G+ +++ ++   K+NCG+A   +V T +L++RME+F L+ET KYLYLLFDE+N LH                             IF+TEAHP+
Sbjct:   31 ELKAYKQEVKELFYFGFDNYLEHGYPYDEVKPISCVPKKRNFEDPTDQGTNDILGNFTITLIDSLTTIAILEDRPQFLKAVRLVERTF-PDGNFDIDSTIQVFEITIRVIGSLLSSHLYATDPTKAVYLGDDYDGSLLRLAQNMADRLLPAYLTSTGLPMPRRNIKRKWDVSEFPEFLETENNVAAMASPMFEFTILSYLTGDPKYEKVTRYAFDKTWSLRTGLDLLPMSFHPEKLTPYTPMTGIGASIDSLFEYALKGAILFDDSELMEVWNVAYEALKTNCK-NDWFFANVMADTGHLFVPWIDSLSAFFSGLQVLAGDLDDAIANHLMFLKMWNTFGGIPERWNFSPPEFPPLSPLERSGAVALDNILPLEWYPLRPEFFESTYFLYRATKDPFYLNIGVHLLKDLKQRFKSNCGFAGFQNVITGELQDRMETFVLSETLKYLYLLFDEENELHNS-----------------------ASDVIFSTEAHPM 500          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Yeast
Match: MNS1 (Alpha-1,2-mannosidase; involved in ER-associated protein degradation (ERAD); catalyzes the removal of one mannose residue from a glycosylated protein, converting the modification from Man9GlcNAc to Man8GlcNAc; catalyzes the last step in glycoprotein maturation in the ER and is critical for ER protein degradation [Source:SGD;Acc:S000003892])

HSP 1 Score: 100.523 bits (249), Expect = 1.035e-22
Identity = 122/457 (26.70%), Postives = 187/457 (40.92%), Query Frame = 3
Query:  273 EFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAF-NTSTGMPFGTVNLQSGVPI---GETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKL----GLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDD-----WHFWVNMDKASVSM-PVFQSLEAFWPGLLTMAGDLEG------------------------AVRTLHNYHQVWKQ--FGFTPEFFSVAKGEPMQQ---RNSY------PL------RPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCG------YATIYDVRT--HQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPI 1454
            E +R+   +   L+ + +  V+VFET IR++GGLLSA+ LS      LE G       L  +     +L  AF +T TG+P+ ++NL SG  +    +   + TA  TT  +EF  L  LTG+  +  +  R    ++ +   L    GLV  +     GK+ A+    G+  DS++EYLLK  +L       +++ + +  + K++         W+           + P    L  F  GLL  +G  EG                        A       +Q++KQ   G  PE      G   Q    R+S       PL      RPE +ESIM++Y  + D    + G +I  S       +C       + ++ D  T   +  N MESF+LAET KYLY+LF ++                            D    +FNTEAHP 
Sbjct:  108 EIQRSEHWINDVLDFDIDAEVNVFETTIRMLGGLLSAYHLSDV----LEVG--NKTVYLNKAIDLGDRLALAFLSTQTGIPYSSINLHSGQAVKNHADGGASSTAEFTTLQMEFKYLAYLTGNRTYWELVERVYEPLYKNNDLLNTYDGLVPIYTFPDTGKFGASTIRFGSRGDSFYEYLLKQYLLTHETLYYDLYRKSMEGMKKHLLAQSKPSSLWYIGEREQGLHGQLSPKMDHLVCFMGGLLA-SGSTEGLSIHEARRRPFFSLSLERKSDWDLAKGITDTCYQMYKQSSSGLAPEIVVFNDGNIKQDGWWRSSVGDFFVKPLDRHNLQRPETVESIMFMYHLSHDHKYREWGAEIATSFFENTCVDCNDPKLRRFTSLSDCITLPTKKSNNMESFWLAETLKYLYILFLDE---------------------------FDLTKVVFNTEAHPF 530          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Nematostella
Match: EDO46917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNU8])

HSP 1 Score: 285.034 bits (728), Expect = 4.191e-89
Identity = 179/474 (37.76%), Postives = 269/474 (56.75%), Query Frame = 3
Query:  120 MFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCS-----GPLLRMSEAFARKLLPAFNTS-TGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRS-KLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDW-----------HFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH 1448
            MF F Y++Y+++AFP DEL P+ C+G+             D  G +SL+LV++L TL VMGN TEF+ A++ ++  ++ ++   V VFE NIRV+G LLSAH++ K     L+P    S       LL ++   A +L+ AFN S TG+P+  VNL SG  + + S TC AG  + +LEFG L++L GDP FE +A +A++ +W  RS   GL GN IDV   +W    SG+GAG+DS++EYLLKG +LF   E  + F++  ++++ ++R               +  VNM+ A +      SL A +  +  + GD+  A+ T   ++ +W+++   PE F+    +P      YPLRPEL ES   +Y+AT  P  L +G +++R ++T A+  CGYATI++V     E+RMESFFL+ET KYLYLLFD +N ++                        D   YIF+TE H
Sbjct:    1 MFYFGYESYMRYAFPHDELDPIHCTGRGPDRKNPTNININDVLGDYSLTLVEALGTLAVMGNSTEFKLAVQHVIDNVHFDRKSTVQVFEANIRVLGSLLSAHMIIKDP---LQPFGDMSPDDYDDELLTLAHDLANRLVDAFNKSPTGIPYPRVNLTSGEALRDRSDTCLAGAGSLLLEFGVLSRLLGDPSFENLARKAVNMLWAQRSASTGLFGNVIDVRTKEWIGKMSGLGAGLDSFYEYLLKGYILFGEVEDLKRFNDIYKQLHLHLRKGRLKCLEGSGETPVYVNVNMNTAKIENAWVDSLHASFAAVQVLKGDISEAICTHALFYHIWRKYQALPERFNWHLKQP--DVYFYPLRPELAESTYVLYQATHHPFYLHVGREMLRDLETHARAECGYATIHNVLDKSQEDRMESFFLSETCKYLYLLFDHENHVNQ-----------------------DASNYIFSTEGH 446          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Nematostella
Match: EDO36928 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH71])

HSP 1 Score: 203.371 bits (516), Expect = 5.679e-56
Identity = 122/323 (37.77%), Postives = 176/323 (54.49%), Query Frame = 3
Query:  405 GVELEPGWPCSG-PLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGV-------PIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLG-LVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKAS-VSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFS----VAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDN 1331
            G + +P  P  G P  R + +  +K  P+     G P     L  G        P G  S   T    T ++EFGAL++LTGDP+FE  A +A+ ++W  RS+   LVG  I++  G W   DSG+GAG+DSY+EY LK  +L       + F+++ + I +Y+        V M +    S     +L+AFWPGL  + GDL+ A+   H  ++V K+  F PE F+    V  GE       +PLRPEL+ES  ++Y AT DP  L++G +I+  I   A+  CG+A + DVRT   E+RM+SF LAET KYLYLLF + +
Sbjct:  225 GKKTQPSIPPQGYPSPRDTLSQGKKTQPSI-PPQGYPIPRDTLAQGKKTQPSIPPQGYPSPRDTLSQGTMIMEFGALSRLTGDPIFEEKAKKAMESLWKFRSRASDLVGTVINIHNGDWVRRDSGVGAGIDSYYEYCLKAYILLGDDTYLDRFNKHYKSIMQYINQGAMFLSVQMHQPERTSHAYMDALQAFWPGLQVLKGDLKKAIEMHHMLYEVAKKHTFLPEAFTTDFEVHWGE-------HPLRPELVESTYFLYEATLDPYYLEVGRNIVEKINEHARVPCGFAALKDVRTLSHEDRMDSFVLAETFKYLYLLFTDKS 539          

HSP 2 Score: 101.679 bits (252), Expect = 1.888e-22
Identity = 70/165 (42.42%), Postives = 106/165 (64.24%), Query Frame = 3
Query:   87 DMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLS---KRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQS 536
            + + +  +VKEMF+ AY++Y+  A+P DEL PL+C G+            D  G FSL+LVD+LDTL V+G  +EF +A+KL++K ++ + ++ VSVFETNIR+VGGLL  H+ +   K++G  L   W  +G LL +++      LPAFNT+TG+P+  V   S
Sbjct:   30 EKRKMRGQVKEMFRHAYNSYMSFAYPADELMPLSCKGRVRGVDPSRGDVDDALGMFSLTLVDTLDTLAVLGEVSEFEKAVKLVIKDVHFDTDVVVSVFETNIRIVGGLLGGHVAADSLKKSGKGL--SW-YNGELLALAKKAGECQLPAFNTTTGIPYPKVRKPS 191          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Nematostella
Match: EDO38861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBV5])

HSP 1 Score: 160.229 bits (404), Expect = 5.891e-43
Identity = 132/439 (30.07%), Postives = 217/439 (49.43%), Query Frame = 3
Query:  111 VKEMFQFAYDNYIQHAFPLDELQPLTCSGQDT----WGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVP--IGETSITCT--AGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRR--PELREMFDEYLRRINKYM----RHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGD--------LEGAVRTLHNYHQVWKQ--FGFTPEFFSV-AKGEPMQQRNS---YPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQL--ENRMESFFLAETTKYLYLLFDEDNFL 1337
            V +M + A++ Y+ +A+  +EL+P++ +G        GS   ++VD+L TL +MG   EF R  K + + LN N+  ++SVFE  IR +GGLLSA+ LS     +++            ++    KLLPAFNT TG+P+  VNL SG     G  S  C+  A   T  LEF  L+ +TG+ V+     R    +   +   GL  N+++   G W +    +GA  DS++EYLLK  ++  +   + R+M+D+ +  I + +    R  +  +        +   +   L  F  G+  +           L+      +  H+ +K+   G  PE F      E +  RN+   Y LRPE+IE   Y++R TRD        +  ++I+   + + GY+ I DV    +  ++  +SFFLAET KYLY++F +D+ L
Sbjct:    3 VLQMMKHAWNGYVTYAWGSNELRPISHTGHSASIFGRGSMGATVVDALSTLKLMGMNEEFERGRKWVAQNLNFNQASDISVFEMTIRFLGGLLSAYALSGEEVFKVK------------AKELGDKLLPAFNTPTGIPWAMVNLASGSGHNWGWASGGCSILAEFGTLHLEFVYLSHITGNQVYAKKVHRVREVVDQVQKPNGLYPNYLNPRTGVWGSQHVSLGALGDSFYEYLLKSWIMSGKMDKKARDMYDKAVEAIERMLVQRSRKSNLTYLAEYKYGRLEHKM-DHLACFTAGMFALGAKESKNEKHYLQLGAELANTCHEAYKRTATGIGPESFRFEGNAEAVAIRNNERYYILRPEVIEGWFYMWRFTRDSKYRDWAWEAAQNIEKHCRVDGGYSGIRDVTNPNVAHDDVQQSFFLAETLKYLYMIFSDDSLL 428          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Nematostella
Match: EDO30560 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0F0])

HSP 1 Score: 92.0485 bits (227), Expect = 2.684e-20
Identity = 76/231 (32.90%), Postives = 125/231 (54.11%), Query Frame = 3
Query:  111 VKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGV--PIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDS-GIGAGVDSYFEYLLK 794
            V E F+ A+  Y Q A+  DEL+P++ S  + W +  L+++DSLDT++++    EFR A   +   L+ +KN++V++FE  IRV+GGLLSA+ LS                 L  +     +LLP FN+ +G+PF  VNL +    P      +  + V+T  LEF  L+ +TG+  ++    + +  + +   K GLV   ++   G++    +  +GA  DSY+EYLLK
Sbjct:    8 VIEAFRHAWKGYKQFAWGHDELKPISKSFSE-WFNIGLTIIDSLDTMLLLNLKDEFREARDWVANSLSFDKNVDVNLFEVTIRVLGGLLSAYHLSN------------DDIFLNKAVELGDRLLPCFNSQSGIPFSDVNLMTRQVHPPRWGPDSSVSEVSTIQLEFRDLSYVTGNDKYKQAVDKVMRHLHSLPKKNGLVPIFVNANTGQFRPGATITLGARGDSYYEYLLK 225          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Nematostella
Match: EDO26074 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCY5])

HSP 1 Score: 50.8322 bits (120), Expect = 3.061e-8
Identity = 38/91 (41.76%), Postives = 62/91 (68.13%), Query Frame = 3
Query:  123 FQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLS 395
            F+ A+  Y Q A+  DEL+P++ S  + W +  L+++DSLDT++++    EFR A   +   L+ +KN++V++FE  IRV+GGLLSA+ LS
Sbjct:    1 FRHAWKGYKQFAWGHDELKPISKSFSE-WFNIGLTIIDSLDTMLLLNLKDEFREARDWVANSLSFDKNVDVNLFEVTIRVLGGLLSAYHLS 90          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Medaka
Match: edem2 (ER degradation enhancing alpha-mannosidase like protein 2 [Source:NCBI gene;Acc:101162666])

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 283/468 (60.47%), Postives = 354/468 (75.64%), Query Frame = 3
Query:   78 NQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCS 1481
             + +M  +   +K MF  AY++Y+ +AFP DEL+PLTC GQDTWGSFSL+L+D+LDTL+V+GN+TEF+R   +L   ++ + ++N SVFETNIRVVGGLLSAHLL+ RAG+ELEPGWPCSGPLLRM+   AR+L+PAF T TGMP+GTVNL  GV   ET +TCTAGV TF+LEF  L++LTGDP FE VA RAL A+W  RS +GLVGNHIDV+  KW A D+GIGAGVDSYFEYL+KG++L +  EL  MF  Y   I  Y R DDW+ WV M K +VSMP+FQSLEAFWPGL ++ G+L+ AVRT  NY+ VW+QFG  PEF+S+ +G  + +R  YPLRPELIES MY++RAT D   LQ+G+D + SI+ V++T CGYA++ D+R HQL+NRMESFFLAET KYLYLLFD  +FLH G                GG+CV+  GG+IFNTEAHP+DP ALYCCS
Sbjct:   23 TEQEMSTVRERIKSMFYHAYNSYLDNAFPYDELRPLTCDGQDTWGSFSLTLIDALDTLLVLGNHTEFQRVASILQDTVDFDIDVNASVFETNIRVVGGLLSAHLLAGRAGMELEPGWPCSGPLLRMAAEAARRLIPAFQTPTGMPYGTVNLLHGVSPTETPVTCTAGVGTFILEFATLSRLTGDPTFEDVARRALTALWKTRSDIGLVGNHIDVLSKKWVAQDAGIGAGVDSYFEYLVKGAILLQDEELLNMFHAYDAAIQNYTRFDDWYLWVQMHKGTVSMPIFQSLEAFWPGLQSLLGNLDSAVRTFQNYYSVWRQFGGLPEFYSIPQGYTVDKREGYPLRPELIESAMYLFRATGDHTYLQLGLDALESIEKVSRTPCGYASVKDLRDHQLDNRMESFFLAETIKYLYLLFDPTHFLHGGGMEGDG---SWEEGGEGGQCVLGAGGFIFNTEAHPLDPAALYCCS 487          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Medaka
Match: edem2 (ER degradation enhancing alpha-mannosidase like protein 2 [Source:NCBI gene;Acc:101162666])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 273/457 (59.74%), Postives = 338/457 (73.96%), Query Frame = 3
Query:  111 VKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCS 1481
            +K MF  AY++Y+ +AFP DEL+PLTC GQDTWG    S+   L     +GN+TEF+R   +L   ++ + ++N SVFETNIRVVGGLLSAHLL+ RAG+ELEPGWPCSGPLLRM+   AR+L+PAF T TGMP+GTVNL  GV   ET +TCTAGV TF+LEF  L++LTGDP FE VA RAL A+W  RS +GLVGNHIDV+  KW A D+GIGAGVDSYFEYL+KG++L +  EL  MF  Y   I  Y R DDW+ WV M K +VSMP+FQSLEAFWPGL ++ G+L+ AVRT  NY+ VW+QFG  PEF+S+ +G  + +R  YPLRPELIES MY++RAT D   LQ+G+D + SI+ V++T CGYA++ D+R HQL+NRMESFFLAET KYLYLLFD  +FLH G                GG+CV+  GG+IFNTEAHP+DP ALYCCS
Sbjct:   36 IKSMFYHAYNSYLDNAFPYDELRPLTCDGQDTWGRKPTSMFSPLKV---LGNHTEFQRVASILQDTVDFDIDVNASVFETNIRVVGGLLSAHLLAGRAGMELEPGWPCSGPLLRMAAEAARRLIPAFQTPTGMPYGTVNLLHGVSPTETPVTCTAGVGTFILEFATLSRLTGDPTFEDVARRALTALWKTRSDIGLVGNHIDVLSKKWVAQDAGIGAGVDSYFEYLVKGAILLQDEELLNMFHAYDAAIQNYTRFDDWYLWVQMHKGTVSMPIFQSLEAFWPGLQSLLGNLDSAVRTFQNYYSVWRQFGGLPEFYSIPQGYTVDKREGYPLRPELIESAMYLFRATGDHTYLQLGLDALESIEKVSRTPCGYASVKDLRDHQLDNRMESFFLAETIKYLYLLFDPTHFLHGGGMEGDG---SWEEGGEGGQCVLGAGGFIFNTEAHPLDPAALYCCS 486          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Medaka
Match: edem1 (ER degradation enhancing alpha-mannosidase like protein 1 [Source:NCBI gene;Acc:101158909])

HSP 1 Score: 327.405 bits (838), Expect = 3.353e-103
Identity = 200/495 (40.40%), Postives = 292/495 (58.99%), Query Frame = 3
Query:   81 QHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPC--------SGPLLRMSEAFARKLLPAF-NTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRS-KLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDD-----------WHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH--PID 1457
            +  MK +A   +EMF F YDNY+++AFP DEL P+ C G+             D  G++SL+L+D+LDTL+V+GN +EF+RA+KL+++ ++ +K+  V VFE NIR++G L+SAH+L        +P  P            LL ++   A +LLPAF +T TG+P+  VNL++GVP+   + TCTAG  + ++EFG L++L GD  FE VA RA+ A+W  RS + GL+GN I++  G+W    SG+GAG+DS++EYLLK  +LF   E  +MF      I  ++R               +  VNM+   +      SL+AF+PGL  + GD++ A+     Y+ +WK+FG  PE ++     P    + YPLRPEL+ES   +Y+AT++P  L +G+DI++S++   K  CGYAT++ V     E+RMESFFL+ET KYLYLLFDE+N LH   +GH                      YIF TE H  PID
Sbjct:  119 KSQMKEMA---REMFYFGYDNYMKYAFPEDELNPIDCKGRGPDALNPSNININDVLGNYSLTLIDTLDTLLVLGNVSEFQRAVKLVIETVSFDKDSTVQVFEANIRILGSLISAHILLT------DPKQPFGKVNFEGYENELLHLAHDLAVRLLPAFEHTDTGIPYPRVNLKTGVPLDSINETCTAGAGSLLVEFGILSRLIGDSTFEWVARRAVRALWRLRSNETGLLGNVINIQTGQWVGKQSGLGAGMDSFYEYLLKSYILFGEEEDNQMFQAAYESIQNHLRRGRDLCNEGEGDPPLYVNVNMNSGEIINTWIDSLQAFFPGLQVLNGDVDNAICLHAFYYAIWKRFGALPERYNWQLQAP--DVHFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEQTTKVRCGYATLHHVVEKSKEDRMESFFLSETCKYLYLLFDENNPLHK--SGHK---------------------YIFTTEGHIVPID 579          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Medaka
Match: si:ch211-282j22.3 (ER degradation-enhancing alpha-mannosidase-like protein 3 [Source:NCBI gene;Acc:101172257])

HSP 1 Score: 291.197 bits (744), Expect = 1.054e-87
Identity = 188/469 (40.09%), Postives = 267/469 (56.93%), Query Frame = 3
Query:  108 EVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLS---KRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGV-----PIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSK-LGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVF-QSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH 1448
            ++ EMF  AY +Y+++A+P DEL PL+C G+            D+ G FSL+L+D+LDTLVV+    EF  A++  +K +  + ++ VSVFETNIRV+GGLL  H+++   ++ G  +E  W     LL M+     +L+PAFNT++G+P+  VNL+ G+       G  S TCTA   T +LEF AL++L+G PVFE  A +AL  +W  R K   LVG  I++  G+W   DSG+GAG+DSY+EYL+K  +L       E F+ +   I KY+        V+M   +VS+  +  SL AF+PGL  + GDL+ A+ T    +QV KQ  F PE F+    E       + LRPE  ES  Y+Y+AT DP  L++G  I+  + T A+  CG+A + DVRT   E+RM+SFFLAE  KYLYLLF + + +                        ID   YIF TEAH
Sbjct:   34 QIVEMFDHAYGSYMKYAYPADELMPLSCKGRVRGQEPNRGDIDDSLGKFSLTLIDTLDTLVVLNKLDEFEDAVRKAVKDVRLDNDVVVSVFETNIRVLGGLLGGHIMADLLRQRGERME--W-YRDELLHMAIELGHRLIPAFNTTSGLPYPKVNLRHGILKPQSRTGTESDTCTACAGTMILEFAALSRLSGQPVFEEHARKALDVLWERRQKGSDLVGTVINIHNGEWVRRDSGVGAGIDSYYEYLMKAYILLGDSVFLERFNVHYSAIMKYISQPPLLLNVHMHNPTVSVRSWMDSLLAFFPGLQVLRGDLKPAIETHEMLYQVTKQHKFLPEAFTT---EFRVHWGQHLLRPEFAESTYYLYKATGDPYYLRVGQSIVEKLNTYARVPCGFAAVQDVRTGTHEDRMDSFFLAEMFKYLYLLFSDKSHVP-----------------------IDIDDYIFTTEAH 473          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Medaka
Match: si:ch211-282j22.3 (ER degradation-enhancing alpha-mannosidase-like protein 3 [Source:NCBI gene;Acc:101172257])

HSP 1 Score: 291.197 bits (744), Expect = 1.054e-87
Identity = 188/469 (40.09%), Postives = 267/469 (56.93%), Query Frame = 3
Query:  108 EVKEMFQFAYDNYIQHAFPLDELQPLTCSGQ------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLS---KRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGV-----PIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSK-LGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVF-QSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAH 1448
            ++ EMF  AY +Y+++A+P DEL PL+C G+            D+ G FSL+L+D+LDTLVV+    EF  A++  +K +  + ++ VSVFETNIRV+GGLL  H+++   ++ G  +E  W     LL M+     +L+PAFNT++G+P+  VNL+ G+       G  S TCTA   T +LEF AL++L+G PVFE  A +AL  +W  R K   LVG  I++  G+W   DSG+GAG+DSY+EYL+K  +L       E F+ +   I KY+        V+M   +VS+  +  SL AF+PGL  + GDL+ A+ T    +QV KQ  F PE F+    E       + LRPE  ES  Y+Y+AT DP  L++G  I+  + T A+  CG+A + DVRT   E+RM+SFFLAE  KYLYLLF + + +                        ID   YIF TEAH
Sbjct:   34 QIVEMFDHAYGSYMKYAYPADELMPLSCKGRVRGQEPNRGDIDDSLGKFSLTLIDTLDTLVVLNKLDEFEDAVRKAVKDVRLDNDVVVSVFETNIRVLGGLLGGHIMADLLRQRGERME--W-YRDELLHMAIELGHRLIPAFNTTSGLPYPKVNLRHGILKPQSRTGTESDTCTACAGTMILEFAALSRLSGQPVFEEHARKALDVLWERRQKGSDLVGTVINIHNGEWVRRDSGVGAGIDSYYEYLMKAYILLGDSVFLERFNVHYSAIMKYISQPPLLLNVHMHNPTVSVRSWMDSLLAFFPGLQVLRGDLKPAIETHEMLYQVTKQHKFLPEAFTT---EFRVHWGQHLLRPEFAESTYYLYKATGDPYYLRVGQSIVEKLNTYARVPCGFAAVQDVRTGTHEDRMDSFFLAEMFKYLYLLFSDKSHVP-----------------------IDIDDYIFTTEAH 473          
BLAST of alpha-1,2-Mannosidase vs. Planmine SMEST
Match: SMESG000026491.1 (SMESG000026491.1)

HSP 1 Score: 1152.5 bits (2980), Expect = 0.000e+0
Identity = 565/569 (99.30%), Postives = 568/569 (99.82%), Query Frame = 3
Query:   90 MKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQMSLDRNVADGVGLPEMAAPPNMPLSAAPSDGLSTFTVADRYSTLLSCPNSKFHFKFMIYGEMIDLDENEIN 1796
            MKALA+EVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGSFSLSLVDSLDTLVVMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYL+RINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVI GGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQMSLDRNVADGVGLPEMAAPPN+PLSAAPSDGLSTFTVADRYSTLLSCPNSKFHFKFMIYGEMIDLDENEIN
Sbjct:    1 MKALALEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGSFSLSLVDSLDTLVVMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLQRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIGGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQMSLDRNVADGVGLPEMAAPPNLPLSAAPSDGLSTFTVADRYSTLLSCPNSKFHFKFMIYGEMIDLDENEIN 569          
BLAST of alpha-1,2-Mannosidase vs. Planmine SMEST
Match: SMESG000026491.1 (SMESG000026491.1)

HSP 1 Score: 1152.12 bits (2979), Expect = 0.000e+0
Identity = 591/595 (99.33%), Postives = 594/595 (99.83%), Query Frame = 3
Query:   12 MSRXXXXXXXXXXXXXSVSGKNNQHDMKALAVEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQMSLDRNVADGVGLPEMAAPPNMPLSAAPSDGLSTFTVADRYSTLLSCPNSKFHFKFMIYGEMIDLDENEIN 1796
            MSRLFFYLLLKFFLIFSVSGKNNQHDMKALA+EVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGSFSLSLVDSLDTLVVMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYL+RINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVI GGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQMSLDRNVADGVGLPEMAAPPN+PLSAAPSDGLSTFTVADRYSTLLSCPNSKFHFKFMIYGEMIDLDENEIN
Sbjct:    1 MSRLFFYLLLKFFLIFSVSGKNNQHDMKALALEVKEMFQFAYDNYIQHAFPLDELQPLTCSGQDTWGSFSLSLVDSLDTLVVMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSEAFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLQRINKYMRHDDWHFWVNMDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHSRPDYQVVAMVSGGECVIGGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQLDQMHRHYPLLRLLNITDYEIALAQMSLDRNVADGVGLPEMAAPPNLPLSAAPSDGLSTFTVADRYSTLLSCPNSKFHFKFMIYGEMIDLDENEIN 595          
BLAST of alpha-1,2-Mannosidase vs. Planmine SMEST
Match: SMESG000061196.1 (SMESG000061196.1)

HSP 1 Score: 311.997 bits (798), Expect = 1.619e-98
Identity = 187/444 (42.12%), Postives = 268/444 (60.36%), Query Frame = 3
Query:  111 VKEMFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLL----SKRAGVELEP-GWPCSGPLLRMSEAFARKLLPAF-NTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKL-GLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWH---------FWVN--MDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGT 1349
            VK MF F Y+NY+  A P DEL P+ C G+             D  G + L+LVD+LDTLV++ +  EF+RA+K+++  L+ N+N  V VFE  IR++G LLSAHLL    +K  G +L+P G+  +  LL ++   A +LL AF  T+TG+P   VNL +G+P+   + TC AG TT +LEFG L++L  DPVFE VA R ++ +W  +S + GL GN I++  GKW +  SG+GAG DS++EYLLK  V+F   +  ++F+E +  +  YMR              F+VN  M    +      SL+A  PG+LT+ GDL+ A+     Y+ +WK+F   PE F+     P    N YPLRPE  ES  ++Y AT++P  L +G +I+ ++    K  CGYAT++DV    LE+RMESFFL+ET KYLYLLFDE+N ++   
Sbjct:   30 VKSMFYFGYENYMNFAHPFDELDPIHCKGRGHDYDNRDNININDALGDYQLTLVDTLDTLVIINDIPEFKRAVKIIIDSLHFNQNTTVQVFEATIRIIGSLLSAHLLIIDETKLFG-DLKPTGY--TNELLMLARDLASRLLSAFEQTNTGIPHPRVNLLTGIPLNSVNETCLAGATTLLLEFGVLSRLIQDPVFENVADRTINTLWRLKSNVTGLPGNVINIHTGKWISEMSGLGAGQDSFYEYLLKSYVVFGNLKYNKLFNEAMGSVRYYMRKGRQKCSGNNGLPPFFVNVQMKNGDIDNHWIDSLQAALPGILTLNGDLDEAICVHAYYYAIWKKFRVLPERFNWYHKRP--DVNFYPLRPEFAESTYFLYMATKNPFYLHVGEEIVSNLNIYTKVKCGYATVHDVLNMSLEDRMESFFLSETCKYLYLLFDENNMINKNV 468          
BLAST of alpha-1,2-Mannosidase vs. Planmine SMEST
Match: SMESG000061196.1 (SMESG000061196.1)

HSP 1 Score: 312.383 bits (799), Expect = 2.327e-98
Identity = 187/444 (42.12%), Postives = 268/444 (60.36%), Query Frame = 3
Query:  111 VKEMFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLL----SKRAGVELEP-GWPCSGPLLRMSEAFARKLLPAF-NTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKL-GLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWH---------FWVN--MDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGT 1349
            VK MF F Y+NY+  A P DEL P+ C G+             D  G + L+LVD+LDTLV++ +  EF+RA+K+++  L+ N+N  V VFE  IR++G LLSAHLL    +K  G +L+P G+  +  LL ++   A +LL AF  T+TG+P   VNL +G+P+   + TC AG TT +LEFG L++L  DPVFE VA R ++ +W  +S + GL GN I++  GKW +  SG+GAG DS++EYLLK  V+F   +  ++F+E +  +  YMR              F+VN  M    +      SL+A  PG+LT+ GDL+ A+     Y+ +WK+F   PE F+     P    N YPLRPE  ES  ++Y AT++P  L +G +I+ ++    K  CGYAT++DV    LE+RMESFFL+ET KYLYLLFDE+N ++   
Sbjct:   51 VKSMFYFGYENYMNFAHPFDELDPIHCKGRGHDYDNRDNININDALGDYQLTLVDTLDTLVIINDIPEFKRAVKIIIDSLHFNQNTTVQVFEATIRIIGSLLSAHLLIIDETKLFG-DLKPTGY--TNELLMLARDLASRLLSAFEQTNTGIPHPRVNLLTGIPLNSVNETCLAGATTLLLEFGVLSRLIQDPVFENVADRTINTLWRLKSNVTGLPGNVINIHTGKWISEMSGLGAGQDSFYEYLLKSYVVFGNLKYNKLFNEAMGSVRYYMRKGRQKCSGNNGLPPFFVNVQMKNGDIDNHWIDSLQAALPGILTLNGDLDEAICVHAYYYAIWKKFRVLPERFNWYHKRP--DVNFYPLRPEFAESTYFLYMATKNPFYLHVGEEIVSNLNIYTKVKCGYATVHDVLNMSLEDRMESFFLSETCKYLYLLFDENNMINKNV 489          
BLAST of alpha-1,2-Mannosidase vs. Planmine SMEST
Match: SMESG000061196.1 (SMESG000061196.1)

HSP 1 Score: 310.842 bits (795), Expect = 4.871e-98
Identity = 188/450 (41.78%), Postives = 268/450 (59.56%), Query Frame = 3
Query:  111 VKEMFQFAYDNYIQHAFPLDELQPLTCSGQ-------------DTWGXXXXXXXXXXXXXXXMGNYTEFRRALKLLMKQLNPNKNINVSVFETNIRVVGGLLSAHLL----SKRAGVELEP-GWPCSGPLLRMSEAFARKLLPAFNTS-------TGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGALTQLTGDPVFEGVALRALHAMWNHRSKL-GLVGNHIDVMKGKWTATDSGIGAGVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWH---------FWVN--MDKASVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSVAKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAKTNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGT 1349
            VK MF F Y+NY+  A P DEL P+ C G+             D  G + L+LVD+LDTLV++ +  EF+RA+K+++  L+ N+N  V VFE  IR++G LLSAHLL    +K  G +L+P G+  +  LL ++   A +LL AF TS       TG+P   VNL +G+P+   + TC AG TT +LEFG L++L  DPVFE VA R ++ +W  +S + GL GN I++  GKW +  SG+GAG DS++EYLLK  V+F   +  ++F+E +  +  YMR              F+VN  M    +      SL+A  PG+LT+ GDL+ A+     Y+ +WK+F   PE F+     P    N YPLRPE  ES  ++Y AT++P  L +G +I+ ++    K  CGYAT++DV    LE+RMESFFL+ET KYLYLLFDE+N ++   
Sbjct:   30 VKSMFYFGYENYMNFAHPFDELDPIHCKGRGHDYDNRDNININDALGDYQLTLVDTLDTLVIINDIPEFKRAVKIIIDSLHFNQNTTVQVFEATIRIIGSLLSAHLLIIDETKLFG-DLKPTGY--TNELLMLARDLASRLLSAFETSPSCYQTNTGIPHPRVNLLTGIPLNSVNETCLAGATTLLLEFGVLSRLIQDPVFENVADRTINTLWRLKSNVTGLPGNVINIHTGKWISEMSGLGAGQDSFYEYLLKSYVVFGNLKYNKLFNEAMGSVRYYMRKGRQKCSGNNGLPPFFVNVQMKNGDIDNHWIDSLQAALPGILTLNGDLDEAICVHAYYYAIWKKFRVLPERFNWYHKRP--DVNFYPLRPEFAESTYFLYMATKNPFYLHVGEEIVSNLNIYTKVKCGYATVHDVLNMSLEDRMESFFLSETCKYLYLLFDENNMINKNV 474          
The following BLAST results are available for this feature:
BLAST of alpha-1,2-Mannosidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EDEM20.000e+053.89ER degradation enhancing alpha-mannosidase like pr... [more]
EDEM20.000e+052.58ER degradation enhancing alpha-mannosidase like pr... [more]
EDEM17.399e-9943.33ER degradation enhancing alpha-mannosidase like pr... [more]
EDEM11.225e-8642.01ER degradation enhancing alpha-mannosidase like pr... [more]
EDEM34.222e-8138.62ER degradation enhancing alpha-mannosidase like pr... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F10C2.50.000e+058.55alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Ac... [more]
C47E12.33.067e-10241.08alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Ac... [more]
C47E12.39.228e-10141.08alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Ac... [more]
ZC506.14.208e-8640.56alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Ac... [more]
ZC506.14.208e-8640.56alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Edem10.000e+057.96gene:FBgn0023511 transcript:FBtr0070354[more]
Edem10.000e+057.96gene:FBgn0023511 transcript:FBtr0305583[more]
Edem10.000e+057.96gene:FBgn0023511 transcript:FBtr0070353[more]
Edem10.000e+057.96gene:FBgn0023511 transcript:FBtr0070352[more]
Edem10.000e+057.96gene:FBgn0023511 transcript:FBtr0332580[more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
edem20.000e+052.01ER degradation enhancer, mannosidase alpha-like 2 ... [more]
edem20.000e+052.01ER degradation enhancer, mannosidase alpha-like 2 ... [more]
edem11.284e-10040.85ER degradation enhancer, mannosidase alpha-like 1 ... [more]
si:ch211-282j22.32.459e-8940.00si:ch211-282j22.3 [Source:ZFIN;Acc:ZDB-GENE-091113... [more]
edem36.573e-8440.54ER degradation enhancer, mannosidase alpha-like 3 ... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp6v1a0.000e+060.68ATPase H+ transporting V1 subunit A [Source:Xenbas... [more]
atp6v1a0.000e+061.93ATPase H+ transporting V1 subunit A [Source:Xenbas... [more]
edem18.274e-10441.87ER degradation enhancing alpha-mannosidase like pr... [more]
edem19.362e-10441.87ER degradation enhancing alpha-mannosidase like pr... [more]
edem11.465e-10341.87ER degradation enhancing alpha-mannosidase like pr... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Edem20.000e+053.85ER degradation enhancer, mannosidase alpha-like 2 ... [more]
Edem18.544e-9942.92ER degradation enhancer, mannosidase alpha-like 1 ... [more]
Edem34.071e-8138.62ER degradation enhancer, mannosidase alpha-like 3 ... [more]
Edem34.903e-8138.62ER degradation enhancer, mannosidase alpha-like 3 ... [more]
Edem35.182e-8138.62ER degradation enhancer, mannosidase alpha-like 3 ... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BV94|EDEM2_HUMAN0.000e+053.89ER degradation-enhancing alpha-mannosidase-like pr... [more]
sp|Q8BJT9|EDEM2_MOUSE0.000e+053.85ER degradation-enhancing alpha-mannosidase-like pr... [more]
sp|Q9FG93|MNS4_ARATH1.005e-12947.73Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana O... [more]
sp|Q9SXC9|MNS5_ARATH2.883e-10440.38Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana O... [more]
sp|Q92611|EDEM1_HUMAN3.553e-9843.33ER degradation-enhancing alpha-mannosidase-like pr... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H7T50.000e+063.04alpha-1,2-Mannosidase OS=Lingula unguis OX=7574 GN... [more]
A0A1B6FVI30.000e+063.62alpha-1,2-Mannosidase (Fragment) OS=Cuerna arida O... [more]
A0A2P8XI180.000e+062.71alpha-1,2-Mannosidase OS=Blattella germanica OX=69... [more]
A0A1B6GCW20.000e+063.62alpha-1,2-Mannosidase (Fragment) OS=Cuerna arida O... [more]
A0A1Y1K2H40.000e+061.33alpha-1,2-Mannosidase OS=Photinus pyralis OX=7054 ... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
edem20.000e+051.98ER degradation enhancer, mannosidase alpha-like 2 ... [more]
edem31.581e-8939.50ER degradation enhancing alpha-mannosidase like pr... [more]
edem32.294e-8939.50ER degradation enhancing alpha-mannosidase like pr... [more]
edem12.208e-8738.87ER degradation enhancer, mannosidase alpha-like 1 ... [more]
si:ch211-282j22.33.989e-8740.51ER degradation-enhancing alpha-mannosidase-like pr... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006166.10.000e+063.66pep scaffold:Pmarinus_7.0:GL476535:951795:959705:-... [more]
edem13.032e-7336.36ER degradation enhancer, mannosidase alpha-like 1 ... [more]
edem33.083e-5837.96ER degradation enhancer, mannosidase alpha-like 3 ... [more]
edem33.092e-5837.96ER degradation enhancer, mannosidase alpha-like 3 ... [more]
man1b1a4.615e-4231.11mannosidase, alpha, class 1B, member 1a [Source:ZF... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
MNL13.720e-7633.74Alpha-1,2-specific exomannosidase of the endoplasm... [more]
MNS11.035e-2226.70Alpha-1,2-mannosidase; involved in ER-associated p... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO469174.191e-8937.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369285.679e-5637.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388615.891e-4330.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305602.684e-2032.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260743.061e-841.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
edem20.000e+060.47ER degradation enhancing alpha-mannosidase like pr... [more]
edem20.000e+059.74ER degradation enhancing alpha-mannosidase like pr... [more]
edem13.353e-10340.40ER degradation enhancing alpha-mannosidase like pr... [more]
si:ch211-282j22.31.054e-8740.09ER degradation-enhancing alpha-mannosidase-like pr... [more]
si:ch211-282j22.31.054e-8740.09ER degradation-enhancing alpha-mannosidase-like pr... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026491.10.000e+099.30SMESG000026491.1[more]
SMESG000026491.10.000e+099.33SMESG000026491.1[more]
SMESG000061196.11.619e-9842.12SMESG000061196.1[more]
SMESG000061196.12.327e-9842.12SMESG000061196.1[more]
SMESG000061196.14.871e-9841.78SMESG000061196.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003288 ID=SMED30003288|Name=alpha-1,2-Mannosidase|organism=Schmidtea mediterranea sexual|type=transcript|length=1877bp
AAATTATTTGAATGTCTCGTCTATTTTTTTATTTATTGTTAAAATTCTTT
TTAATATTTTCTGTTTCTGGCAAGAATAATCAGCATGATATGAAAGCTTT
GGCTGTTGAAGTCAAAGAAATGTTTCAATTTGCTTATGATAATTATATTC
AACATGCATTTCCATTAGATGAATTGCAACCATTGACATGCAGCGGGCAG
GATACTTGGGGAAGTTTTTCATTATCGCTAGTCGATTCTTTAGATACTTT
GGTTGTAATGGGCAATTATACCGAGTTCAGACGAGCTTTAAAATTGTTAA
TGAAACAATTAAATCCAAATAAAAATATTAACGTTTCGGTTTTTGAAACT
AATATAAGAGTGGTTGGCGGACTGCTGAGTGCCCATTTGCTATCAAAACG
TGCTGGGGTAGAACTGGAACCCGGCTGGCCTTGCAGTGGCCCATTGCTGC
GGATGAGCGAAGCATTTGCAAGGAAATTGCTGCCGGCATTCAATACGAGT
ACTGGCATGCCGTTTGGCACTGTCAATTTGCAGTCCGGCGTTCCGATTGG
TGAGACATCGATCACTTGCACTGCTGGCGTGACGACATTCGTCCTGGAAT
TCGGCGCGCTGACCCAGTTGACAGGTGATCCGGTATTCGAGGGGGTTGCG
CTCAGGGCGCTCCATGCGATGTGGAACCACCGGTCGAAACTCGGGCTCGT
TGGCAACCACATCGACGTGATGAAGGGCAAATGGACCGCGACCGACAGCG
GCATCGGCGCAGGCGTCGACTCCTATTTCGAGTACTTGCTCAAGGGCTCC
GTGTTGTTCCGCCGGCCGGAATTGCGGGAAATGTTTGACGAGTACCTGCG
GCGCATCAACAAGTACATGAGGCATGACGACTGGCATTTCTGGGTCAACA
TGGACAAGGCGTCCGTTTCTATGCCTGTTTTCCAGAGTTTGGAGGCGTTC
TGGCCCGGTTTGTTGACAATGGCCGGCGATCTCGAGGGCGCCGTTCGGAC
ATTGCACAATTATCACCAGGTTTGGAAACAGTTCGGATTTACTCCGGAAT
TTTTCAGTGTTGCTAAAGGTGAACCAATGCAGCAAAGAAATTCTTATCCG
CTACGCCCAGAACTGATCGAGTCCATCATGTATGTGTACAGAGCCACAAG
AGATCCAGCTGTACTACAGATGGGTATCGATATTATGCGATCAATTCAAA
CTGTTGCCAAGACAAATTGCGGATACGCAACGATTTATGACGTGCGGACT
CACCAACTGGAGAACAGAATGGAATCATTTTTCCTAGCGGAAACGACTAA
ATATTTATATTTATTGTTTGATGAGGATAATTTTCTTCATGCCGGAACAA
CGGGACATTCTCGGCCGGATTATCAAGTGGTTGCTATGGTATCCGGTGGT
GAGTGCGTCATAGATGGCGGAGGCTACATATTCAATACCGAGGCACATCC
AATCGATCCGGGTGCATTGTACTGCTGTTCCGATAAGTATCACAAGGACC
TGATACAGCTGGACCAGATGCACCGGCATTATCCCCTGTTGCGGTTGCTC
AATATCACCGACTATGAGATCGCTCTTGCTCAGATGTCACTGGATAGAAA
TGTGGCTGATGGAGTCGGGCTGCCTGAAATGGCTGCTCCCCCAAATATGC
CGTTATCGGCTGCACCTTCTGATGGATTATCGACGTTCACTGTGGCAGAT
CGATATTCCACACTTCTGTCTTGTCCCAACTCGAAATTCCATTTCAAATT
CATGATTTACGGAGAGATGATCGATCTGGACGAAAATGAGATCAATTAAA
ATCAGGATAATCGAGATTTATCACTCATTCCAATCAATTTATTGATGATT
TTTGTTTTTCATTAATATATGCCCTGC
back to top

protein sequence of SMED30003288-orf-1

>SMED30003288-orf-1 ID=SMED30003288-orf-1|Name=SMED30003288-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=596bp
MSRLFFYLLLKFFLIFSVSGKNNQHDMKALAVEVKEMFQFAYDNYIQHAF
PLDELQPLTCSGQDTWGSFSLSLVDSLDTLVVMGNYTEFRRALKLLMKQL
NPNKNINVSVFETNIRVVGGLLSAHLLSKRAGVELEPGWPCSGPLLRMSE
AFARKLLPAFNTSTGMPFGTVNLQSGVPIGETSITCTAGVTTFVLEFGAL
TQLTGDPVFEGVALRALHAMWNHRSKLGLVGNHIDVMKGKWTATDSGIGA
GVDSYFEYLLKGSVLFRRPELREMFDEYLRRINKYMRHDDWHFWVNMDKA
SVSMPVFQSLEAFWPGLLTMAGDLEGAVRTLHNYHQVWKQFGFTPEFFSV
AKGEPMQQRNSYPLRPELIESIMYVYRATRDPAVLQMGIDIMRSIQTVAK
TNCGYATIYDVRTHQLENRMESFFLAETTKYLYLLFDEDNFLHAGTTGHS
RPDYQVVAMVSGGECVIDGGGYIFNTEAHPIDPGALYCCSDKYHKDLIQL
DQMHRHYPLLRLLNITDYEIALAQMSLDRNVADGVGLPEMAAPPNMPLSA
APSDGLSTFTVADRYSTLLSCPNSKFHFKFMIYGEMIDLDENEIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0004571mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
GO:0005509calcium ion binding
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR0123416hp_glycosidase-like_sf
IPR036026Seven-hairpin_glycosidases
IPR001382Glyco_hydro_47
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001382Glycoside hydrolase family 47PRINTSPR00747GLYHDRLASE47coord: 363..387
score: 44.38
coord: 306..322
score: 32.77
coord: 422..442
score: 68.93
coord: 249..266
score: 54.23
coord: 70..84
score: 53.97
coord: 107..125
score: 69.42
coord: 37..57
score: 46.49
coord: 158..177
score: 48.57
IPR001382Glycoside hydrolase family 47PFAMPF01532Glyco_hydro_47coord: 37..481
e-value: 4.8E-113
score: 378.5
IPR012341Six-hairpin glycosidase-like superfamilyGENE3DG3DSA:1.50.10.10coord: 19..449
e-value: 1.5E-145
score: 487.3
NoneNo IPR availablePANTHERPTHR45679:SF6ER DEGRADATION-ENHANCING ALPHA-MANNOSIDASE-LIKE PROTEIN 2coord: 21..507
NoneNo IPR availablePANTHERPTHR45679FAMILY NOT NAMEDcoord: 21..507
NoneNo IPR availableCDDcd06253M14_ASTE_ASPA-likecoord: 144..220
e-value: 0.00113899
score: 38.3494
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.873
IPR036026Seven-hairpin glycosidasesSUPERFAMILYSSF48225Seven-hairpin glycosidasescoord: 27..481