Guanine nucleotide-binding protein G(O) subunit alpha

Overview
NameGuanine nucleotide-binding protein G(O) subunit alpha
Smed IDSMED30003275
Length (bp)1729
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanine nucleotide-binding protein G(O) subunit alpha (SMED30003275) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanine nucleotide-binding protein G(O) subunit alpha (SMED30003275) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanine nucleotide-binding protein G(O) subunit alpha (SMED30003275) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanine nucleotide-binding protein G(O) subunit alpha (SMED30003275) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003275

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003275SMESG000055191.1 dd_Smed_v4_1656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003275SMESG000055191.1 dd_Smed_v4_1656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003275SMESG000055191.1 dd_Smed_v4_1656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30003275SMESG000055191.1 dd_Smed_v4_1656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30003275SMESG000055191.1 dd_Smed_v4_1656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003275SMESG000055191.1 dd_Smed_v4_1656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003275SMESG000055191.1 dd_Smed_v4_1656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003275SMESG000055191.1 Contig4364uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003275SMESG000055191.1 Contig4364newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003275SMESG000055191.1 Contig42483newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003275SMESG000055191.1 Contig42483uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003275SMESG000055191.1 Contig42482newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003275SMESG000055191.1 Contig42482uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003275SMESG000055191.1 Contig29815newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003275SMESG000055191.1 Contig29815uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003275SMESG000056130.1 Contig4364uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003275SMESG000056130.1 Contig4364newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
photoreceptor neuronSMED30003275SMESG000055191.1 SMED30003275smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30003275SMESG000055191.1 OX_Smed_1.0.14650ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Human
Match: GNAO1 (G protein subunit alpha o1 [Source:HGNC Symbol;Acc:HGNC:4389])

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 286/354 (80.79%), Postives = 312/354 (88.14%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER AL++S+ I+K LKEDG+ AAKDVKLLLLGAGESGKSTIVKQMKIIHE GF+ ED KQYKPVVYSNT QS+ AI+RAM TLGI +GD +R ADAK+V DV+  MEDTEPFS ELL AM RLW D G+QECF RS EYQLNDSAKY+LD LDR+GA DY PTEQDILRTRVKTTGIVE HF FKN++F+LFDVGGQRSERKKWIHCFEDVTAIIFCVA+S YDQVLHEDETTNRM ESL LFDSICNNK+F  TSIILFLNKKDLF EKIKKSPLT+CFPEY G  TYE+AAAYIQA FE+KN SPNKEIYCH TCATDTNNIQ VFDAVTD+IIANNLRGCGLY
Sbjct:    1 MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Human
Match: GNAO1 (G protein subunit alpha o1 [Source:HGNC Symbol;Acc:HGNC:4389])

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 286/354 (80.79%), Postives = 312/354 (88.14%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER AL++S+ I+K LKEDG+ AAKDVKLLLLGAGESGKSTIVKQMKIIHE GF+ ED KQYKPVVYSNT QS+ AI+RAM TLGI +GD +R ADAK+V DV+  MEDTEPFS ELL AM RLW D G+QECF RS EYQLNDSAKY+LD LDR+GA DY PTEQDILRTRVKTTGIVE HF FKN++F+LFDVGGQRSERKKWIHCFEDVTAIIFCVA+S YDQVLHEDETTNRM ESL LFDSICNNK+F  TSIILFLNKKDLF EKIKKSPLT+CFPEY G  TYE+AAAYIQA FE+KN SPNKEIYCH TCATDTNNIQ VFDAVTD+IIANNLRGCGLY
Sbjct:    1 MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Human
Match: GNAO1 (G protein subunit alpha o1 [Source:HGNC Symbol;Acc:HGNC:4389])

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 282/354 (79.66%), Postives = 310/354 (87.57%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER AL++S+ I+K LKEDG+ AAKDVKLLLLGAGESGKSTIVKQMKIIHE GF+ ED KQYKPVVYSNT QS+ AI+RAM TLGI +GD +R ADAK+V DV+  MEDTEPFS ELL AM RLW D G+QECF RS EYQLNDSAKY+LD LDR+GA DY PTEQDILRTRVKTTGIVE HF FKN++F+LFDVGGQRSERKKWIHCFEDVTAIIFCVA+S YDQVLHEDETTNRM ESLKLFDSICNNKWFT TSIILFLNKKD+F+EKIKKSPLT+CFPEY G   + EA AYIQA +E+KN S +KEIY H TCATDTNNIQFVFDAVTDVIIA NLRGCGLY
Sbjct:    1 MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDIFEEKIKKSPLTICFPEYTGPSAFTEAVAYIQAQYESKNKSAHKEIYTHVTCATDTNNIQFVFDAVTDVIIAKNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Human
Match: GNAI1 (G protein subunit alpha i1 [Source:HGNC Symbol;Acc:HGNC:4384])

HSP 1 Score: 510.375 bits (1313), Expect = 7.650e-179
Identity = 246/356 (69.10%), Postives = 291/356 (81.74%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPF-SEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPN-KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +++ A+++S+ ID+ L+EDG +AA++VKLLLLGAGESGKSTIVKQMKIIHE G+++E+ KQYK VVYSNT QS+IAI+RAM  L I FGD  R  DA+ +  +  A E  E F + EL   +KRLW D GVQ CF RS EYQLNDSA Y+L+DLDR+   +Y+PT+QD+LRTRVKTTGIVE HF FK+++FK+FDVGGQRSERKKWIHCFE VTAIIFCVA+S+YD VL EDE  NRM ES+KLFDSICNNKWFT TSIILFLNKKDLF+EKIKKSPLT+C+PEY G  TYEEAAAYIQ  FE  N   + KEIY H TCATDT N+QFVFDAVTDVII NNL+ CGL+
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAE--EGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Human
Match: GNAI1 (G protein subunit alpha i1 [Source:HGNC Symbol;Acc:HGNC:4384])

HSP 1 Score: 510.375 bits (1313), Expect = 7.650e-179
Identity = 246/356 (69.10%), Postives = 291/356 (81.74%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPF-SEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPN-KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +++ A+++S+ ID+ L+EDG +AA++VKLLLLGAGESGKSTIVKQMKIIHE G+++E+ KQYK VVYSNT QS+IAI+RAM  L I FGD  R  DA+ +  +  A E  E F + EL   +KRLW D GVQ CF RS EYQLNDSA Y+L+DLDR+   +Y+PT+QD+LRTRVKTTGIVE HF FK+++FK+FDVGGQRSERKKWIHCFE VTAIIFCVA+S+YD VL EDE  NRM ES+KLFDSICNNKWFT TSIILFLNKKDLF+EKIKKSPLT+C+PEY G  TYEEAAAYIQ  FE  N   + KEIY H TCATDT N+QFVFDAVTDVII NNL+ CGL+
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAE--EGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Celegans
Match: goa-1 (Guanine nucleotide-binding protein G(o) subunit alpha [Source:UniProtKB/Swiss-Prot;Acc:P51875])

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 300/354 (84.75%), Postives = 320/354 (90.40%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCTMS++ER AL++SR I+K LKEDGMQAAKD+KLLLLGAGESGKSTIVKQMKIIHE GFT ED KQYKPVVYSNT QS++AILRAM+ LG+SFG  DR  DAK+V DV+  MEDTEPFSEELL +MKRLW D GVQ+CF RSNEYQLNDSAKYFLDDL+RLG   Y PTEQDILRTRVKTTGIVEVHF FKN+NFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRM ESLKLFDSICNNKWFT TSIILFLNKKDLF+EKIKKSPLT+CFPEY G+Q Y EA+AYIQA FEAKN S NKEIYCH TCATDT NIQFVFDAVTDVIIANNLRGCGLY
Sbjct:    1 MGCTMSQEERAALERSRMIEKNLKEDGMQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDYKQYKPVVYSNTVQSLVAILRAMSNLGVSFGSADREVDAKLVMDVVARMEDTEPFSEELLSSMKRLWGDAGVQDCFSRSNEYQLNDSAKYFLDDLERLGEAIYQPTEQDILRTRVKTTGIVEVHFTFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYSGRQDYHEASAYIQAQFEAKNKSANKEIYCHMTCATDTTNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Celegans
Match: gpa-16 (Guanine nucleotide-binding protein alpha-16 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9N2V6])

HSP 1 Score: 451.825 bits (1161), Expect = 3.341e-156
Identity = 224/359 (62.40%), Postives = 271/359 (75.49%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADA-KVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKN----NSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGC MS+++  A  +S+ ID+ LKEDG  + + +KLLLLGAGESGKSTI+KQM+IIH+ G+T E+ K ++ VVY N   S+ AI+ AM  L ISF  +D  +DA K++       ED  P  EEL+  MK +W+D G+Q+   RS EYQLNDSA Y+L  LDR+ A +Y+PT+ DILRTR+KTTGIVE  F++K+  F +FDVGGQRSERKKWIHCFEDVTA+IFCVA+SEYD VL ED  TNRM+ESLKLFDSICNNKWF  TSIILFLNKKDLF+EKI +SPLT CFPEY G   YEEA+AYIQ  FE  N       N+EIY   TCATDTNNI+FVFDAVTD+II +NLR CGLY
Sbjct:    1 MGCIMSQEDEAAKRRSKKIDRLLKEDGENSMRTIKLLLLGAGESGKSTILKQMRIIHDVGYTTEERKVFRGVVYGNIILSLNAIIHAMEQLKISFTTLDHESDARKLLMFSTTGEEDELP--EELVVLMKSVWSDSGIQKALERSREYQLNDSAGYYLSQLDRICAPNYIPTQDDILRTRIKTTGIVETQFVYKDRLFLVFDVGGQRSERKKWIHCFEDVTALIFCVALSEYDMVLVEDCQTNRMRESLKLFDSICNNKWFVETSIILFLNKKDLFEEKIVRSPLTHCFPEYTGANNYEEASAYIQQQFEDMNKRTTGEKNQEIYTQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGLY 357          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Celegans
Match: gpa-7 (Guanine nucleotide-binding protein alpha-7 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q21917])

HSP 1 Score: 449.514 bits (1155), Expect = 1.861e-155
Identity = 212/353 (60.06%), Postives = 267/353 (75.64%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGL 1392
            MG   SKD+++    +R ID+++K+D   + + +KLLLLGAGESGKSTI+KQM+I+H+ GF+Q+D +  +PVVYSN   SM++ILRAM  L I +G+ DR  D+++V   + A  + E  +EEL  AM+RLW DPGV+EC+ RSNEYQ++DSAKYFLD+L RL + +Y+P+EQD+LRTR+KTTGI EV F  K + F++ DVGGQRSERKKWIHCF++V AIIF  ++SEYDQ L ED  TNRMQESLKLFDSICN+ WF     ILFLNKKDLF EKI +SPLTVCFPEY G+Q   E   YIQ  FE  N S  +EIYCH TCATDTNN+QFV DA  D+IIA NL+  GL
Sbjct:    1 MGHCTSKDQKEGKRLNRRIDEQIKKDQSMSLRIIKLLLLGAGESGKSTILKQMRILHKDGFSQQDLEMIRPVVYSNCIHSMLSILRAMFHLQIEYGEPDRVRDSQLVFATVHA--NKEELTEELAAAMQRLWHDPGVRECYRRSNEYQIDDSAKYFLDNLPRLSSPNYVPSEQDLLRTRIKTTGITEVLFELKGLTFRVIDVGGQRSERKKWIHCFDNVNAIIFISSLSEYDQTLREDNCTNRMQESLKLFDSICNSPWFADIHFILFLNKKDLFAEKIVRSPLTVCFPEYKGQQNQTECINYIQWKFEQLNRSSQREIYCHHTCATDTNNVQFVLDACLDMIIAKNLKSMGL 351          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Celegans
Match: gpa-4 (Guanine nucleotide-binding protein alpha-4 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9BIG5])

HSP 1 Score: 438.728 bits (1127), Expect = 4.303e-151
Identity = 213/360 (59.17%), Postives = 272/360 (75.56%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKV-VSDVIQA--MEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEA--KNNSP-NKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGC  S    +A  +S+ ID++L+ D  +   ++KLLLLGAGESGKSTIV+QM+I+HE GF +++   Y+PVV+SN  QSM+AIL+AM  L ISF D  R  DA++ +S  +     E +E FS EL + MK+LW D GV++C  R++EYQLNDSA+Y+ + LDR+ +  Y+PT+ DILR RVK+TGIVE  FM+K++ FK+FDVGGQRSERKKWIHCF+ VTA+IFCVA+SEYD  L ED+T NRM ES++LFDSI NN WFT TSIILFLNK D+F+E+I+ +PLTVCFPEY G  T  E + +IQ+ FE   K  +P  KEIY H TCATDTNNI+FVFDAVTD+II NNL  CGLY
Sbjct:    1 MGCFHSTGS-EAKKRSKLIDEQLRHDHERCVGEIKLLLLGAGESGKSTIVRQMRILHETGFNKQEQMAYRPVVFSNMVQSMLAILKAMQPLNISFTDAAREEDARMFISHFLHVNNAELSEAFSLELSDLMKQLWMDEGVKKCVKRAHEYQLNDSAEYYFNALDRISSSSYLPTQDDILRARVKSTGIVETTFMYKDLCFKMFDVGGQRSERKKWIHCFDSVTAVIFCVALSEYDLRLAEDQTMNRMHESMQLFDSIVNNCWFTETSIILFLNKMDIFEERIRYTPLTVCFPEYQGGMTITETSTFIQSRFEILNKRQTPAQKEIYSHFTCATDTNNIRFVFDAVTDIIIRNNLYLCGLY 359          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Celegans
Match: gpa-3 (Guanine nucleotide-binding protein alpha-3 subunit [Source:UniProtKB/Swiss-Prot;Acc:P28052])

HSP 1 Score: 414.846 bits (1065), Expect = 7.354e-142
Identity = 195/353 (55.24%), Postives = 262/353 (74.22%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGL 1392
            MG   S ++++   KS+ IDK++ ++ M   K VKLLLLGAGE GKST++KQM+I+H+ GFT E+ +Q K VV++NT Q+M AIL+ M  L ++F    R  DAK V +  + +++ + F EEL  A++ LW D  VQ+   + NE+Q+ +SA +FL  LDR+   DY PTEQDIL +R+KTTGIVEV F  K+++F++FDVGGQRSERKKWIHCFEDV AIIF  A+SEYDQVL EDETTNRM ES++LF+SICN++WF +TS+ILFLNKKDLF EKIK++ +   FP+Y G QTY+E+  YI+  F+  N +P K IY HQTCATDT+ +Q + D+V D+II  NL+GCGL
Sbjct:    1 MGLCQSAEDKELTLKSKAIDKEMMQNHMSQQKVVKLLLLGAGECGKSTVLKQMRILHDHGFTAEEAEQQKSVVFNNTLQAMTAILKGMEALRMTFDKPIRENDAKFVMESHKMLQEAKVFPEELANAIQALWNDKAVQQVIAKGNEFQMPESAPHFLSSLDRIKLPDYNPTEQDILLSRIKTTGIVEVKFQMKSVDFRVFDVGGQRSERKKWIHCFEDVNAIIFIAAISEYDQVLFEDETTNRMIESMRLFESICNSRWFINTSMILFLNKKDLFAEKIKRTSIKSAFPDYKGAQTYDESCRYIEEKFDGLNANPEKTIYMHQTCATDTDQVQMILDSVIDMIIQANLQGCGL 353          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088267)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 299/354 (84.46%), Postives = 319/354 (90.11%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT S +ER A+ +S+ I+K LKEDG+QAAKD+KLLLLGAGESGKSTIVKQMKIIHE GFT ED KQY+PVVYSNT QS++AILRAM TL I + + +R +DAK+V DV Q M DTEPFSEELL AMKRLW D GVQECF RSNEYQLNDSAKYFLDDLDRLGAKDY PTEQDILRTRVKTTGIVEVHF FKN+NFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFT TSIILFLNKKDLF+EKI+KSPLT+CFPEY G Q Y EAAAYIQA FEAKN S +KEIYCH TCATDTNNIQFVFDAVTDVIIANNLRGCGLY
Sbjct:    1 MGCTTSAEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNKSTSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088269)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 299/354 (84.46%), Postives = 319/354 (90.11%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT S +ER A+ +S+ I+K LKEDG+QAAKD+KLLLLGAGESGKSTIVKQMKIIHE GFT ED KQY+PVVYSNT QS++AILRAM TL I + + +R +DAK+V DV Q M DTEPFSEELL AMKRLW D GVQECF RSNEYQLNDSAKYFLDDLDRLGAKDY PTEQDILRTRVKTTGIVEVHF FKN+NFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFT TSIILFLNKKDLF+EKI+KSPLT+CFPEY G Q Y EAAAYIQA FEAKN S +KEIYCH TCATDTNNIQFVFDAVTDVIIANNLRGCGLY
Sbjct:    1 MGCTTSAEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNKSTSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088264)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 299/354 (84.46%), Postives = 319/354 (90.11%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT S +ER A+ +S+ I+K LKEDG+QAAKD+KLLLLGAGESGKSTIVKQMKIIHE GFT ED KQY+PVVYSNT QS++AILRAM TL I + + +R +DAK+V DV Q M DTEPFSEELL AMKRLW D GVQECF RSNEYQLNDSAKYFLDDLDRLGAKDY PTEQDILRTRVKTTGIVEVHF FKN+NFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFT TSIILFLNKKDLF+EKI+KSPLT+CFPEY G Q Y EAAAYIQA FEAKN S +KEIYCH TCATDTNNIQFVFDAVTDVIIANNLRGCGLY
Sbjct:    1 MGCTTSAEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNKSTSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088268)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 299/354 (84.46%), Postives = 319/354 (90.11%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT S +ER A+ +S+ I+K LKEDG+QAAKD+KLLLLGAGESGKSTIVKQMKIIHE GFT ED KQY+PVVYSNT QS++AILRAM TL I + + +R +DAK+V DV Q M DTEPFSEELL AMKRLW D GVQECF RSNEYQLNDSAKYFLDDLDRLGAKDY PTEQDILRTRVKTTGIVEVHF FKN+NFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFT TSIILFLNKKDLF+EKI+KSPLT+CFPEY G Q Y EAAAYIQA FEAKN S +KEIYCH TCATDTNNIQFVFDAVTDVIIANNLRGCGLY
Sbjct:    1 MGCTTSAEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNKSTSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088270)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 299/354 (84.46%), Postives = 319/354 (90.11%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT S +ER A+ +S+ I+K LKEDG+QAAKD+KLLLLGAGESGKSTIVKQMKIIHE GFT ED KQY+PVVYSNT QS++AILRAM TL I + + +R +DAK+V DV Q M DTEPFSEELL AMKRLW D GVQECF RSNEYQLNDSAKYFLDDLDRLGAKDY PTEQDILRTRVKTTGIVEVHF FKN+NFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFT TSIILFLNKKDLF+EKI+KSPLT+CFPEY G Q Y EAAAYIQA FEAKN S +KEIYCH TCATDTNNIQFVFDAVTDVIIANNLRGCGLY
Sbjct:    1 MGCTTSAEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNKSTSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Zebrafish
Match: gnao1a (guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O, a [Source:ZFIN;Acc:ZDB-GENE-040426-1757])

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 279/354 (78.81%), Postives = 312/354 (88.14%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER ALD+S+ I+K LKEDG+ AAKDVKLLLLGAGESGKSTIVKQMKIIHE GF+ +D KQYKPVVYSNT QS+ AI+RAM TLG+ +GD +R ADAK+V DV+  MEDTEP+S ELL AM RLW+D G+QECF R+ EYQLNDSA+Y+LD LDR+GA DY PTEQDILRTRVKTTGIVE HF FKN++F+LFDVGGQRSERKKWIHCFEDVTAIIFCVA+S YDQVLHEDETTNRM ESL LFDSICNNK+F  TSIILFLNKKDLF EKIKKSPL++CFPEY G  TY++AAAYIQA FE+KN SPNKEIYCH TCATDT NIQ VFDAVTD+IIANNLRGCGLY
Sbjct:    1 MGCTLSAEERAALDRSKAIEKNLKEDGITAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGDDVKQYKPVVYSNTIQSLAAIVRAMDTLGLEYGDKERKADAKMVCDVVSRMEDTEPYSPELLSAMIRLWSDSGIQECFSRAREYQLNDSAQYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFAEKIKKSPLSICFPEYTGPNTYDDAAAYIQAQFESKNRSPNKEIYCHMTCATDTGNIQVVFDAVTDIIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Zebrafish
Match: gnao1a (guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O, a [Source:ZFIN;Acc:ZDB-GENE-040426-1757])

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 273/354 (77.12%), Postives = 311/354 (87.85%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER ALD+S+ I+K LKEDG+ AAKDVKLLLLGAGESGKSTIVKQMKIIHE GF+ +D KQYKPVVYSNT QS+ AI+RAM TLG+ +GD +R ADAK+V DV+  MEDTEP+S ELL AM RLW+D G+QECF R+ EYQLNDSA+Y+LD LDR+GA DY PTEQDILRTRVKTTGIVE HF FKN++F+LFDVGGQRSERKKWIHCFEDVTAIIFCVA+S YDQVLHEDETTNRM ES+KLFDSICNNKWFT+TSIILFLNKKD+F +KI+KSPL++CFPEY G  T+EEA  YIQ+ +E+KN S  KEIY H TCATDT+NIQFVFDAVTDVIIANNLR CGLY
Sbjct:    1 MGCTLSAEERAALDRSKAIEKNLKEDGITAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGDDVKQYKPVVYSNTIQSLAAIVRAMDTLGLEYGDKERKADAKMVCDVVSRMEDTEPYSPELLSAMIRLWSDSGIQECFSRAREYQLNDSAQYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESMKLFDSICNNKWFTNTSIILFLNKKDIFGDKIRKSPLSICFPEYTGSNTFEEAVNYIQSQYESKNKSVEKEIYSHITCATDTDNIQFVFDAVTDVIIANNLRFCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Zebrafish
Match: gnao1b (guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O, b [Source:ZFIN;Acc:ZDB-GENE-040426-1693])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 276/354 (77.97%), Postives = 303/354 (85.59%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER ALD+SR I+K LKEDG+ AAKDVKLLLLG GESGKSTIVKQMKIIHE GF+ +D KQ+KPVVYSNT QS+ AILRAM TLGI + D DR ADAK+V DV+  MEDTEP+S ELL AM RLW D G Q CF RS EYQLNDSA+Y+LD L R+G+ DY+PTEQDILRTRVKTTGIVE HF FKN+NF+LFDVGGQRSERKKWIHCFEDVTAIIFCVAMS YDQ+LHEDETTNRM ESL LFDSICNNK+F  TSIILFLNKKDLF EKI KSPL++CFPEY G  T+E AA+YIQ  FE KN SPNKEIYCH TCATDT NIQ VFDAVTD+IIANNLRGCGLY
Sbjct:    1 MGCTLSAEERAALDRSRAIEKNLKEDGISAAKDVKLLLLGGGESGKSTIVKQMKIIHEDGFSGDDVKQFKPVVYSNTIQSLSAILRAMETLGIEYSDKDRLADAKMVFDVVGRMEDTEPYSTELLAAMIRLWTDTGTQACFNRSREYQLNDSAQYYLDSLQRIGSPDYLPTEQDILRTRVKTTGIVETHFSFKNLNFRLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSGYDQMLHEDETTNRMHESLMLFDSICNNKFFVDTSIILFLNKKDLFGEKIVKSPLSICFPEYTGPNTFEAAASYIQGQFETKNRSPNKEIYCHLTCATDTGNIQVVFDAVTDIIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Zebrafish
Match: gnao1b (guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O, b [Source:ZFIN;Acc:ZDB-GENE-040426-1693])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 276/354 (77.97%), Postives = 303/354 (85.59%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER ALD+SR I+K LKEDG+ AAKDVKLLLLG GESGKSTIVKQMKIIHE GF+ +D KQ+KPVVYSNT QS+ AILRAM TLGI + D DR ADAK+V DV+  MEDTEP+S ELL AM RLW D G Q CF RS EYQLNDSA+Y+LD L R+G+ DY+PTEQDILRTRVKTTGIVE HF FKN+NF+LFDVGGQRSERKKWIHCFEDVTAIIFCVAMS YDQ+LHEDETTNRM ESL LFDSICNNK+F  TSIILFLNKKDLF EKI KSPL++CFPEY G  T+E AA+YIQ  FE KN SPNKEIYCH TCATDT NIQ VFDAVTD+IIANNLRGCGLY
Sbjct:    1 MGCTLSAEERAALDRSRAIEKNLKEDGISAAKDVKLLLLGGGESGKSTIVKQMKIIHEDGFSGDDVKQFKPVVYSNTIQSLSAILRAMETLGIEYSDKDRLADAKMVFDVVGRMEDTEPYSTELLAAMIRLWTDTGTQACFNRSREYQLNDSAQYYLDSLQRIGSPDYLPTEQDILRTRVKTTGIVETHFSFKNLNFRLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSGYDQMLHEDETTNRMHESLMLFDSICNNKFFVDTSIILFLNKKDLFGEKIVKSPLSICFPEYTGPNTFEAAASYIQGQFETKNRSPNKEIYCHLTCATDTGNIQVVFDAVTDIIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Zebrafish
Match: gnao1b (guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O, b [Source:ZFIN;Acc:ZDB-GENE-040426-1693])

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 260/354 (73.45%), Postives = 291/354 (82.20%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER ALD+SR I+K LKEDG+ AAKDVKLLLLG      S     + ++ + GF+ +D KQ+KPVVYSNT QS+ AILRAM TLGI + D DR ADAK+V DV+  MEDTEP+S ELL AM RLW D G Q CF RS EYQLNDSA+Y+LD L R+G+ DY+PTEQDILRTRVKTTGIVE HF FKN+NF+LFDVGGQRSERKKWIHCFEDVTAIIFCVAMS YDQ+LHEDETTNRM ESL LFDSICNNK+F  TSIILFLNKKDLF EKI KSPL++CFPEY G  T+E AA+YIQ  FE KN SPNKEIYCH TCATDT NIQ VFDAVTD+IIANNLRGCGLY
Sbjct:    1 MGCTLSAEERAALDRSRAIEKNLKEDGISAAKDVKLLLLG-----NSRAPVHLAVVSDDGFSGDDVKQFKPVVYSNTIQSLSAILRAMETLGIEYSDKDRLADAKMVFDVVGRMEDTEPYSTELLAAMIRLWTDTGTQACFNRSREYQLNDSAQYYLDSLQRIGSPDYLPTEQDILRTRVKTTGIVETHFSFKNLNFRLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSGYDQMLHEDETTNRMHESLMLFDSICNNKFFVDTSIILFLNKKDLFGEKIVKSPLSICFPEYTGPNTFEAAASYIQGQFETKNRSPNKEIYCHLTCATDTGNIQVVFDAVTDIIIANNLRGCGLY 349          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Xenopus
Match: gnao1 (G protein subunit alpha o1 [Source:NCBI gene;Acc:549749])

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 287/354 (81.07%), Postives = 313/354 (88.42%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER AL++S+ I+K LKEDG+ AAKDVKLLLLGAGESGKSTIVKQMKIIHE GF+ ED KQYKPVVYSNT QS+ AI+RAM TLGI +GD +R ADAK+V DV+  MEDTEPFS ELL AM RLWAD G+QECF RS EYQLNDSAKY+LD LDR+GA DY PTEQDILRTRVKTTGIVE HF FKN++F+LFDVGGQRSERKKWIHCFEDVTAIIFCVA+S YDQVLHEDETTNRM ESL LFDSICNNK+F  TSIILFLNKKDLF EKIKKSPLT+CFPEY G  TYE+AAAYIQA FE+KN SPNKEIYCH TCATDTNNIQ VFDAVTD+IIANNLRGCGLY
Sbjct:    1 MGCTLSAEERAALERSKQIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERRADAKMVCDVVSRMEDTEPFSPELLSAMMRLWADSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFAEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Xenopus
Match: gnao1 (G protein subunit alpha o1 [Source:NCBI gene;Acc:549749])

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 278/354 (78.53%), Postives = 308/354 (87.01%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER AL++S+ I+K LKEDG+ AAKDVKLLLLGAGESGKSTIVKQMKIIHE GF+ ED KQYKPVVYSNT QS+ AI+RAM TLGI +GD +R ADAK+V DV+  MEDTEPFS ELL AM RLWAD G+QECF RS EYQLNDSAKY+LD LDR+GA DY PTEQDILRTRVKTTGIVE HF FKN++F+LFDVGGQRSERKKWIHCFEDVTAIIFCVA+S YDQVLHEDETTNRM ESLKLFDSICNNKWFT TSIILFLNKKD+F EKIK SPLT+CFP+Y G  ++ EA A+IQ  +E++N S  KEIY H TCATDT NIQFVFDAVTDVIIANNLRGCGLY
Sbjct:    1 MGCTLSAEERAALERSKQIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERRADAKMVCDVVSRMEDTEPFSPELLSAMMRLWADSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDIFQEKIKSSPLTICFPDYTGPNSFTEAVAHIQHQYESRNKSQTKEIYTHVTCATDTQNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Xenopus
Match: gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 [Source:NCBI gene;Acc:100038283])

HSP 1 Score: 511.146 bits (1315), Expect = 2.866e-179
Identity = 246/356 (69.10%), Postives = 291/356 (81.74%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPF-SEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPN-KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +++ A+++S+ ID+ L+EDG +AA++VKLLLLGAGESGKSTIVKQMKIIHE G+++E+ KQYK VVYSNT QS+IAI+RAM  L I FGD  R  DA+ +  +  A E  E F + EL   +KRLW D GVQ CF RS EYQLNDSA Y+L+DLDR+    Y+PT+QD+LRTRVKTTGIVE HF FK+++FK+FDVGGQRSERKKWIHCFE VTAIIFCVA+S+YD VL EDE  NRM ES+KLFDSICNNKWFT TSIILFLNKKDLF+EKIK+SPLT+C+PEYPG  TYEEAAAYIQ  FE  N   + KEIY H TCATDT N+QFVFDAVTDVII NNL+ CGL+
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDPSRADDARQLFVLAGAAE--EGFMTAELAGVIKRLWKDGGVQACFNRSREYQLNDSAAYYLNDLDRIAQNSYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYPGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Xenopus
Match: gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 [Source:NCBI gene;Acc:100038283])

HSP 1 Score: 511.146 bits (1315), Expect = 1.493e-178
Identity = 246/356 (69.10%), Postives = 291/356 (81.74%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPF-SEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPN-KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +++ A+++S+ ID+ L+EDG +AA++VKLLLLGAGESGKSTIVKQMKIIHE G+++E+ KQYK VVYSNT QS+IAI+RAM  L I FGD  R  DA+ +  +  A E  E F + EL   +KRLW D GVQ CF RS EYQLNDSA Y+L+DLDR+    Y+PT+QD+LRTRVKTTGIVE HF FK+++FK+FDVGGQRSERKKWIHCFE VTAIIFCVA+S+YD VL EDE  NRM ES+KLFDSICNNKWFT TSIILFLNKKDLF+EKIK+SPLT+C+PEYPG  TYEEAAAYIQ  FE  N   + KEIY H TCATDT N+QFVFDAVTDVII NNL+ CGL+
Sbjct:   44 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDPSRADDARQLFVLAGAAE--EGFMTAELAGVIKRLWKDGGVQACFNRSREYQLNDSAAYYLNDLDRIAQNSYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYPGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 397          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Xenopus
Match: gnai2 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 [Source:NCBI gene;Acc:394861])

HSP 1 Score: 503.442 bits (1295), Expect = 2.742e-176
Identity = 235/355 (66.20%), Postives = 288/355 (81.13%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPN-KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +++ A ++S+NIDK L+EDG +AA++VKLLLLGAGESGKSTIVKQMKIIHE G+++E+ +QY+ VV+SNT QS++AI++AM  L I FGD  R  DA+ +  +    E+     ++L   ++RLWADPGVQ CF RS EYQLNDSA Y+L+DL+R+   DY+PT+QD+LRTRVKTTGIVE HF FK+++FK+FDVGGQRSERKKWIHCFE VTAIIFCVA+S YD VL EDE  NRM ES+KLFDSICNNKWFT TSIILFLNKKDLF+EKI +SPL++CFPEY G   Y+EAA+YIQ  FE  N   + KEIY H TCATDT N+QFVFDAVTDVII NNL+ CGL+
Sbjct:    1 MGCTVSAEDKAAAERSKNIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVFSNTIQSIMAIIKAMGNLKIDFGDPARADDARQLFALSSTAEEQGILPDDLAGVIRRLWADPGVQACFSRSREYQLNDSAAYYLNDLERIARSDYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITRSPLSICFPEYSGANQYDEAASYIQTKFEDLNKRRDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Mouse
Match: Gnao1 (guanine nucleotide binding protein, alpha O [Source:MGI Symbol;Acc:MGI:95775])

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 283/354 (79.94%), Postives = 311/354 (87.85%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER AL++S+ I+K LKEDG+ AAKDVKLLLLGAGESGKSTIVKQMKIIHE GF+ ED KQYKPVVYSNT QS+ AI+RAM TLG+ +GD +R  D+K+V DV+  MEDTEPFS ELL AM RLW D G+QECF RS EYQLNDSAKY+LD LDR+GA DY PTEQDILRTRVKTTGIVE HF FKN++F+LFDVGGQRSERKKWIHCFEDVTAIIFCVA+S YDQVLHEDETTNRM ESL LFDSICNNK+F  TSIILFLNKKDLF EKIKKSPLT+CFPEYPG  TYE+AAAYIQ  FE+KN SPNKEIYCH TCATDTNNIQ VFDAVTD+IIANNLRGCGLY
Sbjct:    1 MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYPGSNTYEDAAAYIQTQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Mouse
Match: Gnao1 (guanine nucleotide binding protein, alpha O [Source:MGI Symbol;Acc:MGI:95775])

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 283/354 (79.94%), Postives = 311/354 (87.85%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER AL++S+ I+K LKEDG+ AAKDVKLLLLGAGESGKSTIVKQMKIIHE GF+ ED KQYKPVVYSNT QS+ AI+RAM TLG+ +GD +R  D+K+V DV+  MEDTEPFS ELL AM RLW D G+QECF RS EYQLNDSAKY+LD LDR+GA DY PTEQDILRTRVKTTGIVE HF FKN++F+LFDVGGQRSERKKWIHCFEDVTAIIFCVA+S YDQVLHEDETTNRM ESL LFDSICNNK+F  TSIILFLNKKDLF EKIKKSPLT+CFPEYPG  TYE+AAAYIQ  FE+KN SPNKEIYCH TCATDTNNIQ VFDAVTD+IIANNLRGCGLY
Sbjct:    1 MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYPGSNTYEDAAAYIQTQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Mouse
Match: Gnao1 (guanine nucleotide binding protein, alpha O [Source:MGI Symbol;Acc:MGI:95775])

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 276/354 (77.97%), Postives = 308/354 (87.01%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER AL++S+ I+K LKEDG+ AAKDVKLLLLGAGESGKSTIVKQMKIIHE GF+ ED KQYKPVVYSNT QS+ AI+RAM TLG+ +GD +R  D+K+V DV+  MEDTEPFS ELL AM RLW D G+QECF RS EYQLNDSAKY+LD LDR+GA DY PTEQDILRTRVKTTGIVE HF FKN++F+LFDVGGQRSERKKWIHCFEDVTAIIFCVA+S YDQVLHEDETTNRM ESLKLFDSICNNKWFT TSIILFLNKKD+F+EKIKKSPLT+CFPEY G   + EA A+IQ  +E+KN S +KE+Y H TCATDTNNIQFVFDAVTDVIIA NLRGCGLY
Sbjct:    1 MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDIFEEKIKKSPLTICFPEYTGPSAFTEAVAHIQGQYESKNKSAHKEVYSHVTCATDTNNIQFVFDAVTDVIIAKNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Mouse
Match: Gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting 1 [Source:MGI Symbol;Acc:MGI:95771])

HSP 1 Score: 510.375 bits (1313), Expect = 5.252e-179
Identity = 246/356 (69.10%), Postives = 291/356 (81.74%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPF-SEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPN-KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +++ A+++S+ ID+ L+EDG +AA++VKLLLLGAGESGKSTIVKQMKIIHE G+++E+ KQYK VVYSNT QS+IAI+RAM  L I FGD  R  DA+ +  +  A E  E F + EL   +KRLW D GVQ CF RS EYQLNDSA Y+L+DLDR+   +Y+PT+QD+LRTRVKTTGIVE HF FK+++FK+FDVGGQRSERKKWIHCFE VTAIIFCVA+S+YD VL EDE  NRM ES+KLFDSICNNKWFT TSIILFLNKKDLF+EKIKKSPLT+C+PEY G  TYEEAAAYIQ  FE  N   + KEIY H TCATDT N+QFVFDAVTDVII NNL+ CGL+
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAE--EGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Mouse
Match: Gnai3 (guanine nucleotide binding protein (G protein), alpha inhibiting 3 [Source:MGI Symbol;Acc:MGI:95773])

HSP 1 Score: 504.982 bits (1299), Expect = 6.805e-177
Identity = 241/355 (67.89%), Postives = 287/355 (80.85%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPN-KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +++ A+++S+ ID+ L+EDG +AAK+VKLLLLGAGESGKSTIVKQMKIIHE G+++++ KQYK VVYSNT QS+IAI+RAM  L I FG+  R  DA+ +  V+    +    + EL   +KRLW D GVQ CF RS EYQLNDSA Y+L+DLDR+   +Y+PT+QD+LRTRVKTTGIVE HF FK + FK+FDVGGQRSERKKWIHCFE VTAIIFCVA+S+YD VL EDE  NRM ES+KLFDSICNNKWFT TSIILFLNKKDLF+EKIK+SPLT+C+PEY G  TYEEAAAYIQ  FE  N   + KE+Y H TCATDT N+QFVFDAVTDVII NNL+ CGLY
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGESARADDARQLF-VLAGSAEEGVMTSELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVKTTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEVYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. UniProt/SwissProt
Match: sp|P30683|GNAO_LYMST (Guanine nucleotide-binding protein G(o) subunit alpha OS=Lymnaea stagnalis OX=6523 PE=2 SV=3)

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 308/354 (87.01%), Postives = 328/354 (92.66%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER A+++S+ I+K LKEDGMQAAKD+KLLLLGAGESGKSTIVKQMKIIHEGGFT EDNKQYKPVVYSNT QS++AI+RAM TL I FGD +R +DAK+V DVI  MEDTEPFSEELL AMKRLW D GVQEC GR+NEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHF FKN+NFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFT TSIILFLNKKDLF+EKIKKSPLT+CFPEY GKQ Y+EA+AYIQA FEAKN S  KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY
Sbjct:    1 MGCTLSAEERAAMERSKAIEKNLKEDGMQAAKDIKLLLLGAGESGKSTIVKQMKIIHEGGFTSEDNKQYKPVVYSNTIQSLVAIIRAMGTLSIPFGDNERESDAKMVLDVIARMEDTEPFSEELLAAMKRLWVDSGVQECLGRANEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTETSIILFLNKKDLFEEKIKKSPLTICFPEYTGKQMYQEASAYIQAQFEAKNKSSAKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. UniProt/SwissProt
Match: sp|P51877|GNAO_PLATR (Guanine nucleotide-binding protein G(o) subunit alpha OS=Planorbella trivolvis OX=283763 PE=2 SV=2)

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 307/354 (86.72%), Postives = 327/354 (92.37%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER A+++S+ I+K LKEDGMQAAKD+KLLLLGAGESGKSTIVKQMKIIHEGGFT ED KQYKPVVYSNT QS++AI+RAM TL I FGD +R +DAK+V DVI  MEDTEPFSEELL AMKRLW D GVQEC GR+NEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHF FKN+NFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFT TSIILFLNKKDLF+EKIKKSPLT+CFPEY GKQ Y+EA+AYIQA FEAKN S  KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY
Sbjct:    1 MGCTLSAEERAAMERSKAIEKNLKEDGMQAAKDIKLLLLGAGESGKSTIVKQMKIIHEGGFTSEDTKQYKPVVYSNTIQSLVAIIRAMGTLSIPFGDNERESDAKMVLDVIARMEDTEPFSEELLAAMKRLWVDSGVQECLGRANEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTETSIILFLNKKDLFEEKIKKSPLTICFPEYTGKQMYQEASAYIQAQFEAKNKSSAKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. UniProt/SwissProt
Match: sp|O15976|GNAO_MIZYE (Guanine nucleotide-binding protein G(o) subunit alpha OS=Mizuhopecten yessoensis OX=6573 GN=SCGOA PE=2 SV=3)

HSP 1 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 308/357 (86.27%), Postives = 330/357 (92.44%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDR---GADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCTMS ++R A ++SR+I+KKLKEDG+QAAKD+KLLLLGAGESGKSTIVKQMKIIHEGGFT EDNKQYKPVVYSNT QS++AI+RAM+TL I +GD +R    +DAK+V DVI  MEDTEPFSEELL AMKRLW D GVQECFGRSNEYQLNDSAKYFLDDLDRLG+KDYMPTEQDILRTRVKTTGIVEVHF FKN+NFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFD+ICNNKWFT TSIILFLNKKDLF+EKIKKS LT+CF EY G QTYEEAAAYIQA FEAKN S +KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY
Sbjct:    1 MGCTMSAEDRAAAERSRDIEKKLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHEGGFTSEDNKQYKPVVYSNTIQSLVAIVRAMSTLNIPYGDNEREEIKSDAKIVLDVIARMEDTEPFSEELLAAMKRLWTDTGVQECFGRSNEYQLNDSAKYFLDDLDRLGSKDYMPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDNICNNKWFTDTSIILFLNKKDLFEEKIKKSSLTICFNEYTGNQTYEEAAAYIQAQFEAKNKSSSKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 357          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. UniProt/SwissProt
Match: sp|P38404|GNAO_LOCMI (Guanine nucleotide-binding protein G(o) subunit alpha OS=Locusta migratoria OX=7004 PE=3 SV=1)

HSP 1 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 307/354 (86.72%), Postives = 322/354 (90.96%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGC MS +ER AL +S+ I+K LKEDG+QAAKD+KLLLLGAGESGKSTIVKQMKIIHE GFT ED KQY+PVVYSNT QS++AILRAM  LGISF + +R  DAK+V DVIQ MEDTEPFSEELL AMKRLWAD GVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDY PTEQDILRTRVKTTGIVEVHF FKN+NFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFT TSIILFLNKKDLF+EKIKKSPLT+CFPEY G Q Y EAAAYIQA FEAKN S  KEIYCH TCATDTNNIQFVFDAVTDVIIANNLRGCGLY
Sbjct:    1 MGCAMSAEERAALARSKQIEKNLKEDGLQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPNLGISFCNNERETDAKMVFDVIQRMEDTEPFSEELLAAMKRLWADSGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYAGAQEYGEAAAYIQAQFEAKNKSTTKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. UniProt/SwissProt
Match: sp|P51875|GNAO_CAEEL (Guanine nucleotide-binding protein G(o) subunit alpha OS=Caenorhabditis elegans OX=6239 GN=goa-1 PE=1 SV=3)

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 300/354 (84.75%), Postives = 320/354 (90.40%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCTMS++ER AL++SR I+K LKEDGMQAAKD+KLLLLGAGESGKSTIVKQMKIIHE GFT ED KQYKPVVYSNT QS++AILRAM+ LG+SFG  DR  DAK+V DV+  MEDTEPFSEELL +MKRLW D GVQ+CF RSNEYQLNDSAKYFLDDL+RLG   Y PTEQDILRTRVKTTGIVEVHF FKN+NFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRM ESLKLFDSICNNKWFT TSIILFLNKKDLF+EKIKKSPLT+CFPEY G+Q Y EA+AYIQA FEAKN S NKEIYCH TCATDT NIQFVFDAVTDVIIANNLRGCGLY
Sbjct:    1 MGCTMSQEERAALERSRMIEKNLKEDGMQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDYKQYKPVVYSNTVQSLVAILRAMSNLGVSFGSADREVDAKLVMDVVARMEDTEPFSEELLSSMKRLWGDAGVQDCFSRSNEYQLNDSAKYFLDDLERLGEAIYQPTEQDILRTRVKTTGIVEVHFTFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYSGRQDYHEASAYIQAQFEAKNKSANKEIYCHMTCATDTTNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. TrEMBL
Match: A0A4E0RQ13 (Guanine nucleotide binding protein (G protein) alpha o polypeptide OS=Fasciola hepatica OX=6192 GN=D915_006627 PE=4 SV=1)

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 328/355 (92.39%), Postives = 342/355 (96.34%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGA-DAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+SK+ERDAL++SRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNT QSM+AILRAM TLGI FGD ++GA DA++V DVIQAMEDT+PFSE+LLEAMKRLWAD GVQECF RSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHF FKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFT TSIILFLNKKDLF+EKIK+SPLT+CFPEYPGKQTYEEAA YIQASFEAKN SPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLR CGLY
Sbjct:    1 MGCTLSKEERDALEQSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTIQSMVAILRAMNTLGIQFGDAEQGAEDARIVCDVIQAMEDTKPFSEDLLEAMKRLWADAGVQECFARSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFQFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICFPEYPGKQTYEEAAIYIQASFEAKNRSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRNCGLY 355          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. TrEMBL
Match: A0A3Q0KCR4 (Putative trimeric G-protein alpha o subunit OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 691.034 bits (1782), Expect = 0.000e+0
Identity = 327/355 (92.11%), Postives = 343/355 (96.62%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGA-DAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+SK+ERDAL++SRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNT QSM+AILRAM TLGI FGD ++GA DA++V DVIQAMEDT+PFSE+LL+AMKRLWAD GVQECF RSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHF FKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFT TSIILFLNKKDLF+EKIK+SPLT+CFPEYPGKQTYEEAA YIQASFEAKN SPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNL+GCGLY
Sbjct:    1 MGCTLSKEERDALEQSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTIQSMVAILRAMNTLGIQFGDSEQGAEDARIVCDVIQAMEDTKPFSEDLLDAMKRLWADSGVQECFARSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFQFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICFPEYPGKQTYEEAAIYIQASFEAKNRSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLKGCGLY 355          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. TrEMBL
Match: A0A094ZCU2 (Guanine nucleotide-binding protein G(O) subunit alpha OS=Schistosoma haematobium OX=6185 GN=MS3_00187 PE=4 SV=1)

HSP 1 Score: 691.034 bits (1782), Expect = 0.000e+0
Identity = 327/355 (92.11%), Postives = 343/355 (96.62%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGA-DAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+SK+ERDAL++SRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNT QSM+AILRAM TLGI FGD ++GA DA++V DVIQAMEDT+PFSE+LL+AMKRLWAD GVQECF RSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHF FKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFT TSIILFLNKKDLF+EKIK+SPLT+CFPEYPGKQTYEEAA YIQASFEAKN SPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNL+GCGLY
Sbjct:    1 MGCTLSKEERDALEQSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTIQSMVAILRAMNTLGIQFGDSEQGAEDARIVCDVIQAMEDTKPFSEDLLDAMKRLWADSGVQECFARSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFQFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICFPEYPGKQTYEEAAIYIQASFEAKNRSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLKGCGLY 355          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. TrEMBL
Match: A0A4Z2CXN4 (Guanine nucleotide-binding protein G(O) subunit alpha isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_006706 PE=4 SV=1)

HSP 1 Score: 691.034 bits (1782), Expect = 0.000e+0
Identity = 327/355 (92.11%), Postives = 343/355 (96.62%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGA-DAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+SK+ERDAL++SRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNT QSM+AILRAM TLGI FGD ++GA DA++V DVIQAMEDT+PFSE+LL+AMKRLWAD GVQECF RSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHF FKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFT TSIILFLNKKDLF+EKIK+SPLT+CFPEYPGKQTYEEAA YIQASFEAKN SPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNL+GCGLY
Sbjct:    1 MGCTLSKEERDALEQSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTIQSMVAILRAMNTLGIQFGDSEQGAEDARIVCDVIQAMEDTKPFSEDLLDAMKRLWADSGVQECFARSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFQFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICFPEYPGKQTYEEAAIYIQASFEAKNRSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLKGCGLY 355          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. TrEMBL
Match: A0A4S2L6S3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009653 PE=4 SV=1)

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 325/355 (91.55%), Postives = 342/355 (96.34%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGA-DAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+SK+ER+AL++S+NIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQ+KPVVYSNT QSM+AILRAM TLGI FGD ++GA DA++V DVIQAMEDT+PFSEELLEAMKRLWAD GVQECF RSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTR+KTTGIVEVHF FKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFT TSIILFLNKKDLF+EKIK+SPLT+CFPEYPGKQTYEEAA YIQASFEAKN SPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLR CGLY
Sbjct:    1 MGCTLSKEEREALEQSKNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQFKPVVYSNTIQSMVAILRAMNTLGIQFGDGEQGAEDARIVCDVIQAMEDTKPFSEELLEAMKRLWADSGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRIKTTGIVEVHFQFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICFPEYPGKQTYEEAAIYIQASFEAKNRSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRNCGLY 355          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Cavefish
Match: gnao1a (G protein subunit alpha o1 [Source:NCBI gene;Acc:103039135])

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 280/354 (79.10%), Postives = 312/354 (88.14%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER ALD+S+ I+K LKEDG+ AAKDVKLLLLGAGESGKSTIVKQMKIIHE GF+ +D KQYKPVVYSNT QS+ AI+RAM TLG+ +GD +R ADAK+V DV+  MEDTEP+S ELL AM RLWAD G+QECF R+ EYQLNDSA+Y+LD LDR+GA DY PTEQDILRTRVKTTGIVE HF FKN++F+LFDVGGQRSERKKWIHCFEDVTAIIFCVA+S YDQVLHEDETTNRM ESL LFDSICNNK+F  TSIILFLNKKDLF EKIKKSPL++CFPEY G  TY++AAAYIQA FE+KN SPNKEIYCH TCATDT NIQ VFDAVTD+IIANNLRGCGLY
Sbjct:    1 MGCTLSAEERAALDRSKAIEKNLKEDGITAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGDDVKQYKPVVYSNTIQSLAAIVRAMDTLGLEYGDKERKADAKMVCDVVSRMEDTEPYSPELLTAMMRLWADSGIQECFSRAREYQLNDSAQYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFAEKIKKSPLSICFPEYTGPNTYDDAAAYIQAQFESKNRSPNKEIYCHMTCATDTGNIQVVFDAVTDIIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Cavefish
Match: gnao1a (G protein subunit alpha o1 [Source:NCBI gene;Acc:103039135])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 277/354 (78.25%), Postives = 311/354 (87.85%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER ALD+S+ I+K LKEDG+ AAKDVKLLLLGAGESGKSTIVKQMKIIHE GF+ +D KQYKPVVYSNT QS+ AI+RAM TLG+ +GD +R ADAK+V DV+  MEDTEP+S ELL AM RLWAD G+QECF R+ EYQLNDSA+Y+LD LDR+GA DY PTEQDILRTRVKTTGIVE HF FKN++F+LFDVGGQRSERKKWIHCFEDVTAIIFCVA+S YDQVLHEDETTNRM ESLKLFDSICNNKWFTSTSIILFLNKKD+F+EKIKKSPLT+CFPEY G  T+ E   YIQ+ +E+KN S +KE+Y H TCATDTNNIQFVFDAVTDVIIANNLR CGLY
Sbjct:    1 MGCTLSAEERAALDRSKAIEKNLKEDGITAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGDDVKQYKPVVYSNTIQSLAAIVRAMDTLGLEYGDKERKADAKMVCDVVSRMEDTEPYSPELLTAMMRLWADSGIQECFSRAREYQLNDSAQYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLKLFDSICNNKWFTSTSIILFLNKKDIFEEKIKKSPLTICFPEYTGPDTFTEGVEYIQSQYESKNKSFHKEVYAHTTCATDTNNIQFVFDAVTDVIIANNLRFCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Cavefish
Match: gnaia (guanine nucleotide-binding protein G(i) subunit alpha-1 [Source:NCBI gene;Acc:103035761])

HSP 1 Score: 499.975 bits (1286), Expect = 4.099e-175
Identity = 238/355 (67.04%), Postives = 287/355 (80.85%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPN-KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +++ A ++S+ ID+ L++DG +AA++VKLLLLGAGESGKSTIVKQMKIIHE G+++E+ KQYK VVYSNT QS+IAI+RAM  L I F D  R  DA+ +  V+    +    + EL   ++RLW D GVQ CF RS EYQLNDSA Y+L+DLDR+ +  Y+PT+QD+LRTRVKTTGIVE HF FK+++FK+FDVGGQRSERKKWIHCFE VTAIIFCV++S+YD VL EDE  NRM ES+KLFDSICNNKWFT TSIILFLNKKDLF+EKIK+SPLT+C+PEY G  TYEEAAAYIQ  FE  N   + KEIY H TCATDT N+QFVFDAVTDVII NNL+ CGL+
Sbjct:    1 MGCTLSSEDKVAQERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFSDAARADDARQLF-VLAGSAEEGYMTGELAGIIQRLWKDGGVQACFSRSREYQLNDSASYYLNDLDRISSAAYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVSLSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Cavefish
Match: gnai2b (guanine nucleotide-binding protein G(i) subunit alpha-2 [Source:NCBI gene;Acc:111193748])

HSP 1 Score: 498.434 bits (1282), Expect = 1.792e-174
Identity = 234/355 (65.92%), Postives = 285/355 (80.28%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPN-KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +++ A ++S+ IDK L+EDG +AA++VKLLLLGAGESGKSTIVKQMKIIHE G+++++ KQY+ VVYSNT QS++AI++AM  L I + D  R  DA+ +  +  A E+     ++L   ++RLWAD GVQ CFGRS EYQLNDSA Y+L+DL+R+   DY+PT+QD+LRTRVKTTGIVE HF FK+++FK+FDVGGQRSERKKWIHCFE VTAIIFCVA+S YD VL EDE  NRM ES+KLFDSICNNKWFT TSIILFLNKKDLF+EKI  SPL +CFPEY G   Y+EAA+YIQ  FE  N   + KEIY H TCATDT N+QFVFDAVTDVII NNL+ CGL+
Sbjct:    1 MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTIQSIMAIIKAMGNLKIEYSDASRADDARQLFALSAAAEEQGILPDDLSNVIRRLWADSGVQGCFGRSREYQLNDSAAYYLNDLERIARADYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITSSPLNICFPEYSGANKYDEAASYIQTKFEDLNKKKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Cavefish
Match: gnai2a (guanine nucleotide-binding protein G(i) subunit alpha-2 [Source:NCBI gene;Acc:103033963])

HSP 1 Score: 488.419 bits (1256), Expect = 1.524e-170
Identity = 234/355 (65.92%), Postives = 286/355 (80.56%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPN-KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S++++ A ++SR+IDK L+EDG +AAK+VKLLLLGAGESGKSTIVKQMKIIHE G+++++ +QY+ VV+SNT QS++AI++AM+ L I + D  R  DA+ +  +  A E+     E+L  A+ RLW+D GVQ CF RS EYQLNDSA Y+L+DLDR+   +Y+P++ D+LRTRVKTTGIVE HF FK+++FK+FDVGGQRSERKKWIHCFE VTAIIFCVAMS YD VL EDE  NRM ES+KLFDSICNNKWFT TSIILFLNKKDLF+EKI  SPLT+CFPEY G   Y+EA+ YI+  FE  N   + KEIY H TCATDT NIQFVFDAVTDVII NNLR CGL+
Sbjct:    1 MGCTVSQEDKAAAERSRHIDKSLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECRQYRAVVFSNTIQSIMAIIKAMSNLKIDYEDPARADDARQLFALAAAAEEQGALPEDLSSAITRLWSDAGVQSCFTRSREYQLNDSAAYYLNDLDRIAMSNYIPSQPDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVAMSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIAHSPLTICFPEYTGASKYDEASEYIRTKFEDLNKKKDTKEIYSHFTCATDTKNIQFVFDAVTDVIIKNNLRDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Sea Lamprey
Match: gnai3 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-070713-6])

HSP 1 Score: 508.449 bits (1308), Expect = 3.416e-179
Identity = 241/355 (67.89%), Postives = 289/355 (81.41%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKN-NSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +++ A+++SR ID+ L+EDG +A+++VKLLLLGAGESGKSTIVKQMKIIHE G+T+E+ KQYK VVYSNT QS+IAI+RAM  L I FGD  R  DA+ +  +  + ED    + EL + +KRLWADPGVQ CF R+ EYQLNDSA Y+L+DL+R+    Y+PT+QD+LRTRVKTTGIVE HF FK+++FK+FDVGGQRSERKKWIHCFE VTAIIFCVA+S YD VL EDE  NRM ES+KLFDSICNNKWF  TSIILFLNKKDLF+EK+ +SPLT+C+PEY G  TYEEAAAYIQ  FE  N    +KEIY H TCATDT N+QFVFDAVTDVII NNL+ CGL+
Sbjct:    1 MGCTLSTEDKAAVERSRMIDRNLREDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEAGYTEEECKQYKAVVYSNTIQSVIAIIRAMGNLRIDFGDAGRADDARQLFVLAGSAEDG-LMTPELAQVIKRLWADPGVQACFRRAREYQLNDSAAYYLNDLERISQPSYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFIETSIILFLNKKDLFEEKVIRSPLTICYPEYTGGNTYEEAAAYIQTQFENLNKRKESKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004355.1 (pep scaffold:Pmarinus_7.0:GL477714:209323:228779:-1 gene:ENSPMAG00000003914.1 transcript:ENSPMAT00000004355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 454.136 bits (1167), Expect = 3.167e-158
Identity = 216/320 (67.50%), Postives = 255/320 (79.69%), Query Frame = 1
Query:  439 LLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPN-KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
             +  GAGESGKSTIVKQMKIIHE G+++++ KQY  VV+SN  QS+IAI+RAM  L I FGD+ R  DA+ +  V+  + +    + +L E +KRLW+D GVQ CF RS EYQLNDSA Y+L+DL+R+    Y+PT+QD+LRTRVKTTGIVE HF FK+++FK+FDVGGQRSERKKWIHCFE VTAIIFCVA+S YD VL EDE TNRM ES+KLFDSICNNKWFT TSIILFLNKKDLF+EKI KSPL++CF EY G  TYEEAAAYIQ  FE  N   + KEIY H TCATDT N+QFVFDAVTDVII NNL+ CGL+
Sbjct:    4 FVFAGAGESGKSTIVKQMKIIHEDGYSEDECKQYTAVVFSNAIQSIIAIIRAMGKLKIDFGDVSRAEDARQLF-VLAGVAEEGVMTPDLSEVIKRLWSDSGVQACFRRSREYQLNDSAAYYLNDLERISNLSYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEETNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKINKSPLSICFAEYIGSNTYEEAAAYIQCQFEDLNKRKDTKEIYSHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 322          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Sea Lamprey
Match: gnat2 (guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-011128-10])

HSP 1 Score: 418.313 bits (1074), Expect = 5.873e-144
Identity = 199/340 (58.53%), Postives = 257/340 (75.59%), Query Frame = 1
Query:  379 SRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKN-NSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            S+ ++KKL ED  + A+ VKLLLLGAGESGKSTIVKQMKIIH+ G+++ +  ++K ++YSNT QS++AI+RAM T  I +GD  R AD + + ++  ++E+      EL   + RLW D GVQ  F R++EYQLNDSA Y+L+DLDRL    Y+P EQD+LR+RVKTTGI+E  F FK++ F++FDVGGQRSERKKWIHCFE VT IIFC A+S YD VL ED+  NRM ESL LF+SICN+++F  TSI+LFLNKKDLF+EK+KK  L +CFP+Y G  T+++A AYI+  F   N     KEIY H TCATDT N++FVFDAVTD+II NNL+ CGL+
Sbjct:    3 SKELEKKLAEDAEKEARTVKLLLLGAGESGKSTIVKQMKIIHKNGYSEAECLEFKAIIYSNTLQSILAIVRAMETFSIDYGDPARAADGRQLFNLADSLEEG-SMPNELSAIIIRLWKDTGVQASFDRASEYQLNDSASYYLNDLDRLMNPSYLPNEQDVLRSRVKTTGIIEDSFCFKDLQFRMFDVGGQRSERKKWIHCFEGVTCIIFCGALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFNDTSIVLFLNKKDLFEEKVKKVHLNICFPDYDGPNTFDDAGAYIKNQFLDLNLRKEAKEIYSHLTCATDTQNVKFVFDAVTDIIIKNNLKDCGLF 341          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007354.1 (pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 gene:ENSPMAG00000006632.1 transcript:ENSPMAT00000007354.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 325.479 bits (833), Expect = 6.625e-108
Identity = 160/319 (50.16%), Postives = 220/319 (68.97%), Query Frame = 1
Query:  439 LLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAA-AYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGL 1392
            L  +G GESGKST +KQM+IIH  G+T++D + +  +V+ N   +M A++RAM TLGI + +    A A+++ +V   +E      +  +EA++ LWADPG++EC+ R  E+QL DSAKY+L+DL R+ A +Y+PT+QDILR R+ TTGI+E  F  +N+ F++ DVGGQRSER+KWIHCFE+VT+I+F VA+SEYDQVL E ++ NRM+ES  LF +I    WF ++S+ILFLNKKDL +EKI  S L   FP++ G Q   +AA  +I   F   N    K IY H TCATDT NI+FVF AV D I+  NL+   L
Sbjct:    1 LFCVGTGESGKSTFIKQMRIIHGSGYTEDDKRSFIKLVHQNVFSAMQAMIRAMETLGIPYANAGNQAHAQLLREV--DVEKICSLDKPYIEAVRCLWADPGIEECYDRRREFQLTDSAKYYLNDLARISAVNYLPTQQDILRVRIPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIIHSHLVDYFPDFDGPQQDPQAAREFILRMFVELNPDTEKVIYSHFTCATDTENIRFVFAAVKDAILQLNLKEYNL 317          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007349.1 (pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 gene:ENSPMAG00000006632.1 transcript:ENSPMAT00000007349.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 323.168 bits (827), Expect = 4.831e-107
Identity = 158/320 (49.38%), Postives = 220/320 (68.75%), Query Frame = 1
Query:  439 LLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAA--YIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGL 1392
            L  +G GESGKST +KQM+IIH  G+T++D + +  +V+ N   +M A++RAM TLGI + +    A A+++ +V   +E      +  +EA++ LWADPG++EC+ R  E+QL DSAKY+L+DL R+ A +Y+PT+QDILR R+ TTGI+E  F  +N+ F++ DVGGQRSER+KWIHCFE+VT+I+F VA+SEYDQVL E ++ NRM+ES  LF +I    WF ++S+ILFLNKKDL +EKI  S L   FP++  +  ++  AA  +I   F   N    K IY H TCATDT NI+FVF AV D I+  NL+   L
Sbjct:    1 LFCVGTGESGKSTFIKQMRIIHGSGYTEDDKRSFIKLVHQNVFSAMQAMIRAMETLGIPYANAGNQAHAQLLREV--DVEKICSLDKPYIEAVRCLWADPGIEECYDRRREFQLTDSAKYYLNDLARISAVNYLPTQQDILRVRIPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIIHSHLVDYFPDFDVRNQFDPQAAREFILRMFVELNPDTEKVIYSHFTCATDTENIRFVFAAVKDAILQLNLKEYNL 318          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Yeast
Match: GPA2 (Nucleotide binding alpha subunit of the heterotrimeric G protein; interacts with the receptor Gpr1p, has signaling role in response to nutrients; required for the recruitment of Ras-GTP at the plasma membrane and in the nucleus [Source:SGD;Acc:S000000822])

HSP 1 Score: 280.796 bits (717), Expect = 4.721e-89
Identity = 142/333 (42.64%), Postives = 212/333 (63.66%), Query Frame = 1
Query:  427 KDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISF--------GDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSN--EYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHF-MFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGL 1392
            K++K+LLLGAGESGKST+++Q+KI+H+ GF++++ K+Y P++Y N  +    +++A T   ++          D+ R    ++ ++       T  F E++   +  LWA P  Q+     N  ++ L DS  YF+++  R+ + +Y PT+QDILR+R  T+GI +    M  ++   ++DVGGQRSERKKWIHCF++VT +IFCV++SEYDQ L ED+  NR QESL LFD+I N++WF  TS++LFLNK DLF EK+ K P+   FP+Y G     +AA YI   F  + N  N  IY H T ATDT+NI+ VF A+ + I+ N L+  G+
Sbjct:  122 KELKVLLLGAGESGKSTVLQQLKILHQNGFSEQEIKEYIPLIYQNLLEIGRNLIQARTRFNVNLEPECELTQQDLSRTMSYEMPNNY------TGQFPEDIAGVISTLWALPSTQDLVNGPNASKFYLMDSTPYFMENFTRITSPNYRPTQQDILRSRQMTSGIFDTVIDMGSDIKMHIYDVGGQRSERKKWIHCFDNVTLVIFCVSLSEYDQTLMEDKNQNRFQESLVLFDNIVNSRWFARTSVVLFLNKIDLFAEKLSKVPMENYFPDYTGGSDINKAAKYILWRF-VQLNRANLSIYPHVTQATDTSNIRLVFAAIKETILENTLKDSGV 447          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Yeast
Match: GPA1 (Subunit of the G protein involved in pheromone response; GTP-binding alpha subunit of the heterotrimeric G protein; negatively regulates the mating pathway by sequestering G(beta)gamma and by triggering an adaptive response; activates Vps34p at the endosome; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001047])

HSP 1 Score: 256.914 bits (655), Expect = 1.165e-79
Identity = 122/245 (49.80%), Postives = 168/245 (68.57%), Query Frame = 1
Query:  664 IQAMEDTEPFSEELLEAMKRLWA-DPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAA-AYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGL 1392
            IQ         E++ +A+K+LW  D G+++CF RSNE+QL  SA Y+ D++++  + +Y+ T++DIL+ R+KTTGI E  F   +  FK+ D GGQRSERKKWIHCFE +TA++F +AMSEYDQ+L EDE  NRM ES+ LFD++ N+KWF  T  ILFLNK DLF+EK+K  P+   FP+Y G+    EA   Y +  F + N + NK IY  +TCATDT  ++FV  AVTD+II  NL+  G+
Sbjct:  228 IQGQNRRNLIHEDIAKAIKQLWNNDKGIKQCFARSNEFQLEGSAAYYFDNIEKFASPNYVCTDEDILKGRIKTTGITETEFNIGSSKFKVLDAGGQRSERKKWIHCFEGITAVLFVLAMSEYDQMLFEDERVNRMHESIMLFDTLLNSKWFKDTPFILFLNKIDLFEEKVKSMPIRKYFPDYQGRVGDAEAGLKYFEKIFLSLNKT-NKPIYVKRTCATDTQTMKFVLSAVTDLIIQQNLKKIGI 471          

HSP 2 Score: 78.5666 bits (192), Expect = 6.190e-16
Identity = 40/103 (38.83%), Postives = 66/103 (64.08%), Query Frame = 1
Query:  334 MGCTMSK----DERDALDKSRN----IDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISF 618
            MGCT+S     DE D   +++     I++ L+ +  +   ++KLLLLGAGESGKST++KQ+K++H+GGF+ ++  QY  V++++  QSM  ++     LGI  
Sbjct:    1 MGCTVSTQTIGDESDPFLQNKRANDVIEQSLQLEKQRDKNEIKLLLLGAGESGKSTVLKQLKLLHQGGFSHQERLQYAQVIWADAIQSMKILIIQARKLGIQL 103          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Yeast
Match: ARF3 (Glucose-repressible ADP-ribosylation factor; GTPase of Ras superfamily involved in regulating cell polarity and invasive growth; localizes to dynamic spots at plasma membrane and modulates PtdIns(4,5)P2 levels to facilitate endocytosis; required for localization of endocytic protein Lsb5p to correct cortical site in cells; also has mRNA binding activity; homolog of mammalian Arf6 [Source:SGD;Acc:S000005620])

HSP 1 Score: 54.299 bits (129), Expect = 4.214e-9
Identity = 35/124 (28.23%), Postives = 59/124 (47.58%), Query Frame = 1
Query:  793 KYFLDDLDRLGAKDYM-PTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFD 1161
            K  +  LD+ G    +   + + ++T   T G       +KN+ F ++DVGGQ+  R  W H F   TA+IF +          +    NRM+E+ +   SI   K   +  ++++ NK+DL D
Sbjct:   19 KILMLGLDKAGKTTILYKLKLNKIKTSTPTVGFNVETVTYKNVKFNMWDVGGQQRLRPLWRHYFPATTALIFVI----------DSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDLKD 132          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Yeast
Match: ARF1 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated vesicle formation in intracellular trafficking within the Golgi; ARF1 has a paralog, ARF2, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002351])

HSP 1 Score: 48.1358 bits (113), Expect = 6.658e-7
Identity = 35/130 (26.92%), Postives = 58/130 (44.62%), Query Frame = 1
Query:  865 TRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQAS 1254
            T + T G       +KN++F ++DVGGQ   R  W H + +   +IF V  ++  ++    E   RM       D + N  W      ++F NK+DL  E +  + +T    E  G  +      +IQA+
Sbjct:   44 TTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNE----DELRNAAW------LVFANKQDL-PEAMSAAEIT----EKLGLHSIRNRPWFIQAT 158          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Yeast
Match: CIN4 (GTP-binding protein involved in beta-tubulin (Tub2p) folding; isolated as mutant with increased chromosome loss and sensitivity to benomyl; regulated by the GTPase-activating protein, Cin2p, the human retinitis pigmentosa 2 (RP2) homolog [Source:SGD;Acc:S000004746])

HSP 1 Score: 46.595 bits (109), Expect = 2.219e-6
Identity = 30/97 (30.93%), Postives = 52/97 (53.61%), Query Frame = 1
Query:  892 EVH-FMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMS---EYDQVLHE-DETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEK 1167
            ++H  M K++   L+D+GGQR+ R  W + F+   A+I+C+ +S    +D+ L E  E  NR +           N+     ++I+ LNK DL ++K
Sbjct:   54 QIHSLMIKDVTISLWDIGGQRTLRPFWDNYFDKTQAMIWCIDVSLSMRFDETLQELKELINRDE-----------NRIGYECAVIVVLNKIDLVEDK 139          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Nematostella
Match: EDO49692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG04])

HSP 1 Score: 523.857 bits (1348), Expect = 0.000e+0
Identity = 252/355 (70.99%), Postives = 292/355 (82.25%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPN-KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +++ A ++S+ IDK L+ DG +AA++VKLLLLGAGESGKSTIVKQMKIIHE G+++E+  QYK VVYSNT QSMIAI+RAM TL I FG  DR  DA+ +  +  +MED + F+ EL+  MKRLW+D G+Q CF RS EYQLNDSA Y+L+ LDRLG+ DY+PTEQD+LRTRVKTTGIVE HF FK+++FK+FDVGGQRSERKKWIHCFE VTAIIFCVA+S YD VL EDE  NRM ES+KLFDSICNNKWFT TSIILFLNKKDLF EKI KSPLT+CFPEY G  TYEEAAAYIQ  FE  N   + KEIY H TCATDTNNIQFVFDAVTDVII NNL+ CGL+
Sbjct:    1 MGCTLSAEDKAAAERSKMIDKNLRADGERAAREVKLLLLGAGESGKSTIVKQMKIIHEHGYSKEECTQYKQVVYSNTIQSMIAIIRAMGTLKIEFGHPDRADDAREMFALAGSMEDVK-FTAELISIMKRLWSDSGIQACFARSREYQLNDSASYYLNALDRLGSPDYVPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMMESMKLFDSICNNKWFTDTSIILFLNKKDLFAEKIVKSPLTICFPEYTGSNTYEEAAAYIQMQFENLNKRKDTKEIYTHFTCATDTNNIQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Nematostella
Match: EDO32540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS4])

HSP 1 Score: 506.908 bits (1304), Expect = 2.681e-178
Identity = 240/354 (67.80%), Postives = 287/354 (81.07%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER A+ +S+ I+K LK +G +A +DVKLLLLGAGESGKSTIVKQM+IIH+ GF+ ED  QY+P+V+SNT  S++ I+RAM  L I F +  R  DAK+V DVI   +DTEPF+ EL E+M+RLW D GVQ+CF RS EYQL DSAKY+LD L R+GA +Y  TEQD+LRTRVKTTGIVEV F +K ++FKLFDVGGQRSERKKWIHCFEDVTAII+CVA+S YD  L EDE+TNRM+ESLKLF+SI NNKWF  TS+ILFLNKKDLF+EKI K PLT+CFPEY G  T++E A YI+  FE+KN +  KEIY H TCATDT NI FVF+AVTD IIANNL+GCGLY
Sbjct:    1 MGCTLSAEERAAIARSKAIEKNLKLEGARAERDVKLLLLGAGESGKSTIVKQMRIIHDHGFSPEDYIQYRPLVFSNTIYSLLTIIRAMDKLRIDFENDARLMDAKLVFDVIARADDTEPFTPELTESMERLWKDAGVQQCFHRSREYQLGDSAKYYLDSLQRIGAPNYEATEQDLLRTRVKTTGIVEVQFDYKRLHFKLFDVGGQRSERKKWIHCFEDVTAIIYCVALSAYDLTLEEDESTNRMEESLKLFESIINNKWFVDTSVILFLNKKDLFEEKISKFPLTLCFPEYSGPSTFDEGAKYIRKQFESKNLNDEKEIYTHLTCATDTQNINFVFNAVTDTIIANNLKGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Nematostella
Match: EDO41465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S470])

HSP 1 Score: 345.895 bits (886), Expect = 4.441e-115
Identity = 175/354 (49.44%), Postives = 234/354 (66.10%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAA-AYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGL 1392
            M C +S++ ++    +  I+K++++D     +++KLLLLG GESGKST +KQM+IIH  G++ ED + Y P+VY N   +M ++ RAM TL I + D      A  +  V    ++   F  E  EA K LW+D G+QEC+ R  EYQL+DSAKY+L DLDRL   DY+PTEQD+LR R  T+GI+E  F  + + F++ DVGGQRSER+KWIHCFE+VT+I+F VA+SEYDQVL E ++ NRM+ES  LF +I    WF ++SIILFLNKKDL +EKI  S L   FPE+ G Q   +AA  +I   F   N   +K IY H TCATDT NI+FVF AV D I+  NL+   L
Sbjct:    1 MDCCLSEEAKERKRINAEIEKQIRQDKRNQRRELKLLLLGTGESGKSTFIKQMRIIHGQGYSDEDKRGYIPLVYQNIITAMHSLTRAMETLKIPYKDSSNLEKASYIRTV--DPKNVTTFEREYYEATKSLWSDAGMQECYDRRREYQLSDSAKYYLTDLDRLAKPDYLPTEQDVLRARAPTSGIIEYPFDLETIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSIILFLNKKDLLEEKIMFSHLVEYFPEFDGPQCDAQAAREFILKMFVDLNPDTDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNL 352          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Nematostella
Match: EDO47993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKI8])

HSP 1 Score: 309.301 bits (791), Expect = 8.738e-101
Identity = 159/354 (44.92%), Postives = 228/354 (64.41%), Query Frame = 1
Query:  337 GCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADA-KVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPG-KQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGL 1392
            GC ++++E +   +S+ IDK++ ++  Q  + VK+LLLGAGESGKST +KQM+II+   F  +  ++YKPVVYSN  + M  +  A   L I +   D    A ++++       DTE F  +  E+++RLW D G+++ F R  E+QL DS +YFLD LDR+   DY+PT+QD+L +R  T GIVE  FM K++ FK+ DVGGQRS+R KW  CF++VT+I+F V+ S YDQVL ED TTNR+ ES  +F++I NNK+F + SIILFLNK DL  EK+K + +   FP + G     E+   +I   F++K    +K ++ H T A DT NI+FVF AV D I+  NL+   L
Sbjct:    5 GCCLTQEEAEQRAQSQKIDKQIAQEKAQLRRQVKILLLGAGESGKSTFLKQMRIIYGKDFDADALQEYKPVVYSNILKGMKVLADARRKLRIDWDAPDNEMHAERILTLQAPPRIDTE-FFLQYAESVRRLWTDAGIRDSFDRRREFQLGDSTRYFLDHLDRICRADYIPTKQDMLHSRKATKGIVEHEFMIKSIPFKMVDVGGQRSQRAKWFQCFDEVTSILFLVSSSAYDQVLMEDRTTNRLVESCNIFETIVNNKFFANVSIILFLNKTDLLTEKVKHTNIKDFFPAFQGDPHKLEDVQNFILQMFDSKRRERSKALFHHFTTAVDTENIKFVFHAVKDTILQENLKALML 357          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Nematostella
Match: EDO49193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHA6])

HSP 1 Score: 276.944 bits (707), Expect = 5.296e-88
Identity = 163/377 (43.24%), Postives = 228/377 (60.48%), Query Frame = 1
Query:  334 MGC---TMSKDERDALDKSRN----IDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHE-GGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTL--GISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIK--KSPLTVCFPEYPGKQTYEEAAA-------------YIQASF-EAKNNSPNKEIYC--HQTCATDTNNIQFVFDAVTDVIIANNLR 1380
            MGC   +++++ER+   K +     I+++LKED +      +LLLLGAGESGKSTIVKQM+I+H+  GFT+ + +Q    +  N   +++ I  AM+TL   +   + +       V +V  A +   P   E  E  K LW D GV EC+ RSNEYQL D A+YFLD +D +  +DY+PTEQD+LR RV T+GI+E  F    + F +FDVGGQR ER+KWI CF DVTAIIF VA S Y+ VL ED + NR++ESL+LF SI NN+W  + S+ILFLNK+DL  +K++  KS +   FP++   +T  +A A             +I+  F      S + + YC  H TCA DT NI+ VF+   D+I   +LR
Sbjct:    1 MGCFRNSLTEEERENTKKQKTTNKKIERQLKEDKIAYRATHRLLLLGAGESGKSTIVKQMRILHDVHGFTELEKRQKIEDIKKNIRDAILTITGAMSTLTPPVKLANPNNQFRLDYVHEVATAPDFDYP--PEFYEHTKILWQDAGVLECYERSNEYQLIDCAQYFLDRVDTIQQQDYLPTEQDLLRCRVLTSGIIETRFEVDRVKFHMFDVGGQRDERRKWIQCFNDVTAIIFVVACSSYNLVLREDASQNRLKESLELFKSIWNNRWLRTISVILFLNKQDLLKDKVRAGKSKIEDYFPDFARYRTPPDATAEPGDEEAVTRAKYFIRDEFLRISTASGDGKHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLR 375          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Medaka
Match: gnao1a (guanine nucleotide-binding protein G(o) subunit alpha [Source:NCBI gene;Acc:101167706])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 279/354 (78.81%), Postives = 311/354 (87.85%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER ALD+S+ I+K LKEDG+ AAKDVKLLLLGAGESGKSTIVKQMKIIHE GF+ +D KQYKPVVYSNT QS+ AI+RAM TLG+ +GD +R ADAK+V DV+  MEDTEPFS ELL AM RLW+D G+QECF R+ EYQLNDSA+Y+LD LDR+GA DY PTEQDILRTRVKTTGIVE HF FKN++F+LFDVGGQRSERKKWIHCFEDVTAIIFCVA+S YDQVLHEDETTNRM ESL LFDSICNNK+F  TSIILFLNKKDLF EKIKKS L++CFPEY G  TY++AAAYIQA FE+KN SPNKEIYCH TCATDT NIQ VFDAVTD+IIANNLRGCGLY
Sbjct:    1 MGCTLSAEERAALDRSKAIEKNLKEDGLTAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGDDVKQYKPVVYSNTIQSLAAIVRAMDTLGLDYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWSDSGLQECFSRAREYQLNDSAQYYLDSLDRIGATDYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFAEKIKKSALSICFPEYTGPNTYDDAAAYIQAQFESKNRSPNKEIYCHLTCATDTGNIQVVFDAVTDIIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Medaka
Match: gnao1b (G protein subunit alpha o1 [Source:NCBI gene;Acc:101166207])

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 283/354 (79.94%), Postives = 309/354 (87.29%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +ER ALD+S+ I+K LKEDGM AAKDVKLLLLG GESGKSTIVKQMKIIHE GF+ +D KQYKPVVYSNT QS+ AILRAM +LGI FGD DR ADAK+V DV+  MEDTEP+S ELL AMKRLWAD G QECF R+ EYQLNDSA+Y+LD LDR+GA DY PTEQDILRTRVKTTGIVE HF FKN++F+LFDVGGQRSERKKWIHCFEDVTAIIFCVA+S YDQVLHEDETTNRM ESL LFDSICNNK+F  TSIILFLNKKDLF EKIKKSPLT+CFPEY G  TY++A AYIQ  FE+KN SPNKEIYCH TCATDT NIQ VFDAVTD+IIANNLRGCGLY
Sbjct:    1 MGCTLSAEERAALDRSKAIEKNLKEDGMVAAKDVKLLLLGGGESGKSTIVKQMKIIHEDGFSGDDVKQYKPVVYSNTIQSLAAILRAMDSLGIEFGDKDRKADAKLVCDVVSRMEDTEPYSAELLAAMKRLWADAGTQECFNRAREYQLNDSAQYYLDSLDRIGAGDYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFAEKIKKSPLTICFPEYTGANTYDDATAYIQVQFESKNRSPNKEIYCHLTCATDTGNIQVVFDAVTDIIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Medaka
Match: gnao1b (G protein subunit alpha o1 [Source:NCBI gene;Acc:101166207])

HSP 1 Score: 514.612 bits (1324), Expect = 0.000e+0
Identity = 240/300 (80.00%), Postives = 261/300 (87.00%), Query Frame = 1
Query:  496 IIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            IIHE GF+ +D KQYKPVVYSNT QS+ AILRAM +LGI FGD DR ADAK+V DV+  MEDTEP+S ELL AMKRLWAD G QECF R+ EYQLNDSA+Y+LD LDR+GA DY PTEQDILRTRVKTTGIVE HF FKN++F+LFDVGGQRSERKKWIHCFEDVTAIIFCVA+S YDQVLHEDETTNRM ESL LFDSICNNK+F  TSIILFLNKKDLF EKIKKSPLT+CFPEY G  TY++A AYIQ  FE+KN SPNKEIYCH TCATDT NIQ VFDAVTD+IIANNLRGCGLY
Sbjct:    4 IIHEDGFSGDDVKQYKPVVYSNTIQSLAAILRAMDSLGIEFGDKDRKADAKLVCDVVSRMEDTEPYSAELLAAMKRLWADAGTQECFNRAREYQLNDSAQYYLDSLDRIGAGDYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFAEKIKKSPLTICFPEYTGANTYDDATAYIQVQFESKNRSPNKEIYCHLTCATDTGNIQVVFDAVTDIIIANNLRGCGLY 303          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000020087.2 (guanine nucleotide-binding protein G(i) subunit alpha-1 [Source:NCBI gene;Acc:101157265])

HSP 1 Score: 505.368 bits (1300), Expect = 3.509e-177
Identity = 239/355 (67.32%), Postives = 289/355 (81.41%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPN-KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S +++ A+++S+ ID+ L++DG +AA++VKLLLLGAGESGKSTIVKQMKIIHE G+++E+ KQYK VVYSNT QS+IAI+RAM  L I F D  R  DA+ +  V+    +    + EL   +KRLW+D GVQ CF RS EYQLNDSA Y+L+DLDR+   +Y+PT+QD+LRTRVKTTGIVE HF FK+++FK+FDVGGQRSERKKWIHCFE VTAIIFCVA+S+YD VL EDE  NRM ES+KLFDSICNNKWFT TSIILFLNKKDLF+EKIK+SPL++C+PEY G  TYEEAAAYIQ  FE  N   + KEIY H TCATDT N+QFVFDAVTDVII NNL+ CGL+
Sbjct:    1 MGCTLSTEDKAAVERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFKDSSRAEDARQLF-VLAGSAEEGSMTTELAGVIKRLWSDDGVQACFSRSREYQLNDSAAYYLNDLDRISQANYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLSICYPEYAGSNTYEEAAAYIQCQFEDLNKRRDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Medaka
Match: gnai3 (Gi1 alpha subunit [Source:NCBI gene;Acc:100144384])

HSP 1 Score: 504.212 bits (1297), Expect = 8.867e-177
Identity = 244/356 (68.54%), Postives = 287/356 (80.62%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPF-SEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPN-KEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCT+S D++ A ++S+ ID+ L++DG +AA++VKLLLLGAGESGKSTIVKQMKIIHE G+++E+ KQYK VVYSNT QS+IAI+RAM  L I F D  R  DA+ +   I A    E F + EL   ++RLW D GVQ CF RS EYQLNDSA Y+L+DLDR+    Y+PT+QD+LRTRVKTTGIVE HF FK+++FK+FDVGGQRSERKKWIHCFE VTAIIFCVA+S+YD VL EDE  NRM ES+KLFDSICNNKWFT TSIILFLNKKDLF+EKIKKSPLT+CFPEY G  TYEEAAAY+Q  FE  N   + KEIY H TCATDT N+QFVFDAVTDVII NNL+ CGL+
Sbjct:    1 MGCTLSTDDKAAQERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFADQARADDARQL--FILAGSTEEGFMTGELAGVIQRLWKDGGVQACFSRSREYQLNDSAAYYLNDLDRISHASYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYAGSNTYEEAAAYVQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Planmine SMEST
Match: SMESG000055191.1 (SMESG000055191.1)

HSP 1 Score: 741.11 bits (1912), Expect = 0.000e+0
Identity = 354/354 (100.00%), Postives = 354/354 (100.00%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY
Sbjct:    1 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Planmine SMEST
Match: SMESG000055191.1 (SMESG000055191.1)

HSP 1 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 350/350 (100.00%), Postives = 350/350 (100.00%), Query Frame = 1
Query:  346 MSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY
Sbjct:    1 MSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 350          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Planmine SMEST
Match: SMESG000026676.1 (SMESG000026676.1)

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 333/354 (94.07%), Postives = 341/354 (96.33%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGC +SKDER+ALDKSRNIDKKLKEDG+QAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFT EDNKQYKPVVYSNTTQSMIAILRAMTTL ISFGD DR ADAK+VSDVIQAMEDTEPFSEELLEA KRLWAD GVQECF RSNEYQLNDSAKYFLDD+DRLGA DYMPTEQDILRTR+KTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFT TSIILFLNKKDLF EKIK+SPLTVCF EY G+QTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY
Sbjct:    1 MGCALSKDEREALDKSRNIDKKLKEDGVQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTNEDNKQYKPVVYSNTTQSMIAILRAMTTLNISFGDPDRSADAKIVSDVIQAMEDTEPFSEELLEATKRLWADSGVQECFNRSNEYQLNDSAKYFLDDIDRLGAGDYMPTEQDILRTRIKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTQTSIILFLNKKDLFAEKIKRSPLTVCFSEYTGRQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Planmine SMEST
Match: SMESG000081487.1 (SMESG000081487.1)

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 248/354 (70.06%), Postives = 295/354 (83.33%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGC MS DER AL+KS++IDKKLKEDG+Q  +D+KLLLLGAGESGKSTI+KQMKIIHEGGF+  DN  YKP+VYSNT QS+ AILRAM  L ISF +  R AD  +V++++  M+D EPF+ +L  A+K LW+D GVQECF RSNEYQLNDSA+YFLD++DR+ A DY P++QDILRTR+KTTGIVE+ F FKNMNFK+FDVGGQRSERKKWIHCFEDVTAIIFCV++SEYDQVL ED+ TNRMQESL LF+SICNN WF  TS ILFLNKKDLF EK++  P+T CFPEY G Q Y+ + +YI+  F +KN   + EIYCH TCATDT+NIQFVFDAVTD+II+NN+RGCG Y
Sbjct:    1 MGCAMSLDERIALNKSKDIDKKLKEDGLQLQRDIKLLLLGAGESGKSTIMKQMKIIHEGGFSSTDNHHYKPIVYSNTIQSVAAILRAMHKLNISFENSAREADEILVNNIMTTMKDQEPFTPQLNSALKSLWSDIGVQECFRRSNEYQLNDSAQYFLDNVDRISAVDYKPSDQDILRTRIKTTGIVEIQFKFKNMNFKIFDVGGQRSERKKWIHCFEDVTAIIFCVSLSEYDQVLVEDDATNRMQESLFLFESICNNVWFLHTSFILFLNKKDLFLEKLQICPITFCFPEYKGPQEYDSSVSYIEQCFRSKNKDVSNEIYCHHTCATDTSNIQFVFDAVTDLIISNNMRGCGFY 354          
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Planmine SMEST
Match: SMESG000026774.1 (SMESG000026774.1)

HSP 1 Score: 455.677 bits (1171), Expect = 8.131e-158
Identity = 218/355 (61.41%), Postives = 271/355 (76.34%), Query Frame = 1
Query:  334 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSP-NKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 1395
            MGC  S  ++D  +K++ I+++L++D  +A K+VKLLLLGAGE GKSTI+KQM IIH  G+ +E+ K+Y P++Y+N  QSM+ IL AM TLGIS  +     ++K+V   ++  E+ E F +EL  A+  LW D  VQ C+ R+ EYQLNDSA Y+LD LDRL    Y+PTEQD+LR+RVKTTGIVE HF FK+++FK+FDVGGQRSERKKW+HCFE VTAI+F VAMSEYD  L ED +TNRM ES++LFDSICN++WF +TSIILFLNKKDLF EK+ KSPLTVCFPEY G   YEEA+AYIQ+ FE  N     K IY H TCATDTNNIQ VFDAV DVII NNL+ CGL+
Sbjct:    1 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGE-FPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 354          
The following BLAST results are available for this feature:
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GNAO10.000e+080.79G protein subunit alpha o1 [Source:HGNC Symbol;Acc... [more]
GNAO10.000e+080.79G protein subunit alpha o1 [Source:HGNC Symbol;Acc... [more]
GNAO10.000e+079.66G protein subunit alpha o1 [Source:HGNC Symbol;Acc... [more]
GNAI17.650e-17969.10G protein subunit alpha i1 [Source:HGNC Symbol;Acc... [more]
GNAI17.650e-17969.10G protein subunit alpha i1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
goa-10.000e+084.75Guanine nucleotide-binding protein G(o) subunit al... [more]
gpa-163.341e-15662.40Guanine nucleotide-binding protein alpha-16 subuni... [more]
gpa-71.861e-15560.06Guanine nucleotide-binding protein alpha-7 subunit... [more]
gpa-44.303e-15159.17Guanine nucleotide-binding protein alpha-4 subunit... [more]
gpa-37.354e-14255.24Guanine nucleotide-binding protein alpha-3 subunit... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Galphao0.000e+084.46gene:FBgn0001122 transcript:FBtr0088267[more]
Galphao0.000e+084.46gene:FBgn0001122 transcript:FBtr0088269[more]
Galphao0.000e+084.46gene:FBgn0001122 transcript:FBtr0088264[more]
Galphao0.000e+084.46gene:FBgn0001122 transcript:FBtr0088268[more]
Galphao0.000e+084.46gene:FBgn0001122 transcript:FBtr0088270[more]
back to top
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnao1a0.000e+078.81guanine nucleotide binding protein (G protein), al... [more]
gnao1a0.000e+077.12guanine nucleotide binding protein (G protein), al... [more]
gnao1b0.000e+077.97guanine nucleotide binding protein (G protein), al... [more]
gnao1b0.000e+077.97guanine nucleotide binding protein (G protein), al... [more]
gnao1b0.000e+073.45guanine nucleotide binding protein (G protein), al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnao10.000e+081.07G protein subunit alpha o1 [Source:NCBI gene;Acc:5... [more]
gnao10.000e+078.53G protein subunit alpha o1 [Source:NCBI gene;Acc:5... [more]
gnai12.866e-17969.10guanine nucleotide binding protein (G protein), al... [more]
gnai11.493e-17869.10guanine nucleotide binding protein (G protein), al... [more]
gnai22.742e-17666.20guanine nucleotide binding protein (G protein), al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gnao10.000e+079.94guanine nucleotide binding protein, alpha O [Sourc... [more]
Gnao10.000e+079.94guanine nucleotide binding protein, alpha O [Sourc... [more]
Gnao10.000e+077.97guanine nucleotide binding protein, alpha O [Sourc... [more]
Gnai15.252e-17969.10guanine nucleotide binding protein (G protein), al... [more]
Gnai36.805e-17767.89guanine nucleotide binding protein (G protein), al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P30683|GNAO_LYMST0.000e+087.01Guanine nucleotide-binding protein G(o) subunit al... [more]
sp|P51877|GNAO_PLATR0.000e+086.72Guanine nucleotide-binding protein G(o) subunit al... [more]
sp|O15976|GNAO_MIZYE0.000e+086.27Guanine nucleotide-binding protein G(o) subunit al... [more]
sp|P38404|GNAO_LOCMI0.000e+086.72Guanine nucleotide-binding protein G(o) subunit al... [more]
sp|P51875|GNAO_CAEEL0.000e+084.75Guanine nucleotide-binding protein G(o) subunit al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RQ130.000e+092.39Guanine nucleotide binding protein (G protein) alp... [more]
A0A3Q0KCR40.000e+092.11Putative trimeric G-protein alpha o subunit OS=Sch... [more]
A0A094ZCU20.000e+092.11Guanine nucleotide-binding protein G(O) subunit al... [more]
A0A4Z2CXN40.000e+092.11Guanine nucleotide-binding protein G(O) subunit al... [more]
A0A4S2L6S30.000e+091.55Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnao1a0.000e+079.10G protein subunit alpha o1 [Source:NCBI gene;Acc:1... [more]
gnao1a0.000e+078.25G protein subunit alpha o1 [Source:NCBI gene;Acc:1... [more]
gnaia4.099e-17567.04guanine nucleotide-binding protein G(i) subunit al... [more]
gnai2b1.792e-17465.92guanine nucleotide-binding protein G(i) subunit al... [more]
gnai2a1.524e-17065.92guanine nucleotide-binding protein G(i) subunit al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnai33.416e-17967.89guanine nucleotide binding protein (G protein), al... [more]
ENSPMAT00000004355.13.167e-15867.50pep scaffold:Pmarinus_7.0:GL477714:209323:228779:-... [more]
gnat25.873e-14458.53guanine nucleotide binding protein (G protein), al... [more]
ENSPMAT00000007354.16.625e-10850.16pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 g... [more]
ENSPMAT00000007349.14.831e-10749.38pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 g... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GPA24.721e-8942.64Nucleotide binding alpha subunit of the heterotrim... [more]
GPA11.165e-7949.80Subunit of the G protein involved in pheromone res... [more]
ARF34.214e-928.23Glucose-repressible ADP-ribosylation factor; GTPas... [more]
ARF16.658e-726.92ADP-ribosylation factor; GTPase of the Ras superfa... [more]
CIN42.219e-630.93GTP-binding protein involved in beta-tubulin (Tub2... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO496920.000e+070.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325402.681e-17867.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414654.441e-11549.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479938.738e-10144.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491935.296e-8843.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnao1a0.000e+078.81guanine nucleotide-binding protein G(o) subunit al... [more]
gnao1b0.000e+079.94G protein subunit alpha o1 [Source:NCBI gene;Acc:1... [more]
gnao1b0.000e+080.00G protein subunit alpha o1 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000020087.23.509e-17767.32guanine nucleotide-binding protein G(i) subunit al... [more]
gnai38.867e-17768.54Gi1 alpha subunit [Source:NCBI gene;Acc:100144384][more]
back to top
BLAST of Guanine nucleotide-binding protein G(O) subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055191.10.000e+0100.00SMESG000055191.1[more]
SMESG000055191.10.000e+0100.00SMESG000055191.1[more]
SMESG000026676.10.000e+094.07SMESG000026676.1[more]
SMESG000081487.10.000e+070.06SMESG000081487.1[more]
SMESG000026774.18.131e-15861.41SMESG000026774.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003275 ID=SMED30003275|Name=Guanine nucleotide-binding protein G(O) subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=1729bp
ATTTTCCTTGCCCACAATACACACACACAGCGCATCAAGTAACCACTGCT
CGAGTAGGAATTTTGTTGACACACTCACTAGTTACATACAATCAATTTCT
TTCTCGAATTCGACTGGATTGAAGTTTCATATTAATTTCTAATAAATTTG
TACGTGAAATTTTTAGATATTTTATGAATTGAATTTTCATATTCATATAG
TACCAAGCATTAATTTCTACTATTCGCTTTGTCTGTTACTACACTGTTTC
TACCCTGTTTTGCTTATCGACCTAGTTTTTGATTGTTTTTTATTTGAAAA
TATCGATTTAAATTCGAAATACAATCGTTCAAAATGGGCTGTACTATGTC
TAAAGATGAGCGGGATGCTCTTGATAAAAGCCGGAATATAGACAAGAAGC
TGAAAGAAGATGGAATGCAAGCAGCAAAGGATGTCAAATTGCTATTGTTG
GGTGCTGGTGAATCAGGCAAGAGCACAATCGTGAAACAAATGAAAATTAT
TCACGAGGGTGGTTTTACTCAGGAGGACAACAAACAATATAAACCAGTTG
TCTACAGCAATACAACACAGTCGATGATCGCAATTTTGAGGGCTATGACT
ACGCTAGGAATATCCTTTGGAGACATTGATAGAGGGGCGGATGCCAAAGT
CGTTAGCGATGTCATACAAGCAATGGAAGATACCGAACCCTTTTCAGAAG
AATTATTAGAAGCAATGAAACGTTTATGGGCAGATCCAGGTGTTCAAGAA
TGTTTTGGAAGGTCTAATGAATATCAATTGAACGATTCTGCTAAATATTT
CTTAGATGATCTCGATCGACTGGGAGCGAAAGACTATATGCCTACAGAAC
AAGATATTTTGCGGACAAGAGTCAAAACCACCGGAATAGTTGAAGTTCAT
TTCATGTTCAAAAACATGAACTTTAAGCTGTTTGATGTCGGTGGACAGCG
ATCGGAGAGAAAGAAATGGATTCATTGTTTTGAAGACGTAACGGCGATCA
TTTTCTGTGTTGCCATGAGCGAATATGATCAGGTTCTACACGAGGATGAA
ACGACTAATCGAATGCAAGAATCTTTGAAATTGTTCGATTCGATTTGCAA
TAATAAATGGTTCACAAGCACGAGCATCATTTTATTTTTGAATAAAAAAG
ATTTGTTTGATGAGAAAATTAAGAAAAGTCCACTGACAGTTTGTTTTCCC
GAATATCCAGGCAAACAGACCTACGAAGAAGCAGCTGCGTACATCCAGGC
GTCGTTTGAAGCGAAGAATAATTCACCAAATAAAGAAATTTATTGTCATC
AAACATGTGCAACAGATACCAATAACATCCAATTCGTGTTCGATGCCGTA
ACGGACGTGATCATTGCAAATAATCTACGTGGTTGTGGTCTCTATTAAGA
TATTAGAATCCTCAACTAGCTGGTTGAAAATATACAATTCAACCGATGAT
TATTTAGATTTTTATTAGCAAAAAAATAATTCTACCACTAACTGCTGCCG
TGTTGCTTTGAACGATAATGATAATGATAATATTATTAATAATATTAATA
TTACAATGGACCTGTTGGACTCTCACACAAACTGATTCTGTCCGCTTTGG
ATTCGTAATTGATATTTCTCAAATACTAGCTTTTTAATTATATGTATATC
GTTTATTTACAAATGGAAATAATGCATTTTCTAATTTGACATTTTCTCGT
TTTAAATATATTATTATTATTATTATTAT
back to top

protein sequence of SMED30003275-orf-1

>SMED30003275-orf-1 ID=SMED30003275-orf-1|Name=SMED30003275-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=355bp
MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIV
KQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDR
GADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLN
DSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLF
DVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKL
FDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEA
AAYIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRG
CGLY*
back to top
Aliases
The feature 'Guanine nucleotide-binding protein G(O) subunit alpha' has the following synonyms
Synonym
gna-o
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0019001guanyl nucleotide binding
GO:0003924GTPase activity
GO:0031683G-protein beta/gamma-subunit complex binding
GO:0004871signal transducer activity
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0007186G-protein coupled receptor signaling pathway
GO:0007188adenylate cyclase-modulating G-protein coupled receptor signaling pathway
Vocabulary: INTERPRO
TermDefinition
IPR001408Gprotein_alpha_I
IPR001019Gprotein_alpha_su
IPR011025GproteinA_insert
IPR027417P-loop_NTPase