Reticulon-like protein

Overview
NameReticulon-like protein
Smed IDSMED30003269
Length (bp)1903
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Reticulon-like protein (SMED30003269) t-SNE clustered cells

Violin plots show distribution of expression levels for Reticulon-like protein (SMED30003269) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Reticulon-like protein (SMED30003269) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Reticulon-like protein (SMED30003269) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003269

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30003269SMESG000068156.1 SMESG000064685.1 SMESG000010609.1 SMESG000076470.1 SMESG000073857.1 SMESG000062429.1 SMESG000058575.1 SMESG000053533.1 SMESG000026676.1 SMESG000020635.1 SMESG000015751.1 SMESG000005260.1 Contig258GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003269SMESG000007676.1 Contig258GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30003269SMESG000007676.1 dd_Smed_v4_1796_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30003269SMESG000007676.1 dd_Smed_v4_1796_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30003269SMESG000007676.1 dd_Smed_v4_1796_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003269SMESG000007676.1 dd_Smed_v4_1796_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003269SMESG000007676.1 dd_Smed_v4_1796_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30003269SMESG000007676.1 dd_Smed_v4_1796_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003269SMESG000007676.1 dd_Smed_v4_1796_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003269SMESG000007676.1 dd_Smed_v4_1796_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30003269SMESG000007676.1 dd_Smed_v4_1796_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Reticulon-like protein vs. Ensembl Human
Match: RTN1 (reticulon 1 [Source:HGNC Symbol;Acc:HGNC:10467])

HSP 1 Score: 74.7146 bits (182), Expect = 2.739e-13
Identity = 34/124 (27.42%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 1078 FNLVKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKF 1428
               V+K D+ +         I+++ + +Q   DC+  ++     E+R L  V     +LK     W+LTY+G  FN L+L+ M  + +F+LP++Y  ++  ID  L  VR  I   +   ++K 
Sbjct:  645 LQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKI 768          
BLAST of Reticulon-like protein vs. Ensembl Human
Match: RTN1 (reticulon 1 [Source:HGNC Symbol;Acc:HGNC:10467])

HSP 1 Score: 74.7146 bits (182), Expect = 2.744e-13
Identity = 34/124 (27.42%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 1078 FNLVKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKF 1428
               V+K D+ +         I+++ + +Q   DC+  ++     E+R L  V     +LK     W+LTY+G  FN L+L+ M  + +F+LP++Y  ++  ID  L  VR  I   +   ++K 
Sbjct:  571 LQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKI 694          
BLAST of Reticulon-like protein vs. Ensembl Human
Match: RTN4 (reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085])

HSP 1 Score: 73.9442 bits (180), Expect = 5.288e-13
Identity = 54/211 (25.59%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  829 DETKMEIFEAQMILDSVIISDNDICRKFKDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQI 1437
            D +   IF A++   SV+           D++ W+D   + VV    + + L L + +SI+S+ AY  L LL  +  +++       ++K D+ +         ++++ + VQ   +  L  +     E+R L  V     +LK     W+ TY+G  FN L+L+ +  I LFS+P+IY  ++  IDH L      +KD++   ++K   +
Sbjct:  783 DRSPSAIFSAELSKTSVV-----------DLLYWRDIKKTGVVFGASLFLLLSLTV-FSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGL 981          
BLAST of Reticulon-like protein vs. Ensembl Human
Match: RTN4 (reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085])

HSP 1 Score: 73.9442 bits (180), Expect = 5.288e-13
Identity = 54/211 (25.59%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  829 DETKMEIFEAQMILDSVIISDNDICRKFKDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQI 1437
            D +   IF A++   SV+           D++ W+D   + VV    + + L L + +SI+S+ AY  L LL  +  +++       ++K D+ +         ++++ + VQ   +  L  +     E+R L  V     +LK     W+ TY+G  FN L+L+ +  I LFS+P+IY  ++  IDH L      +KD++   ++K   +
Sbjct:  783 DRSPSAIFSAELSKTSVV-----------DLLYWRDIKKTGVVFGASLFLLLSLTV-FSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGL 981          
BLAST of Reticulon-like protein vs. Ensembl Human
Match: RTN4 (reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085])

HSP 1 Score: 73.9442 bits (180), Expect = 5.288e-13
Identity = 54/211 (25.59%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  829 DETKMEIFEAQMILDSVIISDNDICRKFKDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQI 1437
            D +   IF A++   SV+           D++ W+D   + VV    + + L L + +SI+S+ AY  L LL  +  +++       ++K D+ +         ++++ + VQ   +  L  +     E+R L  V     +LK     W+ TY+G  FN L+L+ +  I LFS+P+IY  ++  IDH L      +KD++   ++K   +
Sbjct:  783 DRSPSAIFSAELSKTSVV-----------DLLYWRDIKKTGVVFGASLFLLLSLTV-FSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGL 981          
BLAST of Reticulon-like protein vs. Ensembl Celegans
Match: ret-1 (Reticulon-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECZ2])

HSP 1 Score: 62.3882 bits (150), Expect = 9.198e-10
Identity = 37/145 (25.52%), Postives = 75/145 (51.72%), Query Frame = 1
Query: 1000 YSIISLMAYXXXXXXXXXXXYKVAVKFNL-VKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSIN 1410
            Y +++++ YS LL L ++  ++V  K    +KK D  +        ++++  + V    D  ++    + N+++ L +V S  +++K     W LTYI  WF+  +L  +G + +FS+P +Y + +  ID  L  + G +K+  N
Sbjct: 3133 YPLLTVVTYSLLLALGAAAGFRVFKKVEAQIKKTDSEHPFSEILAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIKFGLVLWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQN 3277          
BLAST of Reticulon-like protein vs. Ensembl Celegans
Match: ret-1 (Reticulon-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECZ2])

HSP 1 Score: 60.4622 bits (145), Expect = 2.631e-9
Identity = 37/145 (25.52%), Postives = 75/145 (51.72%), Query Frame = 1
Query: 1000 YSIISLMAYXXXXXXXXXXXYKVAVKFNL-VKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSIN 1410
            Y +++++ YS LL L ++  ++V  K    +KK D  +        ++++  + V    D  ++    + N+++ L +V S  +++K     W LTYI  WF+  +L  +G + +FS+P +Y + +  ID  L  + G +K+  N
Sbjct:  404 YPLLTVVTYSLLLALGAAAGFRVFKKVEAQIKKTDSEHPFSEILAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIKFGLVLWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQN 548          
BLAST of Reticulon-like protein vs. Ensembl Celegans
Match: ret-1 (Reticulon-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECZ2])

HSP 1 Score: 59.6918 bits (143), Expect = 3.757e-9
Identity = 37/145 (25.52%), Postives = 75/145 (51.72%), Query Frame = 1
Query: 1000 YSIISLMAYXXXXXXXXXXXYKVAVKFNL-VKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSIN 1410
            Y +++++ YS LL L ++  ++V  K    +KK D  +        ++++  + V    D  ++    + N+++ L +V S  +++K     W LTYI  WF+  +L  +G + +FS+P +Y + +  ID  L  + G +K+  N
Sbjct:  328 YPLLTVVTYSLLLALGAAAGFRVFKKVEAQIKKTDSEHPFSEILAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIKFGLVLWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQN 472          
BLAST of Reticulon-like protein vs. Ensembl Celegans
Match: ret-1 (Reticulon-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECZ2])

HSP 1 Score: 59.6918 bits (143), Expect = 3.757e-9
Identity = 37/145 (25.52%), Postives = 75/145 (51.72%), Query Frame = 1
Query: 1000 YSIISLMAYXXXXXXXXXXXYKVAVKFNL-VKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSIN 1410
            Y +++++ YS LL L ++  ++V  K    +KK D  +        ++++  + V    D  ++    + N+++ L +V S  +++K     W LTYI  WF+  +L  +G + +FS+P +Y + +  ID  L  + G +K+  N
Sbjct:  328 YPLLTVVTYSLLLALGAAAGFRVFKKVEAQIKKTDSEHPFSEILAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIKFGLVLWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQN 472          
BLAST of Reticulon-like protein vs. Ensembl Celegans
Match: ret-1 (Reticulon-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECZ2])

HSP 1 Score: 59.6918 bits (143), Expect = 3.757e-9
Identity = 37/145 (25.52%), Postives = 75/145 (51.72%), Query Frame = 1
Query: 1000 YSIISLMAYXXXXXXXXXXXYKVAVKFNL-VKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSIN 1410
            Y +++++ YS LL L ++  ++V  K    +KK D  +        ++++  + V    D  ++    + N+++ L +V S  +++K     W LTYI  WF+  +L  +G + +FS+P +Y + +  ID  L  + G +K+  N
Sbjct:  328 YPLLTVVTYSLLLALGAAAGFRVFKKVEAQIKKTDSEHPFSEILAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIKFGLVLWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQN 472          
BLAST of Reticulon-like protein vs. Ensembl Fly
Match: Rtnl1 (gene:FBgn0053113 transcript:FBtr0301538)

HSP 1 Score: 68.5514 bits (166), Expect = 1.073e-11
Identity = 41/146 (28.08%), Postives = 75/146 (51.37%), Query Frame = 1
Query:  982 LGLILDYSIISLMAYXXXXXXXXXXXYKVAVKF-NLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQI 1395
            L  I  +S+IS+ AY  LL LF +  +++       V+K ++ +        +++++ + VQ      +  I    +E+R L  V     ++K     W+ TY+G WFN ++L+ +  + LF+LP +Y   K +ID  LD VR ++
Sbjct:  434 LAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKL 579          
BLAST of Reticulon-like protein vs. Ensembl Fly
Match: Rtnl1 (gene:FBgn0053113 transcript:FBtr0079038)

HSP 1 Score: 68.5514 bits (166), Expect = 1.074e-11
Identity = 41/146 (28.08%), Postives = 75/146 (51.37%), Query Frame = 1
Query:  982 LGLILDYSIISLMAYXXXXXXXXXXXYKVAVKF-NLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQI 1395
            L  I  +S+IS+ AY  LL LF +  +++       V+K ++ +        +++++ + VQ      +  I    +E+R L  V     ++K     W+ TY+G WFN ++L+ +  + LF+LP +Y   K +ID  LD VR ++
Sbjct:  422 LAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKL 567          
BLAST of Reticulon-like protein vs. Ensembl Fly
Match: Rtnl1 (gene:FBgn0053113 transcript:FBtr0079042)

HSP 1 Score: 62.7734 bits (151), Expect = 8.829e-11
Identity = 41/148 (27.70%), Postives = 76/148 (51.35%), Query Frame = 1
Query:  982 LGLILDYSIISLMAYXXXXXXXXXXXYKVAVKFN-LVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKD 1401
            L  I  +S+IS+ AY  LL LF +  +++       V+K ++ +        +++++ + VQ      +  I    +E+R L  V     ++K     W+ TY+G WFN ++L+ +  + LF+LP +Y   K +ID  LD VR ++ +
Sbjct:   49 LAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKLTE 196          
BLAST of Reticulon-like protein vs. Ensembl Fly
Match: Rtnl1 (gene:FBgn0053113 transcript:FBtr0079044)

HSP 1 Score: 62.3882 bits (150), Expect = 1.325e-10
Identity = 41/148 (27.70%), Postives = 76/148 (51.35%), Query Frame = 1
Query:  982 LGLILDYSIISLMAYXXXXXXXXXXXYKVAVKFN-LVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKD 1401
            L  I  +S+IS+ AY  LL LF +  +++       V+K ++ +        +++++ + VQ      +  I    +E+R L  V     ++K     W+ TY+G WFN ++L+ +  + LF+LP +Y   K +ID  LD VR ++ +
Sbjct:   51 LAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKLTE 198          
BLAST of Reticulon-like protein vs. Ensembl Fly
Match: Rtnl1 (gene:FBgn0053113 transcript:FBtr0079041)

HSP 1 Score: 62.3882 bits (150), Expect = 1.325e-10
Identity = 41/148 (27.70%), Postives = 76/148 (51.35%), Query Frame = 1
Query:  982 LGLILDYSIISLMAYXXXXXXXXXXXYKVAVKFN-LVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKD 1401
            L  I  +S+IS+ AY  LL LF +  +++       V+K ++ +        +++++ + VQ      +  I    +E+R L  V     ++K     W+ TY+G WFN ++L+ +  + LF+LP +Y   K +ID  LD VR ++ +
Sbjct:   51 LAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKLTE 198          
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Match: rtn1a (reticulon 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2426])

HSP 1 Score: 77.7962 bits (190), Expect = 5.725e-15
Identity = 52/182 (28.57%), Postives = 94/182 (51.65%), Query Frame = 1
Query:  904 RKFKDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            +K  D+V W+D   S +V   ++++   L   +S++S++AY  L +L ++  ++V       V+K D+ +         IS+++D +   VD    +I     E+R L  V     ++K     W+LTY+G  FN L+L+ +  I +FS+P++Y  Y+T ID  L  VR Q+   +   + K
Sbjct:  165 QKVVDLVHWRDLKQSGLVFGSVLLLLFSLT-QFSVVSVIAYLALAVLSATISFRVYKSVLQAVQKTDEGHPFKSYLEVEISLSADQISKYVDKTQLYINTTMKELRRLFLVQDLVDSIKFAVLMWLLTYVGALFNGLTLLILAVISMFSVPVVYEKYQTQIDQYLGLVRTQVNSVMGKIREK 345          
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Match: rtn1a (reticulon 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2426])

HSP 1 Score: 78.1814 bits (191), Expect = 1.432e-14
Identity = 44/153 (28.76%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  991 ILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            +  +S++S++AY  L +L ++  ++V       V+K D+ +         IS+++D +   VD    +I     E+R L  V     ++K     W+LTY+G  FN L+L+ +  I +FS+P++Y  Y+T ID  L  VR Q+   +   + K
Sbjct:  658 LTQFSVVSVIAYLALAVLSATISFRVYKSVLQAVQKTDEGHPFKSYLEVEISLSADQISKYVDKTQLYINTTMKELRRLFLVQDLVDSIKFAVLMWLLTYVGALFNGLTLLILAVISMFSVPVVYEKYQTQIDQYLGLVRTQVNSVMGKIREK 810          
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Match: rtn1a (reticulon 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2426])

HSP 1 Score: 72.0182 bits (175), Expect = 5.271e-14
Identity = 51/178 (28.65%), Postives = 92/178 (51.69%), Query Frame = 1
Query:  916 DIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            D+V W+D   S +V   ++++   L   +S++S++AY  L +L ++  ++V       V+K D+ +         IS+++D +   VD    +I     E+R L  V     ++K     W+LTY+G  FN L+L+ +  I +FS+P++Y  Y+T ID  L  VR Q+   +   + K
Sbjct:    7 DLVHWRDLKQSGLVFGSVLLLLFSLT-QFSVVSVIAYLALAVLSATISFRVYKSVLQAVQKTDEGHPFKSYLEVEISLSADQISKYVDKTQLYINTTMKELRRLFLVQDLVDSIKFAVLMWLLTYVGALFNGLTLLILAVISMFSVPVVYEKYQTQIDQYLGLVRTQVNSVMGKIREK 183          
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Match: rtn1a (reticulon 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2426])

HSP 1 Score: 71.633 bits (174), Expect = 7.305e-14
Identity = 51/178 (28.65%), Postives = 92/178 (51.69%), Query Frame = 1
Query:  916 DIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            D+V W+D   S +V   ++++   L   +S++S++AY  L +L ++  ++V       V+K D+ +         IS+++D +   VD    +I     E+R L  V     ++K     W+LTY+G  FN L+L+ +  I +FS+P++Y  Y+T ID  L  VR Q+   +   + K
Sbjct:   19 DLVHWRDLKQSGLVFGSVLLLLFSLT-QFSVVSVIAYLALAVLSATISFRVYKSVLQAVQKTDEGHPFKSYLEVEISLSADQISKYVDKTQLYINTTMKELRRLFLVQDLVDSIKFAVLMWLLTYVGALFNGLTLLILAVISMFSVPVVYEKYQTQIDQYLGLVRTQVNSVMGKIREK 195          
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Match: rtn1b (reticulon 1b [Source:ZFIN;Acc:ZDB-GENE-030710-3])

HSP 1 Score: 75.8702 bits (185), Expect = 7.948e-14
Identity = 42/153 (27.45%), Postives = 78/153 (50.98%), Query Frame = 1
Query:  991 ILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            +  +S++S++AY  L  L ++  ++V       V+K D+ +         +S++ D +Q   + V  +I     E+R L  V     +LK     W+LTY+G  FN L+L+ M  + +FS+P++Y  Y+  ID  +D +R Q+   +   + K
Sbjct:  606 LTQFSVVSVVAYLALASLSATISFRVYKSVLQAVQKTDEGHPFKVYLDVEMSLSHDQMQKYAENVQYYINSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLIMVVVCMFSMPVVYEKYQAQIDQYVDLIRTQVNSVVAKIQEK 758          
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Match: ENSXETT00000024406.1 (reticulon 3 [Source:NCBI gene;Acc:549516])

HSP 1 Score: 82.0333 bits (201), Expect = 1.104e-15
Identity = 62/213 (29.11%), Postives = 104/213 (48.83%), Query Frame = 1
Query:  838 KMEIFEAQMILDSVIISDNDICR-KFKDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQILGRR 1449
            KME+ +    L  V  S  DI   K +D++ W+D   S +V    MV+ L L   +SIIS+++Y  L LL  +  Y+V       V+K D+ +        +I+++SD  Q  +   L  + +    I  L  V     +LK     W++TY+G  FN ++L+ +G ++ F+ PI+Y  YK  IDH +  V   +K      ++K    L ++
Sbjct:  386 KMEVLQTYHKLPQVTDSPVDIATLKVQDLLYWRDVKQSGMVFGGTMVLLLSLAA-FSIISVISYLVLSLLAVTISYRVYKSVLQAVQKTDEGHPFKPLLEKDIALSSDAFQKALSTSLAHVNHALKYIVRLFLVEDLVDSLKLALLMWLMTYVGAVFNGITLLILGVLLAFTAPIVYEKYKVQIDHYVSLVHSHVKSITEKIQAKLPGALKKK 597          
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Match: pou2af1 (POU class 2 homeobox associating factor 1 [Source:Xenbase;Acc:XB-GENE-854772])

HSP 1 Score: 75.485 bits (184), Expect = 1.710e-13
Identity = 36/123 (29.27%), Postives = 61/123 (49.59%), Query Frame = 1
Query: 1078 FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
               V+K D+ +         IS++ + +Q   DC+  +   +  E+R L  V     +LK     W+LTY+G  FN L+L+ M  + +FSLP++Y  Y+  ID  L  VR  +   +   ++K
Sbjct:  634 LQAVQKTDEGHPFKSYLDMEISLSQEQIQKYTDCLQAYTNSIVKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLIMAVVSMFSLPVVYDKYQAQIDQYLGLVRTNMNTIVTKIQAK 756          
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Match: trpc2 (transient receptor potential cation channel subfamily C member 2 (pseudogene) [Source:Xenbase;Acc:XB-GENE-6258978])

HSP 1 Score: 71.633 bits (174), Expect = 7.279e-13
Identity = 61/228 (26.75%), Postives = 103/228 (45.18%), Query Frame = 1
Query:  745 VPQNKEVPEYKMEEMEDVRKCDKTFIETDETKMEIFEAQMILDSVIISDNDICRKFKDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDS 1404
             P +  VP   MEE E   +    + +   +    F AQ +   V+           D+V W+D +  S  +    +  L  +  +SI+S++AY  L LL  S  +++       ++K D+ +        N++V  D VQ   +  L  +     E+R L  V     +LK     W+ TYIG  FN L+L+ +  I LFS+P+IY  ++T +DH L  +   +K +
Sbjct:   97 APHSPAVPSAPMEEPE---RPAAPYRDPSGSVAYTFLAQRLPKEVV-----------DLVYWRD-IKKSGAVFGASLFLLLSLSVFSIVSVLAYIALALLSVSISFRIYRGVLQAIQKSDEGHPFRSILESNLAVPEDLVQKYCNVALNHVNCTVKELRRLFLVEDLVDSLKFAVLMWVFTYIGALFNGLTLLILALISLFSIPVIYERHQTQVDHYLALINKNVKST 309          
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Match: ENSXETT00000037176.1 (reticulon 3 [Source:NCBI gene;Acc:549516])

HSP 1 Score: 69.707 bits (169), Expect = 8.753e-13
Identity = 53/187 (28.34%), Postives = 93/187 (49.73%), Query Frame = 1
Query:  913 KDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQILGRR 1449
            +D++ W+D   S +V    MV+ L L   +SIIS+++Y  L LL  +  Y+V       V+K D+ +        +I+++SD  Q  +   L  + +    I  L  V     +LK     W++TY+G  FN ++L+ +G ++ F+ PI+Y  YK  IDH +  V   +K      ++K    L ++
Sbjct:   45 QDLLYWRDVKQSGMVFGGTMVLLLSLA-AFSIISVISYLVLSLLAVTISYRVYKSVLQAVQKTDEGHPFKPLLEKDIALSSDAFQKALSTSLAHVNHALKYIVRLFLVEDLVDSLKLALLMWLMTYVGAVFNGITLLILGVLLAFTAPIVYEKYKVQIDHYVSLVHSHVKSITEKIQAKLPGALKKK 230          
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Match: trpc2 (transient receptor potential cation channel subfamily C member 2 (pseudogene) [Source:Xenbase;Acc:XB-GENE-6258978])

HSP 1 Score: 72.4034 bits (176), Expect = 1.570e-12
Identity = 43/141 (30.50%), Postives = 71/141 (50.35%), Query Frame = 1
Query: 1006 IISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDS 1404
            I+S++AY  L LL  S  +++       ++K D+ +        N++V  D VQ   +  L  +     E+R L  V     +LK     W+ TYIG  FN L+L+ +  I LFS+P+IY  ++T +DH L  +   +K +
Sbjct:  895 IVSVLAYIALALLSVSISFRIYRGVLQAIQKSDEGHPFRSILESNLAVPEDLVQKYCNVALNHVNCTVKELRRLFLVEDLVDSLKFAVLMWVFTYIGALFNGLTLLILALISLFSIPVIYERHQTQVDHYLALINKNVKST 1035          
BLAST of Reticulon-like protein vs. Ensembl Mouse
Match: Rtn1 (reticulon 1 [Source:MGI Symbol;Acc:MGI:1933947])

HSP 1 Score: 74.7146 bits (182), Expect = 2.093e-13
Identity = 33/124 (26.61%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 1078 FNLVKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKF 1428
               V+K D+ +         I+++ + +Q   DC+  ++     E+R L  V     +LK     W+LTY+G  FN L+L+ M  + +F+LP++Y  ++  +D  L  VR  I   +   ++K 
Sbjct:  649 LQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQLYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQVDQYLGLVRTHINTVVAKIQAKI 772          
BLAST of Reticulon-like protein vs. Ensembl Mouse
Match: Rtn4 (reticulon 4 [Source:MGI Symbol;Acc:MGI:1915835])

HSP 1 Score: 72.7886 bits (177), Expect = 9.603e-13
Identity = 41/154 (26.62%), Postives = 76/154 (49.35%), Query Frame = 1
Query: 1000 YSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQI 1437
            +SI+S+ AY  L LL  +  +++       ++K D+ +         ++++ + VQ   +  L  +     E+R L  V     +LK     W+ TY+G  FN L+L+ +  I LFS+P+IY  ++  IDH L      +KD++   ++K   +
Sbjct: 1004 FSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAKIQAKIPGL 1157          
BLAST of Reticulon-like protein vs. Ensembl Mouse
Match: Rtn4 (reticulon 4 [Source:MGI Symbol;Acc:MGI:1915835])

HSP 1 Score: 72.4034 bits (176), Expect = 1.316e-12
Identity = 41/154 (26.62%), Postives = 76/154 (49.35%), Query Frame = 1
Query: 1000 YSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQI 1437
            +SI+S+ AY  L LL  +  +++       ++K D+ +         ++++ + VQ   +  L  +     E+R L  V     +LK     W+ TY+G  FN L+L+ +  I LFS+P+IY  ++  IDH L      +KD++   ++K   +
Sbjct:  888 FSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAKIQAKIPGL 1041          
BLAST of Reticulon-like protein vs. Ensembl Mouse
Match: Rtn1 (reticulon 1 [Source:MGI Symbol;Acc:MGI:1933947])

HSP 1 Score: 68.5514 bits (166), Expect = 2.123e-12
Identity = 30/103 (29.13%), Postives = 55/103 (53.40%), Query Frame = 1
Query: 1117 ISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            I+++ + +Q   DC+  ++     E+R L  V     +LK     W+LTY+G  FN L+L+ M  + +F+LP++Y  ++  +D  L  VR  I   +   ++K
Sbjct:  142 ITLSQEQIQKYTDCLQLYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQVDQYLGLVRTHINTVVAKIQAK 244          
BLAST of Reticulon-like protein vs. Ensembl Mouse
Match: Rtn1 (reticulon 1 [Source:MGI Symbol;Acc:MGI:1933947])

HSP 1 Score: 67.0106 bits (162), Expect = 3.387e-12
Identity = 30/103 (29.13%), Postives = 55/103 (53.40%), Query Frame = 1
Query: 1117 ISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            I+++ + +Q   DC+  ++     E+R L  V     +LK     W+LTY+G  FN L+L+ M  + +F+LP++Y  ++  +D  L  VR  I   +   ++K
Sbjct:   97 ITLSQEQIQKYTDCLQLYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQVDQYLGLVRTHINTVVAKIQAK 199          
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Match: sp|Q5J6M8|RTN3A_XENLA (Reticulon-3-A OS=Xenopus laevis OX=8355 GN=rtn3-a PE=2 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 8.137e-13
Identity = 54/187 (28.88%), Postives = 94/187 (50.27%), Query Frame = 1
Query:  913 KDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQILGRR 1449
            +D++ W+D   S +V    MV+ L L   +SIIS+++Y  L LL  +  Y+V       V+K D+ +        +I+++SD  Q  +   L  + +    I  L  V     +LK     W++TY+G  FN ++L+ +G ++ F+ PI+Y  YK  IDH +  V  Q+K      ++K    L ++
Sbjct:   27 RDLLYWRDVKQSGMVFGGTMVLLLSLA-AFSIISVISYLVLSLLTVTISYRVYKSVLQAVQKTDEGHPFKPLLEKDITLSSDSFQKALTASLAHVNHALKYIVRLFLVDDLVDSLKLALLMWLMTYVGAVFNGITLLILGVLLTFTAPIVYEKYKVQIDHYVSLVHSQVKSITEKIQAKLPGALKKK 212          
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Match: sp|A7MC64|RTN1_XENTR (Reticulon-1 OS=Xenopus tropicalis OX=8364 GN=rtn1 PE=2 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 8.754e-13
Identity = 36/123 (29.27%), Postives = 61/123 (49.59%), Query Frame = 1
Query: 1078 FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
               V+K D+ +         IS++ + +Q   DC+  +   +  E+R L  V     +LK     W+LTY+G  FN L+L+ M  + +FSLP++Y  Y+  ID  L  VR  +   +   ++K
Sbjct:  634 LQAVQKTDEGHPFKSYLDMEISLSQEQIQKYTDCLQAYTNSIVKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLIMAVVSMFSLPVVYDKYQAQIDQYLGLVRTNMNTIVTKIQAK 756          
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Match: sp|Q5IS59|RTN1_PANTR (Reticulon-1 OS=Pan troglodytes OX=9598 GN=RTN1 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.238e-12
Identity = 34/124 (27.42%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 1078 FNLVKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKF 1428
               V+K D+ +         I+++ + +Q   DC+  ++     E+R L  V     +LK     W+LTY+G  FN L+L+ M  + +F+LP++Y  ++  ID  L  VR  I   +   ++K 
Sbjct:  645 LQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKI 768          
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Match: sp|Q16799|RTN1_HUMAN (Reticulon-1 OS=Homo sapiens OX=9606 GN=RTN1 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.316e-12
Identity = 34/124 (27.42%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 1078 FNLVKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKF 1428
               V+K D+ +         I+++ + +Q   DC+  ++     E+R L  V     +LK     W+LTY+G  FN L+L+ M  + +F+LP++Y  ++  ID  L  VR  I   +   ++K 
Sbjct:  645 LQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKI 768          
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Match: sp|Q8K0T0|RTN1_MOUSE (Reticulon-1 OS=Mus musculus OX=10090 GN=Rtn1 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.464e-12
Identity = 33/124 (26.61%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 1078 FNLVKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKF 1428
               V+K D+ +         I+++ + +Q   DC+  ++     E+R L  V     +LK     W+LTY+G  FN L+L+ M  + +F+LP++Y  ++  +D  L  VR  I   +   ++K 
Sbjct:  649 LQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQLYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQVDQYLGLVRTHINTVVAKIQAKI 772          
BLAST of Reticulon-like protein vs. TrEMBL
Match: A0A224YQ66 (Reticulon-like protein OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.660e-15
Identity = 57/181 (31.49%), Postives = 95/181 (52.49%), Query Frame = 1
Query:  907 KFKDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            + +++V W+ P  S +V  +++ + L L   +S+IS++AY  L  L  +  ++V       V+K  + +        ++S+  D V   VD V+K ++     +RSL  V     +LK    FW+LTY+G WFN ++LI +  +  F+LP +Y TYKT ID  L   R  + + I   KSK
Sbjct:   25 QLEELVYWRQPKKSGLVFGLVLAVLLSLTC-FSLISVVAYLALGSLMVAIAFRVYRNVLQAVQKSSEGHPFKEYLEKDLSLPKDRVHETVDVVIKHVDATVARLRSLFLVEDLVDSLKLALLFWVLTYVGSWFNGMTLIILAYVSAFTLPKVYETYKTEIDQYLGLARTHVGNVIGTIKSK 204          
BLAST of Reticulon-like protein vs. TrEMBL
Match: A0A131Z673 (Reticulon-like protein OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.791e-15
Identity = 57/181 (31.49%), Postives = 95/181 (52.49%), Query Frame = 1
Query:  907 KFKDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            + +++V W+ P  S +V  +++ + L L   +S+IS++AY  L  L  +  ++V       V+K  + +        ++S+  D V   VD V+K ++     +RSL  V     +LK    FW+LTY+G WFN ++LI +  +  F+LP +Y TYKT ID  L   R  + + I   KSK
Sbjct:   25 QLEELVYWRQPKKSGLVFGLVLAVLLSLTC-FSLISVVAYLALGSLMVAIAFRVYRNVLQAVQKSSEGHPFKEYLEKDLSLPKDRVHETVDVVIKHVDATVARLRSLFLVEDLVDSLKLALLFWVLTYVGSWFNGMTLIILAYVSAFTLPKVYETYKTEIDQYLGLARTHVGNVIGTIKSK 204          
BLAST of Reticulon-like protein vs. TrEMBL
Match: A0A224YGN4 (Reticulon-like protein OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.306e-15
Identity = 58/184 (31.52%), Postives = 95/184 (51.63%), Query Frame = 1
Query:  898 ICRKFKDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            I    +++V W+ P  S +V  +++ + L L   +S+IS++AY  L  L  +  ++V       V+K  + +        ++S+  D V   VD V+K ++     +RSL  V     +LK    FW+LTY+G WFN ++LI +  +  F+LP +Y TYKT ID  L   R  + + I   KSK
Sbjct:  200 IFSPVEELVYWRQPKKSGLVFGLVLAVLLSLTC-FSLISVVAYLALGSLMVAIAFRVYRNVLQAVQKSSEGHPFKEYLEKDLSLPKDRVHETVDVVIKHVDATVARLRSLFLVEDLVDSLKLALLFWVLTYVGSWFNGMTLIILAYVSAFTLPKVYETYKTEIDQYLGLARTHVGNVIGTIKSK 382          
BLAST of Reticulon-like protein vs. TrEMBL
Match: A0A224YEL3 (Reticulon-like protein OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.191e-15
Identity = 57/181 (31.49%), Postives = 95/181 (52.49%), Query Frame = 1
Query:  907 KFKDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            + +++V W+ P  S +V  +++ + L L   +S+IS++AY  L  L  +  ++V       V+K  + +        ++S+  D V   VD V+K ++     +RSL  V     +LK    FW+LTY+G WFN ++LI +  +  F+LP +Y TYKT ID  L   R  + + I   KSK
Sbjct:   30 QVEELVYWRQPKKSGLVFGLVLAVLLSLTC-FSLISVVAYLALGSLMVAIAFRVYRNVLQAVQKSSEGHPFKEYLEKDLSLPKDRVHETVDVVIKHVDATVARLRSLFLVEDLVDSLKLALLFWVLTYVGSWFNGMTLIILAYVSAFTLPKVYETYKTEIDQYLGLARTHVGNVIGTIKSK 209          
BLAST of Reticulon-like protein vs. TrEMBL
Match: A0A131Z2K8 (Reticulon-like protein OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.191e-15
Identity = 57/181 (31.49%), Postives = 95/181 (52.49%), Query Frame = 1
Query:  907 KFKDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSNC-------NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            + +++V W+ P  S +V  +++ + L L   +S+IS++AY  L  L  +  ++V       V+K  + +        ++S+  D V   VD V+K ++     +RSL  V     +LK    FW+LTY+G WFN ++LI +  +  F+LP +Y TYKT ID  L   R  + + I   KSK
Sbjct:   30 QVEELVYWRQPKKSGLVFGLVLAVLLSLTC-FSLISVVAYLALGSLMVAIAFRVYRNVLQAVQKSSEGHPFKEYLEKDLSLPKDRVHETVDVVIKHVDATVARLRSLFLVEDLVDSLKLALLFWVLTYVGSWFNGMTLIILAYVSAFTLPKVYETYKTEIDQYLGLARTHVGNVIGTIKSK 209          
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Match: rtn1a (reticulon 1 [Source:NCBI gene;Acc:103026308])

HSP 1 Score: 77.0258 bits (188), Expect = 2.858e-14
Identity = 41/153 (26.80%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  991 ILDYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            +  +S++S++AY  L  L ++  ++V       V+K D+ +         I+++ + +   VD V  ++ Y   E+R L  V     ++K     W+LTY+G  FN L+L+ +  + +FS+P++Y  Y+T ID  +  VR Q+   +   + K
Sbjct:  636 LTQFSVVSVVAYLALATLSATISFRVYKSVLQAVQKTDEGHPFKAYLEVEIAMSPEQISKYVDKVQLYVNYTLKELRRLFLVQDLVDSIKFAVLMWLLTYVGALFNGLTLLILAVVSMFSMPLVYEKYQTQIDQYVGLVRTQVNTIMGKIREK 788          
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Match: rtn1a (reticulon 1 [Source:NCBI gene;Acc:103026308])

HSP 1 Score: 71.2478 bits (173), Expect = 9.062e-14
Identity = 41/151 (27.15%), Postives = 78/151 (51.66%), Query Frame = 1
Query:  997 DYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
             +S++S++AY  L  L ++  ++V       V+K D+ +         I+++ + +   VD V  ++ Y   E+R L  V     ++K     W+LTY+G  FN L+L+ +  + +FS+P++Y  Y+T ID  +  VR Q+   +   + K
Sbjct:   45 QFSVVSVVAYLALATLSATISFRVYKSVLQAVQKTDEGHPFKAYLEVEIAMSPEQISKYVDKVQLYVNYTLKELRRLFLVQDLVDSIKFAVLMWLLTYVGALFNGLTLLILAVVSMFSMPLVYEKYQTQIDQYVGLVRTQVNTIMGKIREK 195          
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Match: rtn1b (reticulon-1-A-like [Source:NCBI gene;Acc:103036511])

HSP 1 Score: 75.485 bits (184), Expect = 9.800e-14
Identity = 38/126 (30.16%), Postives = 63/126 (50.00%), Query Frame = 1
Query: 1078 FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQ 1434
               V+K D+ +         IS++ D +Q   + V ++I     E+R L  V     +LK     W+LTY+G  FN L+L+ M  + +FS+P++Y  Y+  ID  L    G +K  +N+   K Q+
Sbjct:  640 LQAVQKTDEGHPFKSYLEVEISLSHDQMQRYAENVQRYINSTMRELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLIMAVVSMFSMPVVYEKYQAQIDQYL----GLVKTHVNSVVGKIQE 761          
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Match: rtn1a (reticulon 1 [Source:NCBI gene;Acc:103026308])

HSP 1 Score: 71.2478 bits (173), Expect = 1.065e-13
Identity = 41/151 (27.15%), Postives = 78/151 (51.66%), Query Frame = 1
Query:  997 DYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
             +S++S++AY  L  L ++  ++V       V+K D+ +         I+++ + +   VD V  ++ Y   E+R L  V     ++K     W+LTY+G  FN L+L+ +  + +FS+P++Y  Y+T ID  +  VR Q+   +   + K
Sbjct:   50 QFSVVSVVAYLALATLSATISFRVYKSVLQAVQKTDEGHPFKAYLEVEIAMSPEQISKYVDKVQLYVNYTLKELRRLFLVQDLVDSIKFAVLMWLLTYVGALFNGLTLLILAVVSMFSMPLVYEKYQTQIDQYVGLVRTQVNTIMGKIREK 200          
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Match: rtn1b (reticulon-1-A-like [Source:NCBI gene;Acc:103036511])

HSP 1 Score: 68.1662 bits (165), Expect = 1.129e-12
Identity = 38/123 (30.89%), Postives = 63/123 (51.22%), Query Frame = 1
Query: 1087 VKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQ 1434
            V+K D+ +         IS++ D +Q   + V ++I     E+R L  V     +LK     W+LTY+G  FN L+L+ M  + +FS+P++Y  Y+  ID  L    G +K  +N+   K Q+
Sbjct:   84 VQKTDEGHPFKSYLEVEISLSHDQMQRYAENVQRYINSTMRELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLIMAVVSMFSMPVVYEKYQAQIDQYL----GLVKTHVNSVVGKIQE 202          
BLAST of Reticulon-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007319.1 (pep scaffold:Pmarinus_7.0:GL490398:662:6495:-1 gene:ENSPMAG00000006605.1 transcript:ENSPMAT00000007319.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 2.121e-12
Identity = 33/99 (33.33%), Postives = 51/99 (51.52%), Query Frame = 1
Query: 1111 CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSI 1407
            C++ V+   V+  +D  L     +  E+R L  V     +LK     W+LTYIG  FN L+L+ +G + LF+ P++Y  Y+  IDH L   R  +   I
Sbjct:   78 CDLGVSQATVETHLDVALARFNAVVRELRRLFLVEDLVDSLKFAVLMWLLTYIGAIFNGLTLLILGVLTLFTAPVVYEKYQKQIDHYLALARSNLNGVI 176          
BLAST of Reticulon-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006786.1 (pep scaffold:Pmarinus_7.0:GL481818:2303:8766:1 gene:ENSPMAG00000006114.1 transcript:ENSPMAT00000006786.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 5.464e-10
Identity = 35/150 (23.33%), Postives = 73/150 (48.67%), Query Frame = 1
Query:  997 DYSIISLMAYXXXXXXXXXXXYKVAVK-FNLVKKCDQSN-------CNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKS 1422
             +S++S++AY  L +L  +  Y+V       V+K +  +        +++++ +  Q  VD  L  +      +R L  V     ++K     W+LTY+G  FN L+++ +  I  F++P++Y  Y+  ID  +  VR  + + +   ++
Sbjct:   38 QFSVVSVLAYLTLAVLSVTISYRVYKSVLQAVQKTEDGHPFREYLDADLAMSPETAQKYVDTALSHVNCQLRHLRRLFLVHDLVDSIKFAVVLWLLTYVGALFNGLTIVILALIGAFTVPMVYEKYQVQIDQQVGMVRKHVGEVVEKVQA 187          
BLAST of Reticulon-like protein vs. Ensembl Nematostella
Match: EDO30766 (Reticulon-like protein [Source:UniProtKB/TrEMBL;Acc:A7SZV0])

HSP 1 Score: 52.373 bits (124), Expect = 7.052e-8
Identity = 25/81 (30.86%), Postives = 42/81 (51.85%), Query Frame = 1
Query: 1171 IEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINN 1413
            I  L   +R L  V     ++K     W+L+Y+G WF++L+LI    +++FSLP +Y  Y+  ID  +  +  Q+   I  
Sbjct:   97 INCLTKSLRRLFLVEDIVDSIKFGVMLWVLSYVGAWFSMLTLIIFAVVMVFSLPKVYEEYQDKIDEHVKVIHSQVSTIIEQ 177          
BLAST of Reticulon-like protein vs. Ensembl Nematostella
Match: EDO36076 (Reticulon-like protein [Source:UniProtKB/TrEMBL;Acc:A7SJN6])

HSP 1 Score: 46.9802 bits (110), Expect = 5.926e-6
Identity = 26/103 (25.24%), Postives = 52/103 (50.49%), Query Frame = 1
Query: 1114 NISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKS 1422
            +I+V+ D   L  +    +I      +R L  V     ++K     +IL+Y+ QWF+ ++L F+G I LF++P  Y  Y+  I+  +  ++  + D ++   +
Sbjct:   79 DINVSKDRADLIGERAAGYIVDSTVSVRRLFLVEDLADSIKLLVVLYILSYLAQWFSGITLTFIGFIGLFTVPKAYDMYREEINSAMSTIKVAVDDLLDKINA 181          
BLAST of Reticulon-like protein vs. Ensembl Medaka
Match: rtn4a (reticulon-4 [Source:NCBI gene;Acc:101163104])

HSP 1 Score: 66.2402 bits (160), Expect = 4.328e-12
Identity = 32/103 (31.07%), Postives = 55/103 (53.40%), Query Frame = 1
Query: 1117 ISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            ++++ + V    D  L  +     E+R +  V     ++K     WILTY+G +FN L+LI +G I  F+ PI+Y  ++  IDH +  V  Q+KD +   ++K
Sbjct:   82 VALSEEMVHKYSDVALSKLNKTIGELRRVFLVEDLVDSIKFAVLMWILTYVGAFFNGLTLIILGLIAAFTCPIVYEKHQAQIDHYVALVNNQVKDVVGKIQAK 184          
BLAST of Reticulon-like protein vs. Ensembl Medaka
Match: rtn3 (reticulon-3-B [Source:NCBI gene;Acc:101170222])

HSP 1 Score: 67.0106 bits (162), Expect = 1.025e-11
Identity = 53/192 (27.60%), Postives = 93/192 (48.44%), Query Frame = 1
Query:  913 KDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVKFNLVKKCDQS--------------NCNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQILGR 1446
            KD++ W+DP  S VV  + +++ L  +  +S+IS+ +Y  L LL       V + F + K   Q+              N ++S+  +  +  VD  L +I     ++  L  V     +LK     W+LTY+G  FN ++L+ +  I+LF++P +Y   KT ID  +D VR Q+  ++   + K    + R
Sbjct:  104 KDLIHWRDPKKSGVVFGLSLLMLL-SLAAFSVISVASYLLLALLI------VTISFRIYKSVLQAVQKSNDGHPFKMLINKDVSIPPETFRKHVDASLTYINRGLKQMSRLFLVEDLVDSLKLAVVMWLLTYVGAVFNGITLLILADILLFAVPPVYEKNKTQIDQYIDVVRTQVNATVAKLQEKLPGAVKR 288          
BLAST of Reticulon-like protein vs. Ensembl Medaka
Match: rtn1b (reticulon 1 [Source:NCBI gene;Acc:101155557])

HSP 1 Score: 64.3142 bits (155), Expect = 2.490e-10
Identity = 27/103 (26.21%), Postives = 54/103 (52.43%), Query Frame = 1
Query: 1117 ISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            I+++ D +    D +L +      E+R L  V     +LK     W+LTY+G  FN L+L+ +  + +F++P++Y  ++  ID  +  +R Q+   +   ++K
Sbjct:  716 IALSQDQITKYADKILLYTNTCMKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLILVVVSMFTMPVVYEKHQAQIDQYVGLIRTQVNSVVGKIQAK 818          
BLAST of Reticulon-like protein vs. Ensembl Medaka
Match: rtn1b (reticulon 1 [Source:NCBI gene;Acc:101155557])

HSP 1 Score: 60.077 bits (144), Expect = 5.111e-10
Identity = 27/103 (26.21%), Postives = 54/103 (52.43%), Query Frame = 1
Query: 1117 ISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            I+++ D +    D +L +      E+R L  V     +LK     W+LTY+G  FN L+L+ +  + +F++P++Y  ++  ID  +  +R Q+   +   ++K
Sbjct:   81 IALSQDQITKYADKILLYTNTCMKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLILVVVSMFTMPVVYEKHQAQIDQYVGLIRTQVNSVVGKIQAK 183          
BLAST of Reticulon-like protein vs. Ensembl Medaka
Match: rtn1b (reticulon 1 [Source:NCBI gene;Acc:101155557])

HSP 1 Score: 60.077 bits (144), Expect = 6.419e-10
Identity = 27/103 (26.21%), Postives = 54/103 (52.43%), Query Frame = 1
Query: 1117 ISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSK 1425
            I+++ D +    D +L +      E+R L  V     +LK     W+LTY+G  FN L+L+ +  + +F++P++Y  ++  ID  +  +R Q+   +   ++K
Sbjct:   97 IALSQDQITKYADKILLYTNTCMKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLILVVVSMFTMPVVYEKHQAQIDQYVGLIRTQVNSVVGKIQAK 199          
BLAST of Reticulon-like protein vs. Planmine SMEST
Match: SMESG000007676.1 (SMESG000007676.1)

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 475/476 (99.79%), Postives = 476/476 (100.00%), Query Frame = 1
Query:   25 MTDQVPELLEFETLKAEPSKIENILKLEDPPVTESDINTEIEATLTSDKLSYNEEIIDHDXXXXXXXXXXXXXXXISDGKDTDEAISQFAQNLIDPIVKEALKLQNAEMEDSITDEVKVDSCGDKKSEKSLSDDGFEYVKADDINSSSGTEQNNEDINQVLDGDKLNKTMDDLFEHEDLKIEDPSEIQSXXXXXXXXXXXXXXXXXXXXXKLESKSPDEEASDEGYDFDLQDIIKEYEANVPQNKEVPEYKMEEMEDVRKCDKTFIETDETKMEIFEAQMILDSVIISDNDICRKFKDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVKFNLVKKCDQSNCNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQILGRRV 1452
            MTDQVPELLEFETLKAEPSKIENILKLEDPPVTESDINTEIEATLTSDKLSYNEEIIDHDELLNLHEPPEEEEKEISDGKDTDEAISQFAQNLIDPIVKEALKLQNAEMEDSITDEVKVDSCGDKKSEKSLSDDGFEYVKADDINSSSGTEQNNEDINQVLDGDKLNKTMDDLFEHEDLK+EDPSEIQSNSEERNDIIEENEVVESSIPVKLESKSPDEEASDEGYDFDLQDIIKEYEANVPQNKEVPEYKMEEMEDVRKCDKTFIETDETKMEIFEAQMILDSVIISDNDICRKFKDIVCWKDPVMSSVVLSVIMVIELGLILDYSIISLMAYSGLLLLFSSFFYKVAVKFNLVKKCDQSNCNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQILGRRV
Sbjct:    1 MTDQVPELLEFETLKAEPSKIENILKLEDPPVTESDINTEIEATLTSDKLSYNEEIIDHDELLNLHEPPEEEEKEISDGKDTDEAISQFAQNLIDPIVKEALKLQNAEMEDSITDEVKVDSCGDKKSEKSLSDDGFEYVKADDINSSSGTEQNNEDINQVLDGDKLNKTMDDLFEHEDLKLEDPSEIQSNSEERNDIIEENEVVESSIPVKLESKSPDEEASDEGYDFDLQDIIKEYEANVPQNKEVPEYKMEEMEDVRKCDKTFIETDETKMEIFEAQMILDSVIISDNDICRKFKDIVCWKDPVMSSVVLSVIMVIELGLILDYSIISLMAYSGLLLLFSSFFYKVAVKFNLVKKCDQSNCNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQILGRRV 476          
BLAST of Reticulon-like protein vs. Planmine SMEST
Match: SMESG000079873.1 (SMESG000079873.1)

HSP 1 Score: 63.929 bits (154), Expect = 2.766e-11
Identity = 52/197 (26.40%), Postives = 103/197 (52.28%), Query Frame = 1
Query:  910 FKDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVKFNLVKKCDQSNCN---------ISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQILGRRV*IIGNCF 1473
            FK+I+ W++P+ ++ +L   + +E+ LI  +S+IS++AY+GL  L  +  +++ +KF+      QS+ N         I +         +  +  ++    +IRSL  +  + ++LK   F + +TYIG  FN ++L  + T+I+F +P IY TY+  +D++   +  +I   ++    K      R + +IG  F
Sbjct:   18 FKNIILWRNPLKTAAILLSCLTLEISLIC-FSVISVLAYAGLTFLIVATSFRMYMKFS-----GQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM-----RHLPVIGPLF 203          
BLAST of Reticulon-like protein vs. Planmine SMEST
Match: SMESG000079873.1 (SMESG000079873.1)

HSP 1 Score: 62.003 bits (149), Expect = 1.320e-10
Identity = 52/198 (26.26%), Postives = 102/198 (51.52%), Query Frame = 1
Query:  907 KFKDIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVKFNLVKKCDQSNCN---------ISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQILGRRV*IIGNCF 1473
            K  DI+ W++P+ ++ +L   + +E+ LI  +S+IS++AY+GL  L  +  +++ +KF+      QS+ N         I +         +  +  ++    +IRSL  +  + ++LK   F + +TYIG  FN ++L  + T+I+F +P IY TY+  +D++   +  +I   ++    K      R + +IG  F
Sbjct:   19 KILDIILWRNPLKTAAILLSCLTLEISLIC-FSVISVLAYAGLTFLIVATSFRMYMKFS-----GQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM-----RHLPVIGPLF 205          
BLAST of Reticulon-like protein vs. Planmine SMEST
Match: SMESG000079873.1 (SMESG000079873.1)

HSP 1 Score: 61.6178 bits (148), Expect = 2.122e-10
Identity = 51/195 (26.15%), Postives = 101/195 (51.79%), Query Frame = 1
Query:  916 DIVCWKDPXXXXXXXXXXXXXELGLILDYSIISLMAYXXXXXXXXXXXYKVAVKFNLVKKCDQSNCN---------ISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQILGRRV*IIGNCF 1473
            DI+ W++P+ ++ +L   + +E+ LI  +S+IS++AY+GL  L  +  +++ +KF+      QS+ N         I +         +  +  ++    +IRSL  +  + ++LK   F + +TYIG  FN ++L  + T+I+F +P IY TY+  +D++   +  +I   ++    K      R + +IG  F
Sbjct:   37 DIILWRNPLKTAAILLSCLTLEISLIC-FSVISVLAYAGLTFLIVATSFRMYMKFS-----GQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM-----RHLPVIGPLF 220          
The following BLAST results are available for this feature:
BLAST of Reticulon-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RTN12.739e-1327.42reticulon 1 [Source:HGNC Symbol;Acc:HGNC:10467][more]
RTN12.744e-1327.42reticulon 1 [Source:HGNC Symbol;Acc:HGNC:10467][more]
RTN45.288e-1325.59reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085][more]
RTN45.288e-1325.59reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085][more]
RTN45.288e-1325.59reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085][more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ret-19.198e-1025.52Reticulon-like protein [Source:UniProtKB/TrEMBL;A... [more]
ret-12.631e-925.52Reticulon-like protein [Source:UniProtKB/TrEMBL;A... [more]
ret-13.757e-925.52Reticulon-like protein [Source:UniProtKB/TrEMBL;A... [more]
ret-13.757e-925.52Reticulon-like protein [Source:UniProtKB/TrEMBL;A... [more]
ret-13.757e-925.52Reticulon-like protein [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rtnl11.073e-1128.08gene:FBgn0053113 transcript:FBtr0301538[more]
Rtnl11.074e-1128.08gene:FBgn0053113 transcript:FBtr0079038[more]
Rtnl18.829e-1127.70gene:FBgn0053113 transcript:FBtr0079042[more]
Rtnl11.325e-1027.70gene:FBgn0053113 transcript:FBtr0079044[more]
Rtnl11.325e-1027.70gene:FBgn0053113 transcript:FBtr0079041[more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtn1a5.725e-1528.57reticulon 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2426... [more]
rtn1a1.432e-1428.76reticulon 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2426... [more]
rtn1a5.271e-1428.65reticulon 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2426... [more]
rtn1a7.305e-1428.65reticulon 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2426... [more]
rtn1b7.948e-1427.45reticulon 1b [Source:ZFIN;Acc:ZDB-GENE-030710-3][more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000024406.11.104e-1529.11reticulon 3 [Source:NCBI gene;Acc:549516][more]
pou2af11.710e-1329.27POU class 2 homeobox associating factor 1 [Source:... [more]
trpc27.279e-1326.75transient receptor potential cation channel subfam... [more]
ENSXETT00000037176.18.753e-1328.34reticulon 3 [Source:NCBI gene;Acc:549516][more]
trpc21.570e-1230.50transient receptor potential cation channel subfam... [more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rtn12.093e-1326.61reticulon 1 [Source:MGI Symbol;Acc:MGI:1933947][more]
Rtn49.603e-1326.62reticulon 4 [Source:MGI Symbol;Acc:MGI:1915835][more]
Rtn41.316e-1226.62reticulon 4 [Source:MGI Symbol;Acc:MGI:1915835][more]
Rtn12.123e-1229.13reticulon 1 [Source:MGI Symbol;Acc:MGI:1933947][more]
Rtn13.387e-1229.13reticulon 1 [Source:MGI Symbol;Acc:MGI:1933947][more]
back to top
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5J6M8|RTN3A_XENLA8.137e-1328.88Reticulon-3-A OS=Xenopus laevis OX=8355 GN=rtn3-a ... [more]
sp|A7MC64|RTN1_XENTR8.754e-1329.27Reticulon-1 OS=Xenopus tropicalis OX=8364 GN=rtn1 ... [more]
sp|Q5IS59|RTN1_PANTR1.238e-1227.42Reticulon-1 OS=Pan troglodytes OX=9598 GN=RTN1 PE=... [more]
sp|Q16799|RTN1_HUMAN1.316e-1227.42Reticulon-1 OS=Homo sapiens OX=9606 GN=RTN1 PE=1 S... [more]
sp|Q8K0T0|RTN1_MOUSE1.464e-1226.61Reticulon-1 OS=Mus musculus OX=10090 GN=Rtn1 PE=1 ... [more]
back to top
BLAST of Reticulon-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A224YQ661.660e-1531.49Reticulon-like protein OS=Rhipicephalus zambeziens... [more]
A0A131Z6731.791e-1531.49Reticulon-like protein OS=Rhipicephalus appendicul... [more]
A0A224YGN42.306e-1531.52Reticulon-like protein OS=Rhipicephalus zambeziens... [more]
A0A224YEL36.191e-1531.49Reticulon-like protein OS=Rhipicephalus zambeziens... [more]
A0A131Z2K86.191e-1531.49Reticulon-like protein OS=Rhipicephalus appendicul... [more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtn1a2.858e-1426.80reticulon 1 [Source:NCBI gene;Acc:103026308][more]
rtn1a9.062e-1427.15reticulon 1 [Source:NCBI gene;Acc:103026308][more]
rtn1b9.800e-1430.16reticulon-1-A-like [Source:NCBI gene;Acc:103036511... [more]
rtn1a1.065e-1327.15reticulon 1 [Source:NCBI gene;Acc:103026308][more]
rtn1b1.129e-1230.89reticulon-1-A-like [Source:NCBI gene;Acc:103036511... [more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007319.12.121e-1233.33pep scaffold:Pmarinus_7.0:GL490398:662:6495:-1 gen... [more]
ENSPMAT00000006786.15.464e-1023.33pep scaffold:Pmarinus_7.0:GL481818:2303:8766:1 gen... [more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reticulon-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO307667.052e-830.86Reticulon-like protein [Source:UniProtKB/TrEMBL;A... [more]
EDO360765.926e-625.24Reticulon-like protein [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtn4a4.328e-1231.07reticulon-4 [Source:NCBI gene;Acc:101163104][more]
rtn31.025e-1127.60reticulon-3-B [Source:NCBI gene;Acc:101170222][more]
rtn1b2.490e-1026.21reticulon 1 [Source:NCBI gene;Acc:101155557][more]
rtn1b5.111e-1026.21reticulon 1 [Source:NCBI gene;Acc:101155557][more]
rtn1b6.419e-1026.21reticulon 1 [Source:NCBI gene;Acc:101155557][more]
back to top
BLAST of Reticulon-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000007676.10.000e+099.79SMESG000007676.1[more]
SMESG000079873.12.766e-1126.40SMESG000079873.1[more]
SMESG000079873.11.320e-1026.26SMESG000079873.1[more]
SMESG000079873.12.122e-1026.15SMESG000079873.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003269 ID=SMED30003269|Name=Reticulon-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1903bp
TCTATATAAATCTTATATGAAAATATGACAGATCAAGTACCAGAACTATT
AGAATTTGAAACATTAAAAGCAGAACCGAGTAAAATTGAAAATATATTAA
AATTGGAAGATCCTCCAGTAACTGAAAGCGATATCAATACTGAAATTGAA
GCTACATTGACATCGGATAAGCTAAGTTATAATGAAGAAATTATAGATCA
TGATGAATTGTTAAATTTGCACGAACCACCCGAGGAGGAAGAAAAAGAAA
TTTCTGATGGCAAAGATACAGATGAAGCTATCAGTCAATTTGCACAAAAT
TTAATTGACCCAATTGTTAAAGAAGCTCTTAAACTTCAAAACGCAGAAAT
GGAGGACAGTATAACTGATGAGGTTAAAGTCGATTCATGCGGTGACAAAA
AATCCGAAAAAAGCTTATCAGATGACGGATTTGAATACGTAAAAGCAGAT
GATATTAATTCTAGTTCAGGAACTGAGCAAAATAATGAAGACATAAATCA
AGTTTTGGATGGTGACAAATTAAATAAAACTATGGATGACTTGTTCGAGC
ACGAAGATTTAAAAATTGAAGATCCAAGTGAAATTCAAAGTAATTCAGAG
GAAAGAAATGATATAATTGAGGAAAATGAAGTTGTGGAAAGTTCTATTCC
TGTGAAATTAGAATCAAAATCGCCCGATGAAGAAGCTAGTGACGAAGGTT
ATGATTTTGATTTACAAGATATTATTAAAGAATATGAAGCGAATGTTCCA
CAAAATAAAGAGGTTCCTGAGTACAAAATGGAAGAAATGGAGGATGTAAG
AAAATGTGACAAAACTTTTATTGAAACAGATGAAACAAAAATGGAAATTT
TTGAAGCCCAGATGATATTGGATTCAGTTATAATTAGTGACAATGACATT
TGCCGAAAATTTAAAGACATTGTATGCTGGAAAGATCCTGTAATGTCATC
AGTCGTTTTATCTGTCATAATGGTAATAGAATTGGGGCTGATATTAGATT
ATTCTATCATTTCGTTGATGGCTTATTCTGGATTGTTGCTTTTATTTAGC
AGTTTTTTCTACAAAGTTGCTGTGAAATTTAATTTAGTCAAAAAATGTGA
TCAAAGTAATTGCAATATCAGTGTCACTAGCGATGACGTACAATTATGTG
TTGATTGCGTATTGAAATGGATAGAATATCTGTTCAATGAGATTAGGTCA
TTGACTTATGTGGTTTCCTTTACAAAAAACCTTAAAGCATTTACATTCTT
CTGGATTTTGACCTATATAGGCCAATGGTTCAATTTACTAAGCCTTATTT
TTATGGGAACAATTATTCTATTTTCACTGCCCATAATTTATACAACATAC
AAAACAACTATTGATCATGTTCTAGACCGAGTTCGTGGCCAGATAAAAGA
TTCTATCAATAATTTTAAATCGAAATTTCAACAAATTCTTGGCCGTCGAG
TCTGAATTATCGGAAATTGTTTTTGAAAGACTAATTACTTTCTGTCTATT
AGTCAATAGATATTTTGCCATTTGATCCAGAATTTTAATCTTGTAATGAA
TTGCCGTAATGTATGATTATTGGCAATTCAATTTCATATTCATTATTCCT
ATAATAATATACAAATATTATATGATACCCCTTTAATTGAAATCGCATGC
CTCTTAGAGATTCATGAGATATGGATGTGTATTTTTGTGCGCTTTTGTTT
TTATATATATATTTCGCTAGTGATTATGAGATTGATTTTTTTCTAAATTT
CATTTTGATCTACAACTATCGGATTTATATATATATATTGTATGTGTGTG
CGTGTGATTAAGAATTTCTCTAATTTTGTTTCGAATATTTGGTTGAATTT
AATTTTCAGAAAGAAATATATTTGTTGTCATTTGAAAAAAAAAGATCGGA
AGA
back to top

protein sequence of SMED30003269-orf-1

>SMED30003269-orf-1 ID=SMED30003269-orf-1|Name=SMED30003269-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=477bp
MTDQVPELLEFETLKAEPSKIENILKLEDPPVTESDINTEIEATLTSDKL
SYNEEIIDHDELLNLHEPPEEEEKEISDGKDTDEAISQFAQNLIDPIVKE
ALKLQNAEMEDSITDEVKVDSCGDKKSEKSLSDDGFEYVKADDINSSSGT
EQNNEDINQVLDGDKLNKTMDDLFEHEDLKIEDPSEIQSNSEERNDIIEE
NEVVESSIPVKLESKSPDEEASDEGYDFDLQDIIKEYEANVPQNKEVPEY
KMEEMEDVRKCDKTFIETDETKMEIFEAQMILDSVIISDNDICRKFKDIV
CWKDPVMSSVVLSVIMVIELGLILDYSIISLMAYSGLLLLFSSFFYKVAV
KFNLVKKCDQSNCNISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFT
KNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVL
DRVRGQIKDSINNFKSKFQQILGRRV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003388Reticulon
IPR001627Semap_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane