Protein atonal like protein 8

Overview
NameProtein atonal like protein 8
Smed IDSMED30003276
Length (bp)1187
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein atonal like protein 8 (SMED30003276) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein atonal like protein 8 (SMED30003276) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein atonal like protein 8 (SMED30003276) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein atonal like protein 8 (SMED30003276) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003276

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior pole progenitor cellSMED30003276h1SMcG0001060 SMED30003276smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30003276h1SMcG0001060 dd_Smed_v4_9899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30003276h1SMcG0001060 dd_Smed_v4_9899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003276h1SMcG0001060 dd_Smed_v4_9899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003276h1SMcG0001060 dd_Smed_v4_9899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003276h1SMcG0001060 Contig39228uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003276h1SMcG0001060 Contig39228newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein atonal like protein 8 vs. Ensembl Human
Match: ATOH8 (atonal bHLH transcription factor 8 [Source:HGNC Symbol;Acc:HGNC:24126])

HSP 1 Score: 71.633 bits (174), Expect = 2.725e-13
Identity = 39/75 (52.00%), Postives = 48/75 (64.00%), Query Frame = 1
Query:  904 HTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            HTISAAFE LR  VP YS   KLSKL ILRIAC YI SL +L       D   N +FS+C+Q+  +T+ +E + K
Sbjct:  244 HTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLARLADLDYSAD-HSNLSFSECVQRCTRTLQAEGRAK 317          
BLAST of Protein atonal like protein 8 vs. Ensembl Fly
Match: net (gene:FBgn0002931 transcript:FBtr0290323)

HSP 1 Score: 77.411 bits (189), Expect = 2.373e-15
Identity = 51/99 (51.52%), Postives = 75/99 (75.76%), Query Frame = 1
Query:  832 NKKNYKSLTXXXXXXXXXXXXXXXHTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            +++NYK++TRERR+EANARER+RVHTISAA+ETLR AVP Y+++ KLSKL +LR+AC YI +L+++       D Q   + + C++ +  TI +E K+K
Sbjct:  258 HQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRMAGEDYSAD-QSVPSIATCLEAVTSTIQTEGKVK 355          
BLAST of Protein atonal like protein 8 vs. Ensembl Fly
Match: net (gene:FBgn0002931 transcript:FBtr0330637)

HSP 1 Score: 77.411 bits (189), Expect = 2.373e-15
Identity = 51/99 (51.52%), Postives = 75/99 (75.76%), Query Frame = 1
Query:  832 NKKNYKSLTXXXXXXXXXXXXXXXHTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            +++NYK++TRERR+EANARER+RVHTISAA+ETLR AVP Y+++ KLSKL +LR+AC YI +L+++       D Q   + + C++ +  TI +E K+K
Sbjct:  258 HQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRMAGEDYSAD-QSVPSIATCLEAVTSTIQTEGKVK 355          
BLAST of Protein atonal like protein 8 vs. Ensembl Zebrafish
Match: atoh8 (atonal bHLH transcription factor 8 [Source:NCBI gene;Acc:561606])

HSP 1 Score: 69.3218 bits (168), Expect = 6.027e-13
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 1
Query:  904 HTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            HTISAAFE LR  VP YS   KLSKL ILRIAC YI SL QL    D      N +F +C+++  +T+ +E + K
Sbjct:  189 HTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLAQLADL-DYTPDHRNMSFRECVEQCTRTLQAEGRSK 262          
BLAST of Protein atonal like protein 8 vs. Ensembl Zebrafish
Match: atoh8 (atonal bHLH transcription factor 8 [Source:NCBI gene;Acc:561606])

HSP 1 Score: 69.3218 bits (168), Expect = 6.451e-13
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 1
Query:  904 HTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            HTISAAFE LR  VP YS   KLSKL ILRIAC YI SL QL    D      N +F +C+++  +T+ +E + K
Sbjct:  189 HTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLAQLADL-DYTPDHRNMSFRECVEQCTRTLQAEGRSK 262          
BLAST of Protein atonal like protein 8 vs. Ensembl Xenopus
Match: ATOH8 (atonal bHLH transcription factor 8 [Source:NCBI gene;Acc:100490889])

HSP 1 Score: 69.707 bits (169), Expect = 5.159e-13
Identity = 39/75 (52.00%), Postives = 48/75 (64.00%), Query Frame = 1
Query:  904 HTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            HTISAAFE LR  VP YS   KLSKL ILRIAC YI SL +L      VD   N +F +C+++  +T+ SE + K
Sbjct:  169 HTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLARLADLDYSVD-HSNLSFPECVEQCTRTLQSEGRSK 242          
BLAST of Protein atonal like protein 8 vs. Ensembl Mouse
Match: Atoh8 (atonal bHLH transcription factor 8 [Source:MGI Symbol;Acc:MGI:1918343])

HSP 1 Score: 71.633 bits (174), Expect = 2.032e-13
Identity = 39/75 (52.00%), Postives = 48/75 (64.00%), Query Frame = 1
Query:  904 HTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            HTISAAFE LR  VP YS   KLSKL ILRIAC YI SL +L       D   N +FS+C+Q+  +T+ +E + K
Sbjct:  245 HTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLARLADLDYSAD-HSNLSFSECVQRCTRTLQAEGRAK 318          
BLAST of Protein atonal like protein 8 vs. UniProt/SwissProt
Match: sp|Q96SQ7|ATOH8_HUMAN (Protein atonal homolog 8 OS=Homo sapiens OX=9606 GN=ATOH8 PE=2 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 1.309e-12
Identity = 39/75 (52.00%), Postives = 48/75 (64.00%), Query Frame = 1
Query:  904 HTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            HTISAAFE LR  VP YS   KLSKL ILRIAC YI SL +L       D   N +FS+C+Q+  +T+ +E + K
Sbjct:  244 HTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLARLADLDYSAD-HSNLSFSECVQRCTRTLQAEGRAK 317          
BLAST of Protein atonal like protein 8 vs. UniProt/SwissProt
Match: sp|Q99NA2|ATOH8_MOUSE (Protein atonal homolog 8 OS=Mus musculus OX=10090 GN=Atoh8 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.421e-12
Identity = 39/75 (52.00%), Postives = 48/75 (64.00%), Query Frame = 1
Query:  904 HTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            HTISAAFE LR  VP YS   KLSKL ILRIAC YI SL +L       D   N +FS+C+Q+  +T+ +E + K
Sbjct:  245 HTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLARLADLDYSAD-HSNLSFSECVQRCTRTLQAEGRAK 318          
BLAST of Protein atonal like protein 8 vs. UniProt/SwissProt
Match: sp|D2CLZ9|ATOH8_DANRE (Protein atonal homolog 8 OS=Danio rerio OX=7955 GN=atoh8 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 4.870e-12
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 1
Query:  904 HTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            HTISAAFE LR  VP YS   KLSKL ILRIAC YI SL QL    D      N +F +C+++  +T+ +E + K
Sbjct:  189 HTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLAQLADL-DYTPDHRNMSFRECVEQCTRTLQAEGRSK 262          
BLAST of Protein atonal like protein 8 vs. TrEMBL
Match: A0A3B0K6T5 (Blast:Protein atonal homolog 8 OS=Drosophila guanche OX=7266 GN=DGUA_6G012015 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.983e-15
Identity = 58/108 (53.70%), Postives = 81/108 (75.00%), Query Frame = 1
Query:  805 DKSSLNMCSNKKNYKSLTXXXXXXXXXXXXXXXHTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            D SSL   S+++NYK++TRERR+EANARER+RVHTISAA+ETLRHAVP Y+++ KLSKL +LR+AC YI +L+++       D Q   + + CI+ +  TI +E K+K
Sbjct:  251 DISSLRPHSHQRNYKNMTRERRIEANARERTRVHTISAAYETLRHAVPAYASTQKLSKLSVLRVACSYILTLSRMAGEDYSAD-QSEPSIADCIEAVTSTIQTEGKVK 357          
BLAST of Protein atonal like protein 8 vs. TrEMBL
Match: A0A0L7LQM0 (Atonal-like protein 8 OS=Operophtera brumata OX=104452 GN=OBRU01_03230 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 2.040e-15
Identity = 55/98 (56.12%), Postives = 76/98 (77.55%), Query Frame = 1
Query:  835 KKNYKSLTXXXXXXXXXXXXXXXHTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            ++NYK++TRERR+EANARER+RVHTISAAF+TLRH+VP YS++ KLSKL +LRIAC YI +L+  L      DP  +++ S  ++ + QTI +E KL+
Sbjct:   59 QRNYKNMTRERRIEANARERTRVHTISAAFDTLRHSVPAYSHNQKLSKLSVLRIACAYITALSTAL------DP--DADLSTAVEAVTQTIHTEGKLR 148          
BLAST of Protein atonal like protein 8 vs. TrEMBL
Match: A0A0M8ZN81 (Protein atonal like protein 8 OS=Melipona quadrifasciata OX=166423 GN=WN51_08044 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.546e-15
Identity = 53/100 (53.00%), Postives = 78/100 (78.00%), Query Frame = 1
Query:  829 SNKKNYKSLTXXXXXXXXXXXXXXXHTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
              ++NYK++TRERR+EANARER+RVHTISAAF+TLR A+P YS++ KLSKL +LRIAC YI +L +++  +DK +P   ++   C+  +++TI +E KL+
Sbjct:  552 GQQRNYKNMTRERRIEANARERTRVHTISAAFDTLRRAIPAYSHNQKLSKLSVLRIACSYIMTLGKIVDITDKGEPINGASLGACVDLVSKTIQTEGKLR 651          
BLAST of Protein atonal like protein 8 vs. TrEMBL
Match: Q29NQ8 (BHLH domain-containing protein OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=Dpse\GA11011 PE=4 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 3.566e-15
Identity = 57/108 (52.78%), Postives = 81/108 (75.00%), Query Frame = 1
Query:  805 DKSSLNMCSNKKNYKSLTXXXXXXXXXXXXXXXHTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            D S+L   S+++NYK++TRERR+EANARER+RVHTISAA+ETLRHAVP Y+++ KLSKL +LR+AC YI +L+++       D Q   + + CI+ +  TI +E K+K
Sbjct:  253 DTSTLRPHSHQRNYKNMTRERRIEANARERTRVHTISAAYETLRHAVPAYASTQKLSKLSVLRVACSYILTLSRMAGQDYSAD-QSEPSIADCIEAVTSTIQTEGKVK 359          
BLAST of Protein atonal like protein 8 vs. TrEMBL
Match: B4GQS8 (GL13900 OS=Drosophila persimilis OX=7234 GN=Dper\GL13900 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.566e-15
Identity = 57/108 (52.78%), Postives = 81/108 (75.00%), Query Frame = 1
Query:  805 DKSSLNMCSNKKNYKSLTXXXXXXXXXXXXXXXHTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            D S+L   S+++NYK++TRERR+EANARER+RVHTISAA+ETLRHAVP Y+++ KLSKL +LR+AC YI +L+++       D Q   + + CI+ +  TI +E K+K
Sbjct:  253 DTSTLRPHSHQRNYKNMTRERRIEANARERTRVHTISAAYETLRHAVPAYASTQKLSKLSVLRVACSYILTLSRMAGQDYSAD-QSEPSIADCIEAVTSTIQTEGKVK 359          
BLAST of Protein atonal like protein 8 vs. Ensembl Cavefish
Match: ENSAMXT00000042212.1 (atonal bHLH transcription factor 8 [Source:NCBI gene;Acc:103039142])

HSP 1 Score: 68.9366 bits (167), Expect = 6.547e-13
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 1
Query:  904 HTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            HTISAAFE LR  VP YS   KLSKL ILRIAC YI SL QL    D      N +F +C+++  +T+ +E + K
Sbjct:  186 HTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLAQLADL-DYTPDHSNMSFRECVEQCTRTLQAEGRSK 259          
BLAST of Protein atonal like protein 8 vs. Ensembl Cavefish
Match: ENSAMXT00000052339.1 (atonal bHLH transcription factor 8 [Source:NCBI gene;Acc:103039142])

HSP 1 Score: 68.9366 bits (167), Expect = 6.547e-13
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 1
Query:  904 HTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            HTISAAFE LR  VP YS   KLSKL ILRIAC YI SL QL    D      N +F +C+++  +T+ +E + K
Sbjct:  186 HTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLAQLADL-DYTPDHSNMSFRECVEQCTRTLQAEGRSK 259          
BLAST of Protein atonal like protein 8 vs. Ensembl Cavefish
Match: ENSAMXT00000053423.1 (atonal bHLH transcription factor 8 [Source:NCBI gene;Acc:103039142])

HSP 1 Score: 68.9366 bits (167), Expect = 6.547e-13
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 1
Query:  904 HTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            HTISAAFE LR  VP YS   KLSKL ILRIAC YI SL QL    D      N +F +C+++  +T+ +E + K
Sbjct:  186 HTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLAQLADL-DYTPDHSNMSFRECVEQCTRTLQAEGRSK 259          
BLAST of Protein atonal like protein 8 vs. Ensembl Cavefish
Match: ENSAMXT00000052689.1 (atonal bHLH transcription factor 8 [Source:NCBI gene;Acc:103039142])

HSP 1 Score: 68.9366 bits (167), Expect = 6.547e-13
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 1
Query:  904 HTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            HTISAAFE LR  VP YS   KLSKL ILRIAC YI SL QL    D      N +F +C+++  +T+ +E + K
Sbjct:  186 HTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLAQLADL-DYTPDHSNMSFRECVEQCTRTLQAEGRSK 259          
BLAST of Protein atonal like protein 8 vs. Ensembl Nematostella
Match: EDO36266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ30])

HSP 1 Score: 62.003 bits (149), Expect = 2.754e-12
Identity = 31/76 (40.79%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  904 HTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLKN 1131
            HT+S AFE+LR AVP YS   KLSKL ILR+A  YI +L  L  T      +   +F++C+++  + + +E + K 
Sbjct:   16 HTMSEAFESLRKAVPSYSQDQKLSKLAILRLATSYISALADL--TESDTSAKSLKHFAECVEQCTRALQAEGRAKR 89          
BLAST of Protein atonal like protein 8 vs. Ensembl Nematostella
Match: EDO40813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S670])

HSP 1 Score: 43.8986 bits (102), Expect = 6.391e-6
Identity = 25/79 (31.65%), Postives = 40/79 (50.63%), Query Frame = 1
Query:  910 ISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLKNNSSTQ 1146
            ++ AFE LR+ +P      KLSK+  LR+A  YI  L  +L+ S    P+   NF   ++   Q+   E + +  SS +
Sbjct:    1 MNTAFEDLRNHIPNVPPDTKLSKIKTLRLAISYIRYLMDILEESKDGKPRVRRNF--VVEMALQSDMKEKRKREQSSVE 77          
BLAST of Protein atonal like protein 8 vs. Ensembl Medaka
Match: ENSORLT00000044230.1 (atonal bHLH transcription factor 8 [Source:NCBI gene;Acc:101168275])

HSP 1 Score: 70.0922 bits (170), Expect = 6.986e-13
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 1
Query:  904 HTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            HTISAAFE LR  VP YS   KLSKL ILRIAC YI SL QL +     D    S F++C+ +  +T+ +E + K
Sbjct:  283 HTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLAQLAELHPGSD---RSGFTECVDQCTRTLQAEGRSK 354          
BLAST of Protein atonal like protein 8 vs. Ensembl Medaka
Match: ENSORLT00000027875.1 (atonal bHLH transcription factor 8 [Source:NCBI gene;Acc:101168275])

HSP 1 Score: 70.0922 bits (170), Expect = 7.839e-13
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 1
Query:  904 HTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            HTISAAFE LR  VP YS   KLSKL ILRIAC YI SL QL +     D    S F++C+ +  +T+ +E + K
Sbjct:  283 HTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLAQLAELHPGSD---RSGFTECVDQCTRTLQAEGRSK 354          
BLAST of Protein atonal like protein 8 vs. Planmine SMEST
Match: SMESG000056587.1 (SMESG000056587.1)

HSP 1 Score: 440.269 bits (1131), Expect = 3.142e-156
Identity = 242/243 (99.59%), Postives = 242/243 (99.59%), Query Frame = 1
Query:  421 MMGKITDISAQSPKEFLNYNPKKKTRERKLLPTSQKIIEYFKVDKNIIQDQIHPGTFERFGILEVFSNYPQDEDSSSSIDCSVKLSHKKSPISCSDSETNKSPTEDESPNNTDNHIRXXXXXXXXVILDKSSLNMCSNKKNYKSLTXXXXXXXXXXXXXXXHTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLKNNSSTQN 1149
            MMGKITDISAQSPKEFLNYNPKKKTRERKLLPTSQKIIEYFKVDKNIIQDQIHPG FERFGILEVFSNYPQDEDSSSSIDCSVKLSHKKSPISCSDSETNKSPTEDESPNNTDNHIRSSSESQSSVILDKSSLNMCSNKKNYKSLTRERRVEANARERSRVHTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLKNNSSTQN
Sbjct:    1 MMGKITDISAQSPKEFLNYNPKKKTRERKLLPTSQKIIEYFKVDKNIIQDQIHPGEFERFGILEVFSNYPQDEDSSSSIDCSVKLSHKKSPISCSDSETNKSPTEDESPNNTDNHIRSSSESQSSVILDKSSLNMCSNKKNYKSLTRERRVEANARERSRVHTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLKNNSSTQN 243          
BLAST of Protein atonal like protein 8 vs. Planmine SMEST
Match: SMESG000018830.1 (SMESG000018830.1)

HSP 1 Score: 89.7373 bits (221), Expect = 4.844e-21
Identity = 46/75 (61.33%), Postives = 55/75 (73.33%), Query Frame = 1
Query:  904 HTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESLNQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLK 1128
            HTIS+AFE+LR  VP Y NS KLSKLGILRIACCYIESL+QL+     V+   +  F+  + KLA TIA ESK+K
Sbjct:   91 HTISSAFESLRQVVPSYYNSYKLSKLGILRIACCYIESLSQLINEDVNVESS-SDQFNDYVNKLAITIAQESKMK 164          
The following BLAST results are available for this feature:
BLAST of Protein atonal like protein 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ATOH82.725e-1352.00atonal bHLH transcription factor 8 [Source:HGNC Sy... [more]
back to top
BLAST of Protein atonal like protein 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein atonal like protein 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
net2.373e-1551.52gene:FBgn0002931 transcript:FBtr0290323[more]
net2.373e-1551.52gene:FBgn0002931 transcript:FBtr0330637[more]
back to top
BLAST of Protein atonal like protein 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
atoh86.027e-1350.67atonal bHLH transcription factor 8 [Source:NCBI ge... [more]
atoh86.451e-1350.67atonal bHLH transcription factor 8 [Source:NCBI ge... [more]
back to top
BLAST of Protein atonal like protein 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ATOH85.159e-1352.00atonal bHLH transcription factor 8 [Source:NCBI ge... [more]
back to top
BLAST of Protein atonal like protein 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Atoh82.032e-1352.00atonal bHLH transcription factor 8 [Source:MGI Sym... [more]
back to top
BLAST of Protein atonal like protein 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q96SQ7|ATOH8_HUMAN1.309e-1252.00Protein atonal homolog 8 OS=Homo sapiens OX=9606 G... [more]
sp|Q99NA2|ATOH8_MOUSE1.421e-1252.00Protein atonal homolog 8 OS=Mus musculus OX=10090 ... [more]
sp|D2CLZ9|ATOH8_DANRE4.870e-1250.67Protein atonal homolog 8 OS=Danio rerio OX=7955 GN... [more]
back to top
BLAST of Protein atonal like protein 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B0K6T51.983e-1553.70Blast:Protein atonal homolog 8 OS=Drosophila guanc... [more]
A0A0L7LQM02.040e-1556.12Atonal-like protein 8 OS=Operophtera brumata OX=10... [more]
A0A0M8ZN812.546e-1553.00Protein atonal like protein 8 OS=Melipona quadrifa... [more]
Q29NQ83.566e-1552.78BHLH domain-containing protein OS=Drosophila pseud... [more]
B4GQS83.566e-1552.78GL13900 OS=Drosophila persimilis OX=7234 GN=Dper\G... [more]
back to top
BLAST of Protein atonal like protein 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000042212.16.547e-1350.67atonal bHLH transcription factor 8 [Source:NCBI ge... [more]
ENSAMXT00000052339.16.547e-1350.67atonal bHLH transcription factor 8 [Source:NCBI ge... [more]
ENSAMXT00000053423.16.547e-1350.67atonal bHLH transcription factor 8 [Source:NCBI ge... [more]
ENSAMXT00000052689.16.547e-1350.67atonal bHLH transcription factor 8 [Source:NCBI ge... [more]
back to top
BLAST of Protein atonal like protein 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein atonal like protein 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein atonal like protein 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO362662.754e-1240.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408136.391e-631.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein atonal like protein 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000044230.16.986e-1350.67atonal bHLH transcription factor 8 [Source:NCBI ge... [more]
ENSORLT00000027875.17.839e-1350.67atonal bHLH transcription factor 8 [Source:NCBI ge... [more]
back to top
BLAST of Protein atonal like protein 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000056587.13.142e-15699.59SMESG000056587.1[more]
SMESG000018830.14.844e-2161.33SMESG000018830.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003276 ID=SMED30003276|Name=Protein atonal like protein 8|organism=Schmidtea mediterranea sexual|type=transcript|length=1187bp
CTCATACAGATGACAGAAAGCAATGTCGTTACATCATCTTGCAGTCTATG
GGAGCCACTCATCACTAATAATTGCAGCCGAAATCGAACACCTGTTTGAT
GACTGATTAATAACCTCACCCAGCAGAATAGTAGAGAATTCATCAGACAA
GCCACCTAATTGCCGCTATTCTGTAACAAGTTGTTATAATTCATTGGTGT
ATGTGTGTATTACTCTGCACGCTTGTTTCTTACCAGAGACGTCCATTCAA
ACCACCTCTACAAACACTTAAATTGTTGATTGGCTATATTTAAAACAGAT
TTTATATCTTTTACATTTGACACATTCGCTAAATATGTCAGCGTTAAACA
TCATGAAAATTGTTTTTATATCCAAATGGATATTTTGATTTCAGTTTAAA
ATATTGTTTTCACTCTGCATATGATGGGAAAAATTACGGATATTTCCGCT
CAATCGCCGAAAGAATTTTTGAATTATAATCCAAAAAAGAAAACCAGAGA
ACGAAAGCTTCTGCCAACATCTCAGAAAATTATCGAGTATTTTAAAGTCG
ATAAAAATATTATTCAAGATCAAATCCATCCGGGTACGTTTGAAAGATTC
GGTATTCTAGAAGTGTTTTCCAATTATCCACAAGATGAAGACAGTTCGTC
TTCTATTGATTGTTCTGTTAAACTGTCACACAAGAAATCACCTATTTCGT
GTTCGGATTCTGAAACCAATAAATCACCAACCGAAGATGAAAGTCCCAAT
AATACTGATAACCATATTAGAAGTTCCTCGGAATCTCAGAGTTCTGTGAT
TCTTGATAAATCATCTCTCAATATGTGTTCTAATAAAAAAAACTATAAAA
GTCTTACCAGAGAACGCCGAGTTGAAGCGAATGCTCGTGAGAGATCTCGA
GTACATACAATTAGTGCGGCTTTTGAAACTCTTCGCCATGCTGTGCCTGG
TTATTCTAACTCTCCGAAATTGTCTAAACTTGGCATTTTACGAATAGCTT
GTTGTTATATAGAATCATTGAATCAACTGCTTCAAACCTCAGATAAAGTA
GACCCTCAATTCAATTCAAATTTTAGTAAATGTATTCAGAAACTAGCACA
AACGATTGCATCAGAAAGTAAATTGAAAAACAATTCTTCCACTCAAAATT
GAAATTGTAAATTTAAATAGAGTTTATTATTCAGTCG
back to top

protein sequence of SMED30003276-orf-1

>SMED30003276-orf-1 ID=SMED30003276-orf-1|Name=SMED30003276-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=244bp
MMGKITDISAQSPKEFLNYNPKKKTRERKLLPTSQKIIEYFKVDKNIIQD
QIHPGTFERFGILEVFSNYPQDEDSSSSIDCSVKLSHKKSPISCSDSETN
KSPTEDESPNNTDNHIRSSSESQSSVILDKSSLNMCSNKKNYKSLTRERR
VEANARERSRVHTISAAFETLRHAVPGYSNSPKLSKLGILRIACCYIESL
NQLLQTSDKVDPQFNSNFSKCIQKLAQTIASESKLKNNSSTQN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0007547anterior pole progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR036638HLH_DNA-bd_sf
IPR032660ATOH8
IPR011598bHLH_dom
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0030154cell differentiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainSMARTSM00353finuluscoord: 154..206
e-value: 4.6E-14
score: 62.7
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPFAMPF00010HLHcoord: 149..200
e-value: 4.0E-14
score: 52.3
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPROSITEPS50888BHLHcoord: 148..200
score: 14.729
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainCDDcd00083HLHcoord: 147..205
e-value: 1.76741E-13
score: 61.4611
IPR036638Helix-loop-helix DNA-binding domain superfamilyGENE3DG3DSA:4.10.280.10coord: 144..212
e-value: 1.6E-19
score: 71.2
IPR036638Helix-loop-helix DNA-binding domain superfamilySUPERFAMILYSSF47459HLH, helix-loop-helix DNA-binding domaincoord: 146..210
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 90..125
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availablePANTHERPTHR19290BASIC HELIX-LOOP-HELIX PROTEIN NEUROGENIN-RELATEDcoord: 34..238
IPR032660Protein atonal homologue 8PANTHERPTHR19290:SF102PROTEIN ATONAL HOMOLOG 8coord: 34..238