Prohibitin

Overview
NameProhibitin
Smed IDSMED30003249
Length (bp)1005
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Prohibitin (SMED30003249) t-SNE clustered cells

Violin plots show distribution of expression levels for Prohibitin (SMED30003249) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Prohibitin (SMED30003249) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Prohibitin (SMED30003249) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003249

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30003249SMESG000038397.1 SmedASXL_004762SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30003249SMESG000038397.1 SmedASXL_004762SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30003249SMESG000038397.1 dd_Smed_v4_1038_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30003249SMESG000038397.1 dd_Smed_v4_1038_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30003249SMESG000038397.1 dd_Smed_v4_1038_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003249SMESG000038397.1 dd_Smed_v4_1038_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003249SMESG000038397.1 dd_Smed_v4_1038_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003249SMESG000038397.1 dd_Smed_v4_1038_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003249SMESG000038397.1 dd_Smed_v4_1038_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003249SMESG000038397.1 dd_Smed_v4_1038_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003249SMESG000038397.1 Contig23393uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003249SMESG000038397.1 Contig23393newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003249SMESG000038397.1 Contig49497uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003249SMESG000038397.1 Contig49497newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30003249SMESG000038397.1 SMED30003249smed_20140614PMID:22696458
Labbé et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30003249SMESG000038397.1 isotig10463be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30003249SMESG000038397.1 dd_Smed_v6_1038_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30003249SMESG000038397.1 dd_Smed_v6_1038_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 1 cellSMED30003249SMESG000038397.1 NB.32.8dsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Category 1 cellSMED30003249SMESG000038397.1 NB.32.8dsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Prohibitin vs. Ensembl Human
Match: PHB (prohibitin [Source:HGNC Symbol;Acc:HGNC:8912])

HSP 1 Score: 355.525 bits (911), Expect = 6.329e-123
Identity = 180/267 (67.42%), Postives = 225/267 (84.27%), Query Frame = 3
Query:  135 VFDLLAKFXXXXXXXXXXXXXXLYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLP 935
            VF+ + KFG+A+AVAGGV +SALY V  GHRAVIFDR  GV+  V+GEGTHFLIPW+QKPII+D R+RPRNVPV TGSKDLQ VNITLRIL++P A  LP+I+T++G D++ERVLPSIT E+LK+VVA+FDA +LITQRELVS +V++ LT RA+ FGL+LDD+SLTHLTFG EF++AVE KQVAQQEAERARF+VEKAEQ+K AAIISAEGDS+AA L+A S    G+G IEL++++ +E+IA  LS+++NI YLP  Q  L+ LP
Sbjct:    5 VFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLP 271          
BLAST of Prohibitin vs. Ensembl Human
Match: PHB (prohibitin [Source:HGNC Symbol;Acc:HGNC:8912])

HSP 1 Score: 355.525 bits (911), Expect = 6.329e-123
Identity = 180/267 (67.42%), Postives = 225/267 (84.27%), Query Frame = 3
Query:  135 VFDLLAKFXXXXXXXXXXXXXXLYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLP 935
            VF+ + KFG+A+AVAGGV +SALY V  GHRAVIFDR  GV+  V+GEGTHFLIPW+QKPII+D R+RPRNVPV TGSKDLQ VNITLRIL++P A  LP+I+T++G D++ERVLPSIT E+LK+VVA+FDA +LITQRELVS +V++ LT RA+ FGL+LDD+SLTHLTFG EF++AVE KQVAQQEAERARF+VEKAEQ+K AAIISAEGDS+AA L+A S    G+G IEL++++ +E+IA  LS+++NI YLP  Q  L+ LP
Sbjct:    5 VFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLP 271          
BLAST of Prohibitin vs. Ensembl Human
Match: PHB (prohibitin [Source:HGNC Symbol;Acc:HGNC:8912])

HSP 1 Score: 355.525 bits (911), Expect = 6.329e-123
Identity = 180/267 (67.42%), Postives = 225/267 (84.27%), Query Frame = 3
Query:  135 VFDLLAKFXXXXXXXXXXXXXXLYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLP 935
            VF+ + KFG+A+AVAGGV +SALY V  GHRAVIFDR  GV+  V+GEGTHFLIPW+QKPII+D R+RPRNVPV TGSKDLQ VNITLRIL++P A  LP+I+T++G D++ERVLPSIT E+LK+VVA+FDA +LITQRELVS +V++ LT RA+ FGL+LDD+SLTHLTFG EF++AVE KQVAQQEAERARF+VEKAEQ+K AAIISAEGDS+AA L+A S    G+G IEL++++ +E+IA  LS+++NI YLP  Q  L+ LP
Sbjct:    5 VFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLP 271          
BLAST of Prohibitin vs. Ensembl Human
Match: PHB (prohibitin [Source:HGNC Symbol;Acc:HGNC:8912])

HSP 1 Score: 330.102 bits (845), Expect = 2.465e-113
Identity = 167/242 (69.01%), Postives = 208/242 (85.95%), Query Frame = 3
Query:  135 VFDLLAKFXXXXXXXXXXXXXXLYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEE 860
            VF+ + KFG+A+AVAGGV +SALY V  GHRAVIFDR  GV+  V+GEGTHFLIPW+QKPII+D R+RPRNVPV TGSKDLQ VNITLRIL++P A  LP+I+T++G D++ERVLPSIT E+LK+VVA+FDA +LITQRELVS +V++ LT RA+ FGL+LDD+SLTHLTFG EF++AVE KQVAQQEAERARF+VEKAEQ+K AAIISAEGDS+AA L+A S    G+G IEL++++ +E+
Sbjct:    5 VFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAED 246          
BLAST of Prohibitin vs. Ensembl Human
Match: PHB (prohibitin [Source:HGNC Symbol;Acc:HGNC:8912])

HSP 1 Score: 300.827 bits (769), Expect = 3.589e-102
Identity = 154/212 (72.64%), Postives = 186/212 (87.74%), Query Frame = 3
Query:  135 VFDLLAKFXXXXXXXXXXXXXXLYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEG 770
            VF+ + KFG+A+AVAGGV +SALY V  GHRAVIFDR  GV+  V+GEGTHFLIPW+QKPII+D R+RPRNVPV TGSKDLQ VNITLRIL++P A  LP+I+T++G D++ERVLPSIT E+LK+VVA+FDA +LITQRELVS +V++ LT RA+ FGL+LDD+SLTHLTFG EF++AVE KQVAQQEAERARF+VEKAEQ+K AAIISAEG
Sbjct:    5 VFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEG 216          
BLAST of Prohibitin vs. Ensembl Celegans
Match: phb-1 (Mitochondrial prohibitin complex protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9BKU4])

HSP 1 Score: 325.094 bits (832), Expect = 2.219e-111
Identity = 160/244 (65.57%), Postives = 201/244 (82.38%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISL 932
            LY V GG RAVIFDR SGV+ +V+GEGTHFLIPW+QKPII+DIR+ PR V   TGSKDLQ VNITLRIL++P  + LP IY N+GLD+ ERVLPSIT EVLK VVAQFDA ++ITQRE+VS + +  L  RA+ FGL+LDDI++THL FG EF++AVE+KQVAQQEAE+AR+LVEKAEQ K+AA+ +AEGD+QAA LLAK+F   G+G +EL++I+ +EEIA  ++KNKN+ YLP  Q TL++L
Sbjct:   30 LYNVDGGQRAVIFDRFSGVKNEVVGEGTHFLIPWVQKPIIFDIRSTPRAVTTITGSKDLQNVNITLRILHRPSPDRLPNIYLNIGLDYAERVLPSITNEVLKAVVAQFDAHEMITQREVVSQRASVALRERAAQFGLLLDDIAITHLNFGREFTEAVEMKQVAQQEAEKARYLVEKAEQMKIAAVTTAEGDAQAAKLLAKAFASAGDGLVELRKIEAAEEIAERMAKNKNVTYLPGNQQTLLNL 273          
BLAST of Prohibitin vs. Ensembl Celegans
Match: phb-2 (Mitochondrial prohibitin complex protein 2 [Source:UniProtKB/Swiss-Prot;Acc:P50093])

HSP 1 Score: 250.366 bits (638), Expect = 9.178e-82
Identity = 124/235 (52.77%), Postives = 170/235 (72.34%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLP 905
            ++TV  GHRA++F+RI G+  D+  EG HF IPW Q PIIYDIR RP  +   TGSKDLQ VNI LR+L +P  E L  IY  LG ++EERVLPSI  EVLK VVA+F+AS LITQR+ VS  V + L  RA +F ++LDD+SLT L F  ++S AVE KQVA QEA+RA F VE+A+Q+K   I+ AEG++++A LL ++  +   GF++L++I+ +++IAR++S++ N  YLP
Sbjct:   40 MFTVEAGHRAIMFNRIGGLSTDLYKEGLHFRIPWFQYPIIYDIRARPNQIRSPTGSKDLQMVNIGLRVLSRPNPEHLVHIYRTLGQNWEERVLPSICNEVLKGVVAKFNASQLITQRQQVSMLVRKTLIERALDFNIILDDVSLTELAFSPQYSAAVEAKQVAAQEAQRATFYVERAKQQKQEKIVQAEGEAESAKLLGEAM-KNDPGFLKLRKIRAAQKIARIVSESGNKTYLP 273          
BLAST of Prohibitin vs. Ensembl Celegans
Match: phb-2 (Mitochondrial prohibitin complex protein 2 [Source:UniProtKB/Swiss-Prot;Acc:P50093])

HSP 1 Score: 250.366 bits (638), Expect = 9.178e-82
Identity = 124/235 (52.77%), Postives = 170/235 (72.34%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLP 905
            ++TV  GHRA++F+RI G+  D+  EG HF IPW Q PIIYDIR RP  +   TGSKDLQ VNI LR+L +P  E L  IY  LG ++EERVLPSI  EVLK VVA+F+AS LITQR+ VS  V + L  RA +F ++LDD+SLT L F  ++S AVE KQVA QEA+RA F VE+A+Q+K   I+ AEG++++A LL ++  +   GF++L++I+ +++IAR++S++ N  YLP
Sbjct:   40 MFTVEAGHRAIMFNRIGGLSTDLYKEGLHFRIPWFQYPIIYDIRARPNQIRSPTGSKDLQMVNIGLRVLSRPNPEHLVHIYRTLGQNWEERVLPSICNEVLKGVVAKFNASQLITQRQQVSMLVRKTLIERALDFNIILDDVSLTELAFSPQYSAAVEAKQVAAQEAQRATFYVERAKQQKQEKIVQAEGEAESAKLLGEAM-KNDPGFLKLRKIRAAQKIARIVSESGNKTYLP 273          
BLAST of Prohibitin vs. Ensembl Fly
Match: l(2)37Cc (gene:FBgn0002031 transcript:FBtr0081164)

HSP 1 Score: 360.918 bits (925), Expect = 2.072e-125
Identity = 168/246 (68.29%), Postives = 210/246 (85.37%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLPA 938
            LY V GGHRAVIFDR +G++ +V+GEGTHF IPW+Q+PII+DIR++PRNVPV TGSKDLQ VNITLRILY+P  + LPKIYT LG D++ERVLPSI  EVLK VVAQFDA +LITQRE+VS +V++ LT RA  FG +LDDISLTHLTFG EF+ AVE+KQVAQQEAE+ARF+VEKAEQ+KLA+IISAEGD++AA LLAKSF + G+G +EL+RI+ +E+IA  LS+++ + YLP  Q TL++LP+
Sbjct:   27 LYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNVPVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYLPSGQSTLLNLPS 272          
BLAST of Prohibitin vs. Ensembl Fly
Match: l(2)37Cc (gene:FBgn0002031 transcript:FBtr0081165)

HSP 1 Score: 360.918 bits (925), Expect = 2.072e-125
Identity = 168/246 (68.29%), Postives = 210/246 (85.37%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLPA 938
            LY V GGHRAVIFDR +G++ +V+GEGTHF IPW+Q+PII+DIR++PRNVPV TGSKDLQ VNITLRILY+P  + LPKIYT LG D++ERVLPSI  EVLK VVAQFDA +LITQRE+VS +V++ LT RA  FG +LDDISLTHLTFG EF+ AVE+KQVAQQEAE+ARF+VEKAEQ+KLA+IISAEGD++AA LLAKSF + G+G +EL+RI+ +E+IA  LS+++ + YLP  Q TL++LP+
Sbjct:   27 LYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNVPVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYLPSGQSTLLNLPS 272          
BLAST of Prohibitin vs. Ensembl Fly
Match: l(2)37Cc (gene:FBgn0002031 transcript:FBtr0346428)

HSP 1 Score: 360.918 bits (925), Expect = 2.072e-125
Identity = 168/246 (68.29%), Postives = 210/246 (85.37%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLPA 938
            LY V GGHRAVIFDR +G++ +V+GEGTHF IPW+Q+PII+DIR++PRNVPV TGSKDLQ VNITLRILY+P  + LPKIYT LG D++ERVLPSI  EVLK VVAQFDA +LITQRE+VS +V++ LT RA  FG +LDDISLTHLTFG EF+ AVE+KQVAQQEAE+ARF+VEKAEQ+KLA+IISAEGD++AA LLAKSF + G+G +EL+RI+ +E+IA  LS+++ + YLP  Q TL++LP+
Sbjct:   27 LYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNVPVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYLPSGQSTLLNLPS 272          
BLAST of Prohibitin vs. Ensembl Fly
Match: Phb2 (gene:FBgn0010551 transcript:FBtr0086614)

HSP 1 Score: 258.84 bits (660), Expect = 6.704e-85
Identity = 120/234 (51.28%), Postives = 175/234 (74.79%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 902
            LYTV GGHRA+IF R+ G++ D+  EG H  IPW Q PIIYDIR+RPR +   TGSKDLQ +NI+LR+L +P +  LP ++  LG+D++E+VLPSI  EVLK+V+A+F+AS LITQR+ VS  + + L  RA +F ++LDD+SLT L+FG E++ A+E KQVAQQEA+RA F VE+A+QEK   I+ AEG+++AA +L  +  Q    +++L++++ ++ IAR ++ ++N VYL
Sbjct:   42 LYTVEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSRPRKISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKMLGLAVKQ-NPAYLKLRKLRAAQSIARTIASSQNKVYL 274          
BLAST of Prohibitin vs. Ensembl Fly
Match: Phb2 (gene:FBgn0010551 transcript:FBtr0086615)

HSP 1 Score: 258.84 bits (660), Expect = 6.704e-85
Identity = 120/234 (51.28%), Postives = 175/234 (74.79%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 902
            LYTV GGHRA+IF R+ G++ D+  EG H  IPW Q PIIYDIR+RPR +   TGSKDLQ +NI+LR+L +P +  LP ++  LG+D++E+VLPSI  EVLK+V+A+F+AS LITQR+ VS  + + L  RA +F ++LDD+SLT L+FG E++ A+E KQVAQQEA+RA F VE+A+QEK   I+ AEG+++AA +L  +  Q    +++L++++ ++ IAR ++ ++N VYL
Sbjct:   42 LYTVEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSRPRKISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKMLGLAVKQ-NPAYLKLRKLRAAQSIARTIASSQNKVYL 274          
BLAST of Prohibitin vs. Ensembl Zebrafish
Match: phb (prohibitin [Source:ZFIN;Acc:ZDB-GENE-030131-6577])

HSP 1 Score: 360.147 bits (923), Expect = 5.917e-125
Identity = 170/245 (69.39%), Postives = 209/245 (85.31%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLP 935
            LY V  GHRAVIFDR  GV+  V+GEGTHFLIPW+QKPII+D R+RPRNVPV TGSKDLQ VNITLRIL++P A  LP+I+T++G D++ERVLPSIT EVLK+VVA+FDA +LITQRELVS +V+E LT RAS FGL+LDD+SLTHLTFG EF++AVE+KQVAQQEAERARF+VEKAEQ+K AAIISAEGDSQAA L+A S  + G+G +EL++++ +E+IA  LS+ +N+ YLP  QGTL+ LP
Sbjct:   26 LYNVDAGHRAVIFDRFRGVQDVVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVAGQLPRIFTSIGEDYDERVLPSITTEVLKSVVARFDAGELITQRELVSRQVSEDLTERASTFGLILDDVSLTHLTFGKEFTEAVEMKQVAQQEAERARFVVEKAEQQKQAAIISAEGDSQAALLIANSLAEAGDGLVELRKLEAAEDIAFQLSRARNVTYLPSGQGTLLQLP 270          
BLAST of Prohibitin vs. Ensembl Zebrafish
Match: phb2b (prohibitin 2b [Source:ZFIN;Acc:ZDB-GENE-040718-430])

HSP 1 Score: 255.758 bits (652), Expect = 1.508e-83
Identity = 128/234 (54.70%), Postives = 173/234 (73.93%), Query Frame = 3
Query:  204 YTVPGGHRAVIFDRISGVRPD-VIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 902
            YTV GG RA+IF+RI GV+ D V+ EG HF IPW Q PIIYDIR RPR +   TGSKDLQ VNI LR+L +P A  LP +Y  LG D++ERVLPSI  EVLK+VVA+F+AS LITQR  VS  +   L  RA +F ++LDD+++T L+F  E++ AVE KQVAQQEA+RA+F VEKA+QE+   II AEG++QAA +L ++  +   G+++L+RI+ ++ IA+ ++ ++N VYL
Sbjct:   49 YTVEGGQRAIIFNRIGGVQLDTVLTEGLHFRIPWFQYPIIYDIRARPRKISSLTGSKDLQMVNIALRVLSRPLASNLPIMYQQLGQDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELFERAKDFNIILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFFVEKAKQEQKQKIIQAEGEAQAAKMLGEAVTK-NPGYLKLRRIRAAQNIAKTVAASQNKVYL 281          
BLAST of Prohibitin vs. Ensembl Zebrafish
Match: phb2b (prohibitin 2b [Source:ZFIN;Acc:ZDB-GENE-040718-430])

HSP 1 Score: 255.758 bits (652), Expect = 1.508e-83
Identity = 128/234 (54.70%), Postives = 173/234 (73.93%), Query Frame = 3
Query:  204 YTVPGGHRAVIFDRISGVRPD-VIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 902
            YTV GG RA+IF+RI GV+ D V+ EG HF IPW Q PIIYDIR RPR +   TGSKDLQ VNI LR+L +P A  LP +Y  LG D++ERVLPSI  EVLK+VVA+F+AS LITQR  VS  +   L  RA +F ++LDD+++T L+F  E++ AVE KQVAQQEA+RA+F VEKA+QE+   II AEG++QAA +L ++  +   G+++L+RI+ ++ IA+ ++ ++N VYL
Sbjct:   49 YTVEGGQRAIIFNRIGGVQLDTVLTEGLHFRIPWFQYPIIYDIRARPRKISSLTGSKDLQMVNIALRVLSRPLASNLPIMYQQLGQDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELFERAKDFNIILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFFVEKAKQEQKQKIIQAEGEAQAAKMLGEAVTK-NPGYLKLRRIRAAQNIAKTVAASQNKVYL 281          
BLAST of Prohibitin vs. Ensembl Zebrafish
Match: phb2b (prohibitin 2b [Source:ZFIN;Acc:ZDB-GENE-040718-430])

HSP 1 Score: 255.758 bits (652), Expect = 1.508e-83
Identity = 128/234 (54.70%), Postives = 173/234 (73.93%), Query Frame = 3
Query:  204 YTVPGGHRAVIFDRISGVRPD-VIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 902
            YTV GG RA+IF+RI GV+ D V+ EG HF IPW Q PIIYDIR RPR +   TGSKDLQ VNI LR+L +P A  LP +Y  LG D++ERVLPSI  EVLK+VVA+F+AS LITQR  VS  +   L  RA +F ++LDD+++T L+F  E++ AVE KQVAQQEA+RA+F VEKA+QE+   II AEG++QAA +L ++  +   G+++L+RI+ ++ IA+ ++ ++N VYL
Sbjct:   49 YTVEGGQRAIIFNRIGGVQLDTVLTEGLHFRIPWFQYPIIYDIRARPRKISSLTGSKDLQMVNIALRVLSRPLASNLPIMYQQLGQDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELFERAKDFNIILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFFVEKAKQEQKQKIIQAEGEAQAAKMLGEAVTK-NPGYLKLRRIRAAQNIAKTVAASQNKVYL 281          
BLAST of Prohibitin vs. Ensembl Zebrafish
Match: phb2a (prohibitin 2a [Source:ZFIN;Acc:ZDB-GENE-030131-3141])

HSP 1 Score: 252.677 bits (644), Expect = 2.590e-82
Identity = 125/234 (53.42%), Postives = 172/234 (73.50%), Query Frame = 3
Query:  204 YTVPGGHRAVIFDRISGVRPD-VIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 902
            YTV GG RAVIF RI G++ D V+ EG HF +PW Q PIIYDIR RPR +   TGSKDLQ VNI LR+L +P A  LP +Y  LG D++ERVLPSI  EVLK+VVA+F+AS LITQR  VS  +   L  RA +F ++LDD+++T L+F  E++ AVE KQVAQQEA+RA+F VEKA+Q++   II AEG+++AA +L ++  +   G+++L+RI+ ++ IA+ ++ ++N VYL
Sbjct:   49 YTVEGGQRAVIFSRIGGMQMDTVLAEGLHFRMPWFQYPIIYDIRARPRKISSLTGSKDLQMVNIGLRVLSRPVASQLPIMYQQLGKDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRDLIERAKDFNIILDDVAITELSFSKEYTAAVEAKQVAQQEAQRAQFFVEKAKQDQRQKIIQAEGEAEAAKMLGQAVTK-NPGYLKLRRIRAAQNIAKTVAASQNKVYL 281          
BLAST of Prohibitin vs. Ensembl Xenopus
Match: phb (prohibitin [Source:NCBI gene;Acc:394635])

HSP 1 Score: 350.132 bits (897), Expect = 6.871e-121
Identity = 174/267 (65.17%), Postives = 221/267 (82.77%), Query Frame = 3
Query:  135 VFDLLAKFXXXXXXXXXXXXXXLYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLP 935
            +F+ + K G+ +AVAGGV +SALY V  GH+AVIFDR  GV+  V+GEGTHFLIPW+QKPII+D R+RPRNVPV TGSKDLQ VNITLRIL++P    LP+I+T++G D++ERVLPSIT E+LK+VVA+FDA +LITQRELVS +V+E L  RA+ FGL+LDD+SLTHLTFG EF++AVE KQVAQQEAERARF+VEKAEQ+K AA+ISAEGDS+AA L+A S    G+G IEL++++ +E+IA  LS+ +N+ YLP  Q TL+ LP
Sbjct:    5 LFETIGKLGLGLAVAGGVVNSALYNVDAGHQAVIFDRFRGVQETVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVVTGSKDLQNVNITLRILFRPMGNQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSEDLMERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFIVEKAEQQKKAAVISAEGDSKAAELIATSLADAGDGLIELRKLEAAEDIAYQLSRARNVTYLPSGQSTLLQLP 271          
BLAST of Prohibitin vs. Ensembl Xenopus
Match: cgref1 (cell growth regulator with EF-hand domain 1 [Source:Xenbase;Acc:XB-GENE-997667])

HSP 1 Score: 258.84 bits (660), Expect = 1.085e-84
Identity = 125/235 (53.19%), Postives = 176/235 (74.89%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPD-VIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 902
            ++TV GGHRA+ F+RI GV+ D ++ EG HF  PW Q PIIYDIR RPR +   TGSKDLQ VNITLR+L +P A  LP +Y  LGLD++ERVLPSI  EVLK+VVA+F+AS LITQR  VS  +   LT RA +F ++LDD+++T L+F  E++ AVE KQVAQQEA+RA+FLVEKA+Q++   I+ AEG++ AA ++  + ++   G+++L+RI+ ++ IA+ ++ ++N VYL
Sbjct:   40 VFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRFPWFQYPIIYDIRARPRKISSPTGSKDLQMVNITLRVLSRPLASELPFMYQRLGLDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSIILDDVAITELSFSREYTAAVESKQVAQQEAQRAQFLVEKAKQDQKQKIVQAEGEAAAAKMIGDALSK-NPGYLKLRRIRAAQSIAKTIASSQNRVYL 273          
BLAST of Prohibitin vs. Ensembl Xenopus
Match: cgref1 (cell growth regulator with EF-hand domain 1 [Source:Xenbase;Acc:XB-GENE-997667])

HSP 1 Score: 258.84 bits (660), Expect = 1.085e-84
Identity = 125/235 (53.19%), Postives = 176/235 (74.89%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPD-VIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 902
            ++TV GGHRA+ F+RI GV+ D ++ EG HF  PW Q PIIYDIR RPR +   TGSKDLQ VNITLR+L +P A  LP +Y  LGLD++ERVLPSI  EVLK+VVA+F+AS LITQR  VS  +   LT RA +F ++LDD+++T L+F  E++ AVE KQVAQQEA+RA+FLVEKA+Q++   I+ AEG++ AA ++  + ++   G+++L+RI+ ++ IA+ ++ ++N VYL
Sbjct:   40 VFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRFPWFQYPIIYDIRARPRKISSPTGSKDLQMVNITLRVLSRPLASELPFMYQRLGLDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSIILDDVAITELSFSREYTAAVESKQVAQQEAQRAQFLVEKAKQDQKQKIVQAEGEAAAAKMIGDALSK-NPGYLKLRRIRAAQSIAKTIASSQNRVYL 273          
BLAST of Prohibitin vs. Ensembl Xenopus
Match: cgref1 (cell growth regulator with EF-hand domain 1 [Source:Xenbase;Acc:XB-GENE-997667])

HSP 1 Score: 259.225 bits (661), Expect = 1.088e-84
Identity = 125/235 (53.19%), Postives = 176/235 (74.89%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPD-VIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 902
            ++TV GGHRA+ F+RI GV+ D ++ EG HF  PW Q PIIYDIR RPR +   TGSKDLQ VNITLR+L +P A  LP +Y  LGLD++ERVLPSI  EVLK+VVA+F+AS LITQR  VS  +   LT RA +F ++LDD+++T L+F  E++ AVE KQVAQQEA+RA+FLVEKA+Q++   I+ AEG++ AA ++  + ++   G+++L+RI+ ++ IA+ ++ ++N VYL
Sbjct:   40 VFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRFPWFQYPIIYDIRARPRKISSPTGSKDLQMVNITLRVLSRPLASELPFMYQRLGLDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSIILDDVAITELSFSREYTAAVESKQVAQQEAQRAQFLVEKAKQDQKQKIVQAEGEAAAAKMIGDALSK-NPGYLKLRRIRAAQSIAKTIASSQNRVYL 273          
BLAST of Prohibitin vs. Ensembl Mouse
Match: Phb (prohibitin [Source:MGI Symbol;Acc:MGI:97572])

HSP 1 Score: 357.066 bits (915), Expect = 9.514e-124
Identity = 181/267 (67.79%), Postives = 225/267 (84.27%), Query Frame = 3
Query:  135 VFDLLAKFXXXXXXXXXXXXXXLYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLP 935
            VF+ + KFG+A+AVAGGV +SALY V  GHRAVIFDR  GV+  V+GEGTHFLIPW+QKPII+D R+RPRNVPV TGSKDLQ VNITLRIL++P A  LP+IYT++G D++ERVLPSIT E+LK+VVA+FDA +LITQRELVS +V++ LT RA+ FGL+LDD+SLTHLTFG EF++AVE KQVAQQEAERARF+VEKAEQ+K AAIISAEGDS+AA L+A S    G+G IEL++++ +E+IA  LS+++NI YLP  Q  L+ LP
Sbjct:    5 VFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLP 271          
BLAST of Prohibitin vs. Ensembl Mouse
Match: Phb (prohibitin [Source:MGI Symbol;Acc:MGI:97572])

HSP 1 Score: 288.5 bits (737), Expect = 1.262e-97
Identity = 147/203 (72.41%), Postives = 178/203 (87.68%), Query Frame = 3
Query:  135 VFDLLAKFXXXXXXXXXXXXXXLYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEK 743
            VF+ + KFG+A+AVAGGV +SALY V  GHRAVIFDR  GV+  V+GEGTHFLIPW+QKPII+D R+RPRNVPV TGSKDLQ VNITLRIL++P A  LP+IYT++G D++ERVLPSIT E+LK+VVA+FDA +LITQRELVS +V++ LT RA+ FGL+LDD+SLTHLTFG EF++AVE KQVAQQEAERARF+VEKAEQ+K
Sbjct:    5 VFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQK 207          
BLAST of Prohibitin vs. Ensembl Mouse
Match: Phb2 (prohibitin 2 [Source:MGI Symbol;Acc:MGI:102520])

HSP 1 Score: 266.544 bits (680), Expect = 9.405e-88
Identity = 127/235 (54.04%), Postives = 180/235 (76.60%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPD-VIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 902
            ++TV GGHRA+ F+RI GV+ D ++ EG HF IPW Q PIIYDIR RPR +   TGSKDLQ VNI+LR+L +P A+ LP +Y  LGLD+EERVLPSI  EVLK+VVA+F+AS LITQR  VS  +   LT RA +F L+LDD+++T L+F  E++ AVE KQVAQQEA+RA+FLVEKA+QE+   I+ AEG+++AA +L ++ ++   G+I+L++I+ ++ I++ ++ ++N +YL
Sbjct:   40 VFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSK-NPGYIKLRKIRAAQNISKTIATSQNRIYL 273          
BLAST of Prohibitin vs. Ensembl Mouse
Match: Phb2 (prohibitin 2 [Source:MGI Symbol;Acc:MGI:102520])

HSP 1 Score: 135.961 bits (341), Expect = 1.909e-39
Identity = 64/101 (63.37%), Postives = 77/101 (76.24%), Query Frame = 3
Query:  270 IGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKV 572
            + EG HF IPW Q PIIYDIR RPR +   TGSKDLQ VNI+LR+L +P A+ LP +Y  LGLD+EERVLPSI  EVLK+VVA+F+AS LITQR   S+ +
Sbjct:    1 LAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQFSDPL 101          
BLAST of Prohibitin vs. Ensembl Mouse
Match: Phb2 (prohibitin 2 [Source:MGI Symbol;Acc:MGI:102520])

HSP 1 Score: 120.168 bits (300), Expect = 8.784e-33
Identity = 69/181 (38.12%), Postives = 104/181 (57.46%), Query Frame = 3
Query:  360 TGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 902
            TGSKDLQ VNI+LR+L +P A+ LP +Y  LGLD+EERVLPSI  EVLK+VVA+F+AS LITQR                                                    A+FLVEKA+QE+   I+ AEG+++AA +L ++ ++   G+I+L++I+ ++ I++ ++ ++N +YL
Sbjct:    4 TGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQR----------------------------------------------------AQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSK-NPGYIKLRKIRAAQNISKTIATSQNRIYL 131          
BLAST of Prohibitin vs. UniProt/SwissProt
Match: sp|P24156|L2CC_DROME (Protein l(2)37Cc OS=Drosophila melanogaster OX=7227 GN=l(2)37Cc PE=2 SV=2)

HSP 1 Score: 360.918 bits (925), Expect = 2.077e-124
Identity = 168/246 (68.29%), Postives = 210/246 (85.37%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLPA 938
            LY V GGHRAVIFDR +G++ +V+GEGTHF IPW+Q+PII+DIR++PRNVPV TGSKDLQ VNITLRILY+P  + LPKIYT LG D++ERVLPSI  EVLK VVAQFDA +LITQRE+VS +V++ LT RA  FG +LDDISLTHLTFG EF+ AVE+KQVAQQEAE+ARF+VEKAEQ+KLA+IISAEGD++AA LLAKSF + G+G +EL+RI+ +E+IA  LS+++ + YLP  Q TL++LP+
Sbjct:   27 LYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNVPVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYLPSGQSTLLNLPS 272          
BLAST of Prohibitin vs. UniProt/SwissProt
Match: sp|P67779|PHB_RAT (Prohibitin OS=Rattus norvegicus OX=10116 GN=Phb PE=1 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 6.655e-123
Identity = 181/267 (67.79%), Postives = 225/267 (84.27%), Query Frame = 3
Query:  135 VFDLLAKFXXXXXXXXXXXXXXLYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLP 935
            VF+ + KFG+A+AVAGGV +SALY V  GHRAVIFDR  GV+  V+GEGTHFLIPW+QKPII+D R+RPRNVPV TGSKDLQ VNITLRIL++P A  LP+IYT++G D++ERVLPSIT E+LK+VVA+FDA +LITQRELVS +V++ LT RA+ FGL+LDD+SLTHLTFG EF++AVE KQVAQQEAERARF+VEKAEQ+K AAIISAEGDS+AA L+A S    G+G IEL++++ +E+IA  LS+++NI YLP  Q  L+ LP
Sbjct:    5 VFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLP 271          
BLAST of Prohibitin vs. UniProt/SwissProt
Match: sp|P67778|PHB_MOUSE (Prohibitin OS=Mus musculus OX=10090 GN=Phb PE=1 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 6.655e-123
Identity = 181/267 (67.79%), Postives = 225/267 (84.27%), Query Frame = 3
Query:  135 VFDLLAKFXXXXXXXXXXXXXXLYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLP 935
            VF+ + KFG+A+AVAGGV +SALY V  GHRAVIFDR  GV+  V+GEGTHFLIPW+QKPII+D R+RPRNVPV TGSKDLQ VNITLRIL++P A  LP+IYT++G D++ERVLPSIT E+LK+VVA+FDA +LITQRELVS +V++ LT RA+ FGL+LDD+SLTHLTFG EF++AVE KQVAQQEAERARF+VEKAEQ+K AAIISAEGDS+AA L+A S    G+G IEL++++ +E+IA  LS+++NI YLP  Q  L+ LP
Sbjct:    5 VFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLP 271          
BLAST of Prohibitin vs. UniProt/SwissProt
Match: sp|P84173|PHB_CHICK (Prohibitin OS=Gallus gallus OX=9031 GN=PHB PE=1 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 1.112e-122
Identity = 177/267 (66.29%), Postives = 224/267 (83.90%), Query Frame = 3
Query:  135 VFDLLAKFXXXXXXXXXXXXXXLYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLP 935
            VF+ + KFG+ +AVAGGV +SALY V  GHRAVIFDR  GV+  V+GEGTHFLIPW+QKPII+D R+RPRN+PV TGSKDLQ VNITLRIL++P    LP+I+T++G D++ERVLPSIT E+LK+VVA+FDA +LITQRELVS +V+E LT RA+ FGL+LDD+SLTHLTFG EF++AVE+KQVAQQEAERARF+VEKAEQ+K AA+ISAEGDS+AA L+A S    G+G IEL++++ +E+IA  LS+++NI YLP  Q  L+ LP
Sbjct:    5 VFESIGKFGLGLAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDTVVGEGTHFLIPWVQKPIIFDCRSRPRNIPVITGSKDLQNVNITLRILFRPVTAQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSEDLTERAATFGLILDDVSLTHLTFGKEFTEAVEMKQVAQQEAERARFIVEKAEQQKKAAVISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPSGQSVLLQLP 271          
BLAST of Prohibitin vs. UniProt/SwissProt
Match: sp|P35232|PHB_HUMAN (Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 3.039e-122
Identity = 180/267 (67.42%), Postives = 225/267 (84.27%), Query Frame = 3
Query:  135 VFDLLAKFXXXXXXXXXXXXXXLYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLP 935
            VF+ + KFG+A+AVAGGV +SALY V  GHRAVIFDR  GV+  V+GEGTHFLIPW+QKPII+D R+RPRNVPV TGSKDLQ VNITLRIL++P A  LP+I+T++G D++ERVLPSIT E+LK+VVA+FDA +LITQRELVS +V++ LT RA+ FGL+LDD+SLTHLTFG EF++AVE KQVAQQEAERARF+VEKAEQ+K AAIISAEGDS+AA L+A S    G+G IEL++++ +E+IA  LS+++NI YLP  Q  L+ LP
Sbjct:    5 VFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLP 271          
BLAST of Prohibitin vs. TrEMBL
Match: A0A430QDG4 (Prohibitin OS=Schistosoma bovis OX=6184 GN=DC041_0004608 PE=3 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 3.766e-133
Identity = 186/246 (75.61%), Postives = 214/246 (86.99%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLPA 938
            LY V GGHRAVIFDR  GVRPDV GEGTHF+IPW+QKPII+DIR+RPRNVPV TGSKDLQ VNITLRIL++P+   LPKIY NLG D+EERVLPSIT EVLK VVAQFDAS+LITQRELVS +VNE LT RAS+FG++LDDI+LT ++FG EFS+AVE KQVAQQEAERAR+LVEKAEQ KLAAIISAEGDS+AA LL+KSF   GEG IEL+RI+ +E+IA  LSKN+NI Y+PD Q TL++LPA
Sbjct:   26 LYNVDGGHRAVIFDRFKGVRPDVRGEGTHFIIPWVQKPIIFDIRSRPRNVPVMTGSKDLQTVNITLRILFRPEPSTLPKIYQNLGFDYEERVLPSITTEVLKAVVAQFDASELITQRELVSQRVNEDLTQRASSFGILLDDIALTQISFGREFSEAVEAKQVAQQEAERARYLVEKAEQHKLAAIISAEGDSEAATLLSKSFGSSGEGLIELRRIEAAEDIAYQLSKNRNITYIPDGQHTLLNLPA 271          
BLAST of Prohibitin vs. TrEMBL
Match: A0A5K4FC32 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 5.300e-133
Identity = 186/246 (75.61%), Postives = 214/246 (86.99%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLPA 938
            LY V GGHRAVIFDR  GVRPDV GEGTHF+IPW+QKPII+DIR+RPRNVPV TGSKDLQ VNITLRIL++P+   LPKIY NLG D+EERVLPSIT EVLK VVAQFDAS+LITQRELVS +VNE LT RAS+FG++LDDI+LT ++FG EFS+AVE KQVAQQEAERAR+LVEKAEQ KLAAIISAEGDS+AA LL+KSF   GEG IEL+RI+ +E+IA  LSKN+NI Y+PD Q TL++LPA
Sbjct:   27 LYNVDGGHRAVIFDRFKGVRPDVRGEGTHFIIPWVQKPIIFDIRSRPRNVPVMTGSKDLQTVNITLRILFRPEPSTLPKIYQNLGFDYEERVLPSITTEVLKAVVAQFDASELITQRELVSQRVNEDLTQRASSFGILLDDIALTQISFGREFSEAVEAKQVAQQEAERARYLVEKAEQHKLAAIISAEGDSEAATLLSKSFGSSGEGLIELRRIEAAEDIAYQLSKNRNITYIPDGQHTLLNLPA 272          
BLAST of Prohibitin vs. TrEMBL
Match: A0A0V0J2R0 (Prohibitin (Fragment) OS=Schistocephalus solidus OX=70667 GN=L2CC PE=3 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 7.151e-133
Identity = 183/245 (74.69%), Postives = 217/245 (88.57%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLP 935
            LY V GGHRAVIFDR  GVR +VIGEGTHF+IPW+QKPIIYDIR++PRN+PV TGSKDLQ VNITLRILY+PKAE+LPKIY+NLG D+EERVLPSIT EVLK VVAQFDAS+LITQRE+VS +V++ LT RAS+FG++LDDI+LT ++F TEF+ AVE KQVAQQEAERARFLVEKAEQ+KLAA+ISAEGDS+AA LLAK+F   G+G IEL+RI+TSE+IA  LSKN+N+ YLPD Q  L++LP
Sbjct:   20 LYNVDGGHRAVIFDRFKGVRENVIGEGTHFIIPWVQKPIIYDIRSKPRNIPVMTGSKDLQNVNITLRILYRPKAELLPKIYSNLGFDYEERVLPSITTEVLKAVVAQFDASELITQREVVSQRVSDSLTERASSFGILLDDIALTQISFSTEFAAAVEAKQVAQQEAERARFLVEKAEQQKLAAVISAEGDSEAATLLAKAFGGSGDGLIELRRIETSEDIAYQLSKNRNVSYLPDGQHALLNLP 264          
BLAST of Prohibitin vs. TrEMBL
Match: A0A183TP29 (Prohibitin OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS18227 PE=3 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 8.831e-133
Identity = 183/245 (74.69%), Postives = 217/245 (88.57%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLP 935
            LY V GGHRAVIFDR  GVR +VIGEGTHF+IPW+QKPIIYDIR++PRN+PV TGSKDLQ VNITLRILY+PKAE+LPKIY+NLG D+EERVLPSIT EVLK VVAQFDAS+LITQRE+VS +V++ LT RAS+FG++LDDI+LT ++F TEF+ AVE KQVAQQEAERARFLVEKAEQ+KLAA+ISAEGDS+AA LLAK+F   G+G IEL+RI+TSE+IA  LSKN+N+ YLPD Q  L++LP
Sbjct:   30 LYNVDGGHRAVIFDRFKGVRENVIGEGTHFIIPWVQKPIIYDIRSKPRNIPVMTGSKDLQNVNITLRILYRPKAELLPKIYSNLGFDYEERVLPSITTEVLKAVVAQFDASELITQREVVSQRVSDSLTERASSFGILLDDIALTQISFSTEFAAAVEAKQVAQQEAERARFLVEKAEQQKLAAVISAEGDSEAATLLAKAFGGSGDGLIELRRIETSEDIAYQLSKNRNVSYLPDGQHALLNLP 274          
BLAST of Prohibitin vs. TrEMBL
Match: Q5DE25 (Prohibitin OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 5.155e-132
Identity = 185/246 (75.20%), Postives = 214/246 (86.99%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLPA 938
            LY V GGHRAVIFDR  GVR DV GEGTHF+IPW+QKPII+DIR+RPRNVPV TGSKDLQ VNITLRIL++P+  +LPKIY NLG D+EERVLPSIT EVLK VVAQFDAS+LITQRELVS +VNE LT RAS+FG++LDDI+LT ++FG EFS+AVE KQVAQQEAERAR+LVEKAEQ KLAAIISAEGDS+AA LL+KSF   GEG IEL+RI+ +E+IA  LSKN+NI Y+PD Q TL++LPA
Sbjct:   27 LYNVEGGHRAVIFDRFKGVRSDVRGEGTHFIIPWVQKPIIFDIRSRPRNVPVMTGSKDLQTVNITLRILFRPEPSVLPKIYQNLGFDYEERVLPSITTEVLKAVVAQFDASELITQRELVSQRVNEDLTERASSFGILLDDIALTQISFGREFSEAVEAKQVAQQEAERARYLVEKAEQHKLAAIISAEGDSEAATLLSKSFGSSGEGLIELRRIEAAEDIAYQLSKNRNITYIPDGQHTLLNLPA 272          
BLAST of Prohibitin vs. Ensembl Cavefish
Match: phb (prohibitin [Source:NCBI gene;Acc:103031128])

HSP 1 Score: 356.295 bits (913), Expect = 1.331e-123
Identity = 168/245 (68.57%), Postives = 207/245 (84.49%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLP 935
            L+ V  GHRAVIFDR  GV+  V+GEGTHFLIPW+QKPII+D R+RPRNVPV TGSKDLQ VNITLRIL++P A  LP+I+T++G D++ERVLPSIT EVLK VVA+FDA +LITQRELVS +V+E LT RAS FGL+LDD+SLTHLTFG EF++AVE+KQVAQQEAERARF+VEKAEQ+K AAIISA GDSQAA L+A S    G+G +EL++++ +E+IA  LS+++N+ YLP  QGTL+ LP
Sbjct:   26 LFNVDAGHRAVIFDRFRGVQDAVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVVTGSKDLQNVNITLRILFRPVANQLPRIFTSIGEDYDERVLPSITTEVLKAVVARFDAGELITQRELVSRQVSEDLTERASTFGLILDDVSLTHLTFGKEFTEAVEMKQVAQQEAERARFVVEKAEQQKQAAIISAAGDSQAALLIADSLAVAGDGLVELRKLEAAEDIAFQLSRSRNVTYLPSGQGTLLQLP 270          
BLAST of Prohibitin vs. Ensembl Cavefish
Match: phb2a (prohibitin-2-like [Source:NCBI gene;Acc:103035142])

HSP 1 Score: 254.988 bits (650), Expect = 2.675e-83
Identity = 125/235 (53.19%), Postives = 175/235 (74.47%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPD-VIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 902
            +YTV GG RA+IF+RI G+  D V+ EG HF IPW Q PIIYDIR RPR +   TGSKDLQ VNI LR+L +P A  LP +Y +LG+D++ERVLPSI  EVLK+VVA+F+AS LITQR  VS  +   L  RA +F ++LDD+++T L+F  E++ AVE KQVAQQEA+RA+F VEKA+Q++   II AEG+++AA LL ++  +   G+++L+RI+ ++ IA+ ++ ++N +YL
Sbjct:   48 MYTVEGGQRAIIFNRIGGMEKDTVLAEGLHFRIPWFQYPIIYDIRARPRKISSLTGSKDLQMVNIALRVLSRPVASNLPFLYQHLGVDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSMLIRRELIERAKDFNIILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFYVEKAKQDQRQKIIQAEGEAEAAKLLGEAVTK-NPGYLKLRRIRAAQNIAKTVASSQNKLYL 281          
BLAST of Prohibitin vs. Ensembl Cavefish
Match: phb2b (prohibitin-2-like [Source:NCBI gene;Acc:103047478])

HSP 1 Score: 251.521 bits (641), Expect = 6.557e-82
Identity = 122/234 (52.14%), Postives = 174/234 (74.36%), Query Frame = 3
Query:  204 YTVPGGHRAVIFDRISGVRPD-VIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 902
            YTV GG RA++F+R+ G++ D V+ EG HF IPW Q PIIYDIR +PR +   TGSKDLQ VNI LR+L +P A  LP +Y +LG D++ERVLPSI  EVLK+VVA+F+AS L+TQR  VS  +   L  RA +F ++LDD+++T L+F  E++ AVE KQVAQQEA+RA+F VEKA+QE+   II AEG+++AA +L ++  +   G+++L+RI+ ++ IA+ ++ ++N VYL
Sbjct:   49 YTVEGGQRAIVFNRVGGMQMDTVLSEGLHFRIPWFQYPIIYDIRAKPRKISSLTGSKDLQMVNIALRVLSRPVASNLPYMYQHLGKDYDERVLPSIVNEVLKSVVAKFNASQLLTQRAQVSLLIRRELFERAKDFNIILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFFVEKAKQEQKQKIIQAEGEAEAAKMLGEAVTK-NPGYLKLRRIRAAQNIAKTVAASQNKVYL 281          
BLAST of Prohibitin vs. Ensembl Cavefish
Match: phb2a (prohibitin-2-like [Source:NCBI gene;Acc:103035142])

HSP 1 Score: 248.44 bits (633), Expect = 3.668e-80
Identity = 123/227 (54.19%), Postives = 169/227 (74.45%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPD-VIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLS 878
            +YTV GG RA+IF+RI G+  D V+ EG HF IPW Q PIIYDIR RPR +   TGSKDLQ VNI LR+L +P A  LP +Y +LG+D++ERVLPSI  EVLK+VVA+F+AS LITQR  VS  +   L  RA +F ++LDD+++T L+F  E++ AVE KQVAQQEA+RA+F VEKA+Q++   II AEG+++AA LL ++  +   G+++L+RI+ ++ IA+ +S
Sbjct:   48 MYTVEGGQRAIIFNRIGGMEKDTVLAEGLHFRIPWFQYPIIYDIRARPRKISSLTGSKDLQMVNIALRVLSRPVASNLPFLYQHLGVDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSMLIRRELIERAKDFNIILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFYVEKAKQDQRQKIIQAEGEAEAAKLLGEAVTK-NPGYLKLRRIRAAQNIAKTVS 273          
BLAST of Prohibitin vs. Ensembl Cavefish
Match: phb2b (prohibitin-2-like [Source:NCBI gene;Acc:103047478])

HSP 1 Score: 242.662 bits (618), Expect = 1.103e-78
Identity = 125/239 (52.30%), Postives = 172/239 (71.97%), Query Frame = 3
Query:  204 YTVPGGHRAVIFDRISGVRPD-VIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQT----SEEIARLLSKN-KNIVYL 902
            YTV GG RA++F+R+ G++ D V+ EG HF IPW Q PIIYDIR +PR +   TGSKDLQ VNI LR+L +P A  LP +Y +LG D++ERVLPSI  EVLK+VVA+F+AS L+TQR  VS  +   L  RA +F ++LDD+++T L+F  E++ AVE KQVAQQEA+RA+F VEKA+QE+   II AEG+++AA +L ++  +   G+++L+RI+     +   +  LSKN KN VYL
Sbjct:   30 YTVEGGQRAIVFNRVGGMQMDTVLSEGLHFRIPWFQYPIIYDIRAKPRKISSLTGSKDLQMVNIALRVLSRPVASNLPYMYQHLGKDYDERVLPSIVNEVLKSVVAKFNASQLLTQRAQVSLLIRRELFERAKDFNIILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFFVEKAKQEQKQKIIQAEGEAEAAKMLGEAVTK-NPGYLKLRRIRAVFLLTVVCSCFLSKNRKNKVYL 267          
BLAST of Prohibitin vs. Ensembl Sea Lamprey
Match: phb (prohibitin [Source:ZFIN;Acc:ZDB-GENE-030131-6577])

HSP 1 Score: 344.354 bits (882), Expect = 1.805e-119
Identity = 161/244 (65.98%), Postives = 204/244 (83.61%), Query Frame = 3
Query:  207 TVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLPA 938
            TV GGHRAVIFDR  GV+  V+GEGTHF+IPW+Q+PII+D R+RPRNVPV TGSKD+Q VNITLRIL++P A  LPKIY ++G D++ERVLPSIT EVLK VVA+FDA +LITQRELVS +V+  L  RA+ FGL+LDD+SLTHLTFG EF+ AVE KQVAQQEAERARF+VE+AEQ+K AAII+AEGD++AA L+A + ++ GEG +EL++++ +E+IA  LSK++ + YLP  Q TL+ LPA
Sbjct:   27 TVEGGHRAVIFDRFRGVQDLVVGEGTHFVIPWVQRPIIFDCRSRPRNVPVVTGSKDMQNVNITLRILFRPIASQLPKIYMSIGEDYDERVLPSITTEVLKAVVARFDAGELITQRELVSRQVSNDLMERAATFGLILDDVSLTHLTFGREFTQAVEAKQVAQQEAERARFVVERAEQQKKAAIIAAEGDAKAAQLIATAISEAGEGLVELRKLEAAEDIAMQLSKSRGVAYLPSGQHTLLQLPA 270          
BLAST of Prohibitin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006512.1 (pep scaffold:Pmarinus_7.0:GL479067:257:4164:-1 gene:ENSPMAG00000005886.1 transcript:ENSPMAT00000006512.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.836 bits (390), Expect = 7.992e-47
Identity = 73/120 (60.83%), Postives = 91/120 (75.83%), Query Frame = 3
Query:  204 YTVPGGHRAVIFDRISGVRPD-VIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELV 560
            YTV GG RA+IF R+ G++ + ++ EG HF IPW   PIIYDIR +PR +   TGSKDLQ VNITLR+L +P A  LP+++  LGLD+EERVLPSI  EVLK+VVA+F+AS LITQR  V
Sbjct:   41 YTVDGGQRAIIFSRLGGIQENTILAEGLHFRIPWFHYPIIYDIRAKPRKISSPTGSKDLQMVNITLRVLSRPDALKLPRMFQQLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQV 160          
BLAST of Prohibitin vs. Ensembl Yeast
Match: PHB1 (Subunit of the prohibitin complex (Phb1p-Phb2p); prohibitin is a 1.2 MDa ring-shaped inner mitochondrial membrane chaperone that stabilizes newly synthesized proteins; determinant of replicative life span; involved in mitochondrial segregation; prohibitin deficiency induces a mitochondrial unfolded protein response (mtUPR) [Source:SGD;Acc:S000003364])

HSP 1 Score: 310.457 bits (794), Expect = 4.053e-106
Identity = 134/238 (56.30%), Postives = 198/238 (83.19%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQ 914
            +Y V GG R VIFDRI+GV+  V+GEGTHFL+PW+QK IIYD+RT+P+++  NTG+KDLQ V++TLR+L++P+   LP IY NLGLD++ERVLPSI  EVLK++VAQFDA++LITQRE++S K+ + L++RA+ FG+ L+D+S+TH+TFG EF+ AVE KQ+AQQ+AERA+FLVEKAEQE+ A++I AEG++++A  ++K+  + G+G + ++R++ S++IA+ L+ + N+VYLP + 
Sbjct:   29 MYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPSQH 266          
BLAST of Prohibitin vs. Ensembl Yeast
Match: PHB2 (Subunit of the prohibitin complex (Phb1p-Phb2p); prohibitin is a 1.2 MDa ring-shaped inner mitochondrial membrane chaperone that stabilizes newly synthesized proteins; determinant of replicative life span; involved in mitochondrial segregation; prohibitin deficiency induces a mitochondrial unfolded protein response (mtUPR) [Source:SGD;Acc:S000003463])

HSP 1 Score: 260.381 bits (664), Expect = 3.688e-86
Identity = 123/243 (50.62%), Postives = 177/243 (72.84%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLIS 929
            L+ V GGHRA+++ RI GV   +  EGTHF+ PW+  PIIYD+R +PRNV   TG+KDLQ VNIT R+L +P    LP IY  LG D++ERVLPSI  EVLK VVAQF+AS LITQRE VS  + E L  RAS F ++LDD+S+T++TF  EF++AVE KQ+AQQ+A+RA F+V+KA QEK   ++ A+G++++A L+ ++  +  + ++EL+R+ T+ +IA++L+ + N V L D +  L++
Sbjct:   58 LFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQEKQGMVVRAQGEAKSAELIGEAIKKSRD-YVELKRLDTARDIAKILASSPNRVIL-DNEALLLN 298          
BLAST of Prohibitin vs. Ensembl Nematostella
Match: EDO49486 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG85])

HSP 1 Score: 379.793 bits (974), Expect = 3.964e-133
Identity = 176/245 (71.84%), Postives = 214/245 (87.35%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLP 935
            L+ V GGHRAVIFDR  GV+PDV+GEGTHFLIPW+Q+PII+DIRTRPRNVPV TGSKDLQ VNITLRILY+P+ ++LPKIY NLG D++ERVLPSIT EVLK VVAQFDA +LITQRE+VS KV E LT RAS+FGL+LDDISLTHLTFG EF++AVELKQVAQQ+AERARFLVE+AEQ+K AA+ISAEGD++ A LLA++F + GEG +EL++I+ SEEIA  +S+++N+ YLP  Q  L++LP
Sbjct:   27 LFNVDGGHRAVIFDRFQGVKPDVVGEGTHFLIPWVQRPIIFDIRTRPRNVPVTTGSKDLQNVNITLRILYRPQPQVLPKIYMNLGEDYDERVLPSITTEVLKAVVAQFDAGELITQREMVSQKVQEDLTERASSFGLVLDDISLTHLTFGKEFTEAVELKQVAQQDAERARFLVERAEQQKKAAVISAEGDARGAALLAQAFKEAGEGLVELRKIEASEEIAERMSRSRNVAYLPGGQKMLLNLP 271          
BLAST of Prohibitin vs. Ensembl Nematostella
Match: EDO42348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1L7])

HSP 1 Score: 270.011 bits (689), Expect = 1.246e-89
Identity = 134/244 (54.92%), Postives = 182/244 (74.59%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISL 932
            +YTV GGHRA+IF RI GV+  V  EG HF IPW Q PIIYDIR+RPR +   TGSKDLQ VNI LR+L +P+A  LP +Y  LGLDF+ERVLPSI  EVLK+VVAQF+AS LIT R+ VS  +   L  RA +F ++LDD+S+T L+FG E++ A+E KQVAQQEA+RA+F+VEKA QE+   I+ AEG++QAA LL ++      G++ L++I+ +++I+R+++ ++N VYL D  G L++L
Sbjct:   40 VYTVDGGHRAIIFSRIGGVQDTVYTEGLHFRIPWFQYPIIYDIRSRPRKIISPTGSKDLQMVNIGLRVLARPEANKLPPMYRKLGLDFDERVLPSIMNEVLKSVVAQFNASQLITMRQQVSLLIRRQLMERARDFYIILDDVSITDLSFGKEYTSAIEAKQVAQQEAQRAQFIVEKAIQERQQKIVQAEGEAQAAKLLGEALKD-NPGYLRLRKIRAAQKISRVIAASQNPVYL-DSDGLLLNL 281          
BLAST of Prohibitin vs. Ensembl Medaka
Match: phb (prohibitin [Source:NCBI gene;Acc:101158276])

HSP 1 Score: 349.362 bits (895), Expect = 9.714e-121
Identity = 164/244 (67.21%), Postives = 204/244 (83.61%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISL 932
            LY V  GHRAVIFDR  GV+  V+GEGTHFLIPW+QKP+I+D R+RPRNVPV TGSKDLQ VNITLRIL++P    LP+I+T++G D++ERVLPSIT EVLK VVA+FDA +LITQRELVS +V+E LT RA+ FGL+LDD+SLTHLTFG EF++AVE+KQVAQQEAERARF+VEKAEQ+K A IISAEGDSQAA L+A S    G+G +EL++++ +E+IA  L++++N+ YLP  QGTL  L
Sbjct:   26 LYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPVIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVTSQLPRIFTSIGEDYDERVLPSITTEVLKAVVARFDAGELITQRELVSRQVSEDLTERATTFGLILDDVSLTHLTFGKEFTEAVEMKQVAQQEAERARFVVEKAEQQKQATIISAEGDSQAALLIANSLMDAGDGLVELRKLEAAEDIAFQLARSRNVTYLPSGQGTLFQL 269          
BLAST of Prohibitin vs. Ensembl Medaka
Match: phb (prohibitin [Source:NCBI gene;Acc:101158276])

HSP 1 Score: 349.747 bits (896), Expect = 1.495e-120
Identity = 164/244 (67.21%), Postives = 204/244 (83.61%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISL 932
            LY V  GHRAVIFDR  GV+  V+GEGTHFLIPW+QKP+I+D R+RPRNVPV TGSKDLQ VNITLRIL++P    LP+I+T++G D++ERVLPSIT EVLK VVA+FDA +LITQRELVS +V+E LT RA+ FGL+LDD+SLTHLTFG EF++AVE+KQVAQQEAERARF+VEKAEQ+K A IISAEGDSQAA L+A S    G+G +EL++++ +E+IA  L++++N+ YLP  QGTL  L
Sbjct:   54 LYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPVIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVTSQLPRIFTSIGEDYDERVLPSITTEVLKAVVARFDAGELITQRELVSRQVSEDLTERATTFGLILDDVSLTHLTFGKEFTEAVEMKQVAQQEAERARFVVEKAEQQKQATIISAEGDSQAALLIANSLMDAGDGLVELRKLEAAEDIAFQLARSRNVTYLPSGQGTLFQL 297          
BLAST of Prohibitin vs. Ensembl Medaka
Match: phb2b (prohibitin 2 [Source:NCBI gene;Acc:101159337])

HSP 1 Score: 254.988 bits (650), Expect = 3.052e-83
Identity = 123/234 (52.56%), Postives = 176/234 (75.21%), Query Frame = 3
Query:  204 YTVPGGHRAVIFDRISGVRPD-VIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 902
            YTV GGHRA++F+RI G++ D ++ EG HF IPWIQ PIIYDIR +PR +   TGSKDLQ VNI +R+L +P A  LP +Y  LG D++ERVLPSI  EVLK+VVA+F+AS LITQR  VS  V   L  RA +F ++LDD+S+T L+F ++++ AVE KQVAQQEA+RA+F VEKA+Q++   II AEG+++AA +L ++  +   G+++L+RI+ ++ IA+ ++ ++N +YL
Sbjct:   49 YTVEGGHRAIVFNRIGGMQMDTILSEGLHFRIPWIQYPIIYDIRAKPRKISSLTGSKDLQMVNIAVRVLSRPLASNLPIMYQQLGKDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLVRRELYDRAKDFNIILDDVSITELSFSSQYTAAVEAKQVAQQEAQRAQFYVEKAKQDQRQKIIQAEGEAEAAKMLGQAVTK-NPGYLKLRRIRAAQNIAKTVAASQNRIYL 281          
BLAST of Prohibitin vs. Planmine SMEST
Match: SMESG000038397.1 (SMESG000038397.1)

HSP 1 Score: 518.85 bits (1335), Expect = 0.000e+0
Identity = 270/270 (100.00%), Postives = 270/270 (100.00%), Query Frame = 3
Query:  129 MAVFDLLAKFXXXXXXXXXXXXXXLYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLPA 938
            MAVFDLLAKFGVAVAVAGGVASSALYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLPA
Sbjct:    1 MAVFDLLAKFGVAVAVAGGVASSALYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYLPDKQGTLISLPA 270          
BLAST of Prohibitin vs. Planmine SMEST
Match: SMESG000021272.1 (SMESG000021272.1)

HSP 1 Score: 247.284 bits (630), Expect = 6.700e-81
Identity = 116/234 (49.57%), Postives = 173/234 (73.93%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 902
             YTV GG R++IF R  G++ ++  EG H  IP IQ PII+D+R+RPR +   TGSKDLQ VNI+LR+L +P    +P IY N+G D++E+VLPSI+ EVLK VVA+F+A  LITQRE VS  + ++L  RA +F +++DD+S+T L+F  ++S+AVE KQ++QQEA+RA+F V +A+QE+   I++AEG++QAA L+  +  Q   G+++L++I+ +E+IAR LS ++N  YL
Sbjct:    5 FYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAQDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSS-GYLKLRKIKAAEKIARTLSTSQNKAYL 237          
BLAST of Prohibitin vs. Planmine SMEST
Match: SMESG000021272.1 (SMESG000021272.1)

HSP 1 Score: 247.284 bits (630), Expect = 1.518e-80
Identity = 116/234 (49.57%), Postives = 173/234 (73.93%), Query Frame = 3
Query:  201 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 902
             YTV GG R++IF R  G++ ++  EG H  IP IQ PII+D+R+RPR +   TGSKDLQ VNI+LR+L +P    +P IY N+G D++E+VLPSI+ EVLK VVA+F+A  LITQRE VS  + ++L  RA +F +++DD+S+T L+F  ++S+AVE KQ++QQEA+RA+F V +A+QE+   I++AEG++QAA L+  +  Q   G+++L++I+ +E+IAR LS ++N  YL
Sbjct:   33 FYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAQDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSS-GYLKLRKIKAAEKIARTLSTSQNKAYL 265          
The following BLAST results are available for this feature:
BLAST of Prohibitin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PHB6.329e-12367.42prohibitin [Source:HGNC Symbol;Acc:HGNC:8912][more]
PHB6.329e-12367.42prohibitin [Source:HGNC Symbol;Acc:HGNC:8912][more]
PHB6.329e-12367.42prohibitin [Source:HGNC Symbol;Acc:HGNC:8912][more]
PHB2.465e-11369.01prohibitin [Source:HGNC Symbol;Acc:HGNC:8912][more]
PHB3.589e-10272.64prohibitin [Source:HGNC Symbol;Acc:HGNC:8912][more]
back to top
BLAST of Prohibitin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
phb-12.219e-11165.57Mitochondrial prohibitin complex protein 1 [Sourc... [more]
phb-29.178e-8252.77Mitochondrial prohibitin complex protein 2 [Sourc... [more]
phb-29.178e-8252.77Mitochondrial prohibitin complex protein 2 [Sourc... [more]
back to top
BLAST of Prohibitin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l(2)37Cc2.072e-12568.29gene:FBgn0002031 transcript:FBtr0081164[more]
l(2)37Cc2.072e-12568.29gene:FBgn0002031 transcript:FBtr0081165[more]
l(2)37Cc2.072e-12568.29gene:FBgn0002031 transcript:FBtr0346428[more]
Phb26.704e-8551.28gene:FBgn0010551 transcript:FBtr0086614[more]
Phb26.704e-8551.28gene:FBgn0010551 transcript:FBtr0086615[more]
back to top
BLAST of Prohibitin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phb5.917e-12569.39prohibitin [Source:ZFIN;Acc:ZDB-GENE-030131-6577][more]
phb2b1.508e-8354.70prohibitin 2b [Source:ZFIN;Acc:ZDB-GENE-040718-430... [more]
phb2b1.508e-8354.70prohibitin 2b [Source:ZFIN;Acc:ZDB-GENE-040718-430... [more]
phb2b1.508e-8354.70prohibitin 2b [Source:ZFIN;Acc:ZDB-GENE-040718-430... [more]
phb2a2.590e-8253.42prohibitin 2a [Source:ZFIN;Acc:ZDB-GENE-030131-314... [more]
back to top
BLAST of Prohibitin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
phb6.871e-12165.17prohibitin [Source:NCBI gene;Acc:394635][more]
cgref11.085e-8453.19cell growth regulator with EF-hand domain 1 [Sourc... [more]
cgref11.085e-8453.19cell growth regulator with EF-hand domain 1 [Sourc... [more]
cgref11.088e-8453.19cell growth regulator with EF-hand domain 1 [Sourc... [more]
back to top
BLAST of Prohibitin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Phb9.514e-12467.79prohibitin [Source:MGI Symbol;Acc:MGI:97572][more]
Phb1.262e-9772.41prohibitin [Source:MGI Symbol;Acc:MGI:97572][more]
Phb29.405e-8854.04prohibitin 2 [Source:MGI Symbol;Acc:MGI:102520][more]
Phb21.909e-3963.37prohibitin 2 [Source:MGI Symbol;Acc:MGI:102520][more]
Phb28.784e-3338.12prohibitin 2 [Source:MGI Symbol;Acc:MGI:102520][more]
back to top
BLAST of Prohibitin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P24156|L2CC_DROME2.077e-12468.29Protein l(2)37Cc OS=Drosophila melanogaster OX=722... [more]
sp|P67779|PHB_RAT6.655e-12367.79Prohibitin OS=Rattus norvegicus OX=10116 GN=Phb PE... [more]
sp|P67778|PHB_MOUSE6.655e-12367.79Prohibitin OS=Mus musculus OX=10090 GN=Phb PE=1 SV... [more]
sp|P84173|PHB_CHICK1.112e-12266.29Prohibitin OS=Gallus gallus OX=9031 GN=PHB PE=1 SV... [more]
sp|P35232|PHB_HUMAN3.039e-12267.42Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=... [more]
back to top
BLAST of Prohibitin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430QDG43.766e-13375.61Prohibitin OS=Schistosoma bovis OX=6184 GN=DC041_0... [more]
A0A5K4FC325.300e-13375.61Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A0V0J2R07.151e-13374.69Prohibitin (Fragment) OS=Schistocephalus solidus O... [more]
A0A183TP298.831e-13374.69Prohibitin OS=Schistocephalus solidus OX=70667 GN=... [more]
Q5DE255.155e-13275.20Prohibitin OS=Schistosoma japonicum OX=6182 PE=2 S... [more]
back to top
BLAST of Prohibitin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phb1.331e-12368.57prohibitin [Source:NCBI gene;Acc:103031128][more]
phb2a2.675e-8353.19prohibitin-2-like [Source:NCBI gene;Acc:103035142][more]
phb2b6.557e-8252.14prohibitin-2-like [Source:NCBI gene;Acc:103047478][more]
phb2a3.668e-8054.19prohibitin-2-like [Source:NCBI gene;Acc:103035142][more]
phb2b1.103e-7852.30prohibitin-2-like [Source:NCBI gene;Acc:103047478][more]
back to top
BLAST of Prohibitin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
phb1.805e-11965.98prohibitin [Source:ZFIN;Acc:ZDB-GENE-030131-6577][more]
ENSPMAT00000006512.17.992e-4760.83pep scaffold:Pmarinus_7.0:GL479067:257:4164:-1 gen... [more]
back to top
BLAST of Prohibitin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PHB14.053e-10656.30Subunit of the prohibitin complex (Phb1p-Phb2p); p... [more]
PHB23.688e-8650.62Subunit of the prohibitin complex (Phb1p-Phb2p); p... [more]
back to top
BLAST of Prohibitin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO494863.964e-13371.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423481.246e-8954.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Prohibitin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
phb9.714e-12167.21prohibitin [Source:NCBI gene;Acc:101158276][more]
phb1.495e-12067.21prohibitin [Source:NCBI gene;Acc:101158276][more]
phb2b3.052e-8352.56prohibitin 2 [Source:NCBI gene;Acc:101159337][more]
back to top
BLAST of Prohibitin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000038397.10.000e+0100.00SMESG000038397.1[more]
SMESG000021272.16.700e-8149.57SMESG000021272.1[more]
SMESG000021272.11.518e-8049.57SMESG000021272.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003249 ID=SMED30003249|Name=Prohibitin|organism=Schmidtea mediterranea sexual|type=transcript|length=1005bp
ATTTTTCTACATATTTTTATAATATTTTAATATAATAAATTAAAGGCATT
TTTATTTTTTAATGAATTATGTTAGTTTCTTTAAATGAACTAAATTGGCT
CATTGTTTGAAATTATAAACCGTGATATATGGCAGTCTTTGATTTATTAG
CAAAATTTGGTGTTGCAGTTGCTGTTGCCGGGGGTGTCGCTAGTTCAGCA
TTATATACTGTTCCCGGTGGTCATAGAGCTGTTATTTTTGATCGTATTAG
CGGTGTTCGACCAGATGTTATTGGCGAAGGTACACATTTCCTGATCCCAT
GGATACAAAAGCCAATTATTTATGACATTCGAACTCGCCCAAGAAATGTT
CCAGTTAATACTGGTTCCAAGGATTTACAGAAAGTGAACATAACTCTTAG
AATTTTGTATAAACCTAAAGCTGAAATGTTACCGAAAATCTACACAAATT
TAGGTTTAGATTTTGAAGAAAGAGTTCTTCCATCGATAACATATGAAGTT
TTGAAAACAGTTGTTGCTCAATTTGATGCCAGTGACTTAATCACTCAGAG
AGAATTAGTTAGTAATAAAGTTAATGAAATGCTCACATCTAGGGCTTCTA
ATTTTGGATTAATGCTTGATGATATTTCATTGACTCATTTGACTTTTGGA
ACTGAATTTTCCGATGCCGTCGAATTGAAACAAGTCGCTCAGCAAGAAGC
AGAAAGGGCGAGATTTTTGGTTGAAAAGGCTGAGCAAGAGAAACTAGCAG
CTATTATTAGTGCTGAAGGTGACTCACAAGCTGCCAATTTGCTCGCCAAG
TCATTCAATCAATGCGGCGAAGGATTTATCGAACTGCAAAGAATTCAAAC
CTCTGAAGAAATTGCGCGCTTATTGTCAAAAAATAAAAACATTGTCTACT
TGCCCGATAAACAGGGAACCTTGATCAGTCTCCCTGCATAATGTCTTTAG
TTGCTGTGTCGTAATTATAGAATTAGAAATTTGTCTTTATTGAAAAAAAA
AGATC
back to top

protein sequence of SMED30003249-orf-1

>SMED30003249-orf-1 ID=SMED30003249-orf-1|Name=SMED30003249-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=271bp
MAVFDLLAKFGVAVAVAGGVASSALYTVPGGHRAVIFDRISGVRPDVIGE
GTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEM
LPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNE
MLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEK
AEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLS
KNKNIVYLPDKQGTLISLPA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000429neoblast
PLANA:0002013Category 1 cell
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036013Band_7/SPFH_dom_sf
IPR000163Prohibitin
IPR001107Band_7
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 184..204
NoneNo IPR availableGENE3DG3DSA:3.30.479.30coord: 53..187
e-value: 4.3E-5
score: 25.5
NoneNo IPR availablePANTHERPTHR23222:SF14PROHIBITINcoord: 3..269
IPR000163ProhibitinPRINTSPR00679PROHIBITINcoord: 180..203
score: 80.13
coord: 203..219
score: 54.75
coord: 68..84
score: 63.35
coord: 109..127
score: 69.23
coord: 86..105
score: 55.77
coord: 132..148
score: 59.73
coord: 155..174
score: 58.46
IPR000163ProhibitinPANTHERPTHR23222PROHIBITINcoord: 3..269
IPR000163ProhibitinCDDcd03401SPFH_prohibitincoord: 25..219
e-value: 1.11031E-93
score: 272.465
IPR001107Band 7 domainSMARTSM00244PHB_4coord: 23..185
e-value: 7.0E-42
score: 155.1
IPR001107Band 7 domainPFAMPF01145Band_7coord: 27..204
e-value: 4.8E-24
score: 85.3
IPR036013Band 7/SPFH domain superfamilySUPERFAMILYSSF117892Band 7/SPFH domaincoord: 56..192