SMED30003244

Overview
NameSMED30003244
Smed IDSMED30003244
Length (bp)629
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30003244 (SMED30003244) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30003244 (SMED30003244) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003244

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30003244SMESG000065696.1 SmedASXL_004439SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30003244SMESG000065696.1 dd_Smed_v4_35838_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30003244 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001732:5150..5778 -3019
v31.001732:5409..6774 -1706
v31.001732:6325..7185 -1380
v31.001732:6622..7425 -889
v31.001732:5899..6480 -647
Homology
BLAST of SMED30003244 vs. Planmine SMEST
Match: SMESG000065696.1 (SMESG000065696.1)

HSP 1 Score: 333.954 bits (855), Expect = 1.191e-105
Identity = 200/209 (95.69%), Postives = 202/209 (96.65%), Query Frame = 1
Query:    1 VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDKIIADQXXXXXXXXXXXXXXXXXXXXVEIQALSEFIENRNQSNIDGSVIINKFQLLMECSGSNTNEPGLANHNIANKSIINENQSNLSSIDSSGIEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINKLLLPIECLGSNTDESGL 627
            VDNSSVFPEKSISNEFIE  NQS+IIDSVLIN SQTSIRYLESDKTFVLSNAEDK IADQSIINEISEIPSNLSSIDSSSVEIQALSEFIENRNQSNIDGSVIIN+FQL MECSGSNTNEPGLANHNIANKSIINENQSNLSSIDSSGIEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINKL LPIECLGSN DESGL
Sbjct:  695 VDNSSVFPEKSISNEFIENLNQSDIIDSVLINNSQTSIRYLESDKTFVLSNAEDKNIADQSIINEISEIPSNLSSIDSSSVEIQALSEFIENRNQSNIDGSVIINEFQLPMECSGSNTNEPGLANHNIANKSIINENQSNLSSIDSSGIEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINKLRLPIECLGSNNDESGL 903          

HSP 2 Score: 137.887 bits (346), Expect = 2.671e-37
Identity = 118/229 (51.53%), Postives = 141/229 (61.57%), Query Frame = 1
Query:    1 VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAED-KIIADQXXXXXXXXXXXXXXXX----------XXXXVEIQALSEFIENRNQSNIDGSVIINKFQLLMECSGSNTN--EPGLANHNIANKSIINENQSNLSSID-------SSGIEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINKLLLPIECLGSNTDESGL 627
            V NS + PEKSISNEFIEYRNQSNIIDSVLINKSQTSIRY ESDKTFVLSNAED + I+D+SIINE S++ S LS             S   E    +EFIEN NQS+I  SV+IN  Q  +    S+         + NIA++SIINE    +S I        SS +EI AL+E                  FIEN+NQSNID S++IN+  LP+EC GSNT+E GL
Sbjct:  611 VKNSLLLPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYSESDKTFVLSNAEDGQNISDKSIINENSKMSSKLSHKNLSNKSQVDNSSVFPEKSISNEFIENLNQSDIIDSVLINNSQTSIRYLESDKTFVLSNAEDKNIADQSIINE----ISEIPSNLSSIDSSSVEIQALSE------------------FIENRNQSNIDGSVIINEFQLPMECSGSNTNEPGL 817          

HSP 3 Score: 132.109 bits (331), Expect = 2.894e-35
Identity = 133/281 (47.33%), Postives = 149/281 (53.02%), Query Frame = 1
Query:    1 VDNSSVFPE------KSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAED-KIIADQXXXXXXXXXXXXXXXXXXXXVEIQALS------------------------EFIENRNQSNIDGSVIINKFQLLMECSGSNTN---EPGLANHNIANKSI-------------------------INENQSN------------------------------LSSIDSSGIEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINK 576
            VDNSSV PE      KSISNEFIE  NQSNI DSVLINKSQTSIRYLESDKTFVLSNAED + IAD+SIINE  E+PS LS I+SSS++IQ LS                        EFIENRNQSNI  S +INK Q       SN            N+A+KSI                         +NEN S                               LS I+SSGIEI  L+EQS V NS ++PEK ISN FIE +NQSNI  S+LINK
Sbjct:  363 VDNSSVIPETGEFIEKSISNEFIENLNQSNINDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIINEYREMPSKLSPINSSSIDIQHLSNRSPVDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINKSQSSKRSFQSNKTFVLRNSDEGQNVADKSIPNENPEITYKLSRENSTFREMQSIRLNENPSKINDIINNSHPLINLDSERSILSEIPEIISILSPINSSGIEIETLSEQSPVKNSLLLPEKSISNEFIEYRNQSNIIDSVLINK 643          

HSP 4 Score: 86.2705 bits (212), Expect = 2.043e-19
Identity = 94/254 (37.01%), Postives = 124/254 (48.82%), Query Frame = 1
Query:   43 EFIEYRNQSNIIDSVLINKSQTSIRYLES---DKTFVLSNAEDKIIADQXXXXXXXXXXXXXXXXXXXXVEIQALSE------------------FIENRNQSNIDGSVIINKFQLLMECSGSNTNEPGLANHNIANKSIINE-NQSNLSSIDSSGIEILALTEQSQVDNSSVIPEK-----PI---SNRFI-------------------------ENQNQSNIDRSILINKLLLPIECLG----SNTDESGL 627
            EFIE RNQSNI  SV+IN+ Q  +    S   +      N  +K I +++  N  S   S         +EI AL+E                  FIEN+NQSNID S++INK +L +EC GSN +E GL NHNIANKSIINE  + NL+  D+S + I   +E+      S IPE      P+   S+R+I                         EN NQSN+  S ++N L  P+ECL     SN + SGL
Sbjct:  782 EFIENRNQSNIDGSVIINEFQLPMECSGSNTNEPGLANHNIANKSIINENQSNLSSIDSSG--------IEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINKLRLPIECLGSNNDESGLENHNIANKSIINEYPEMNLNENDNSHLLINTDSER-----FSKIPEMSSKSFPMINSSSRYIDSSRQLLMSNSSKKFNREDFSIEFNENLNQSNVSNSPIVNVLQRPMECLESCKLSNPNASGL 1022          

HSP 5 Score: 85.8853 bits (211), Expect = 2.521e-19
Identity = 94/258 (36.43%), Postives = 126/258 (48.84%), Query Frame = 1
Query:    1 VDNSSVFPE------KSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNA----EDKIIADQXXXXXXXXXXXXXXXXXXXXVEIQALSEFIEN--------------RNQSNIDGSVIINKFQLLMECSGSNTNEPGLANHNIANKSIINENQSNLSSIDSSGIEILA------------------------------------LTEQSQVDNSSVIP------EKPISNRFIENQNQSNIDRSILINK 576
            VDNSSV PE      KSISNEFIE RNQSNIIDS LINKSQ+S R  +S+KTFVL N+      ++++     N       ++S  ++S+ E   LSE                   N+S +D S +I +    +E S SN     L   NI +  +IN++Q+++  ++S    +L+                                    L+ +S VDNSSVIP      EK ISN FIEN+NQSNI  S LINK
Sbjct:  242 VDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINKSQSSKRSFQSNKTFVLRNSIPNENPEMLSKLPHTNSAFREMQSISLNENSNSERSILSEIPPKLPPINSSSIDIQHLSNRSPVDNSSVIPETGEFIEKSISNEFIENLNQSNINDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIINEYREMPSKLSPINSSSIDIQHLSNRSPVDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINK 499          

HSP 6 Score: 67.3958 bits (163), Expect = 6.704e-13
Identity = 62/151 (41.06%), Postives = 76/151 (50.33%), Query Frame = 1
Query:  262 EFIENRNQSNIDGSVIINKFQ-----------LLMECSGSNTNEPGLANHNIAN------------------KSIINENQSNLSSIDSSGIEILALTEQSQVDNSSVIP------EKPISNRFIENQNQSNIDRSILINKLLLPIECLGSN 609
            EFIENRNQSNI  S +INK Q            ++  S  N N   L+     N                  +SI++E    L  I+SS I+I  L+ +S VDNSSVIP      EK ISN FIEN NQSNI+ S+LINK    I  L S+
Sbjct:  262 EFIENRNQSNIIDSGLINKSQSSKRSFQSNKTFVLRNSIPNENPEMLSKLPHTNSAFREMQSISLNENSNSERSILSEIPPKLPPINSSSIDIQHLSNRSPVDNSSVIPETGEFIEKSISNEFIENLNQSNINDSVLINKSQTSIRYLESD 412          

HSP 7 Score: 62.3882 bits (150), Expect = 3.290e-11
Identity = 46/75 (61.33%), Postives = 52/75 (69.33%), Query Frame = 1
Query:  376 HNI-ANKSIINENQ-SNLSSIDSSGIEILALTEQSQVDNSSVIPE------KPISNRFIENQNQSNIDRSILINK 576
            H I A+KSIINEN  S L  I+SS I+I  L+ +S VDNSSVIPE      K ISN FIEN+NQSNI  S LINK
Sbjct:  206 HKINADKSIINENMPSKLHPINSSSIDIQHLSNRSPVDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINK 280          
BLAST of SMED30003244 vs. Planmine SMEST
Match: SMESG000065696.1 (SMESG000065696.1)

HSP 1 Score: 333.954 bits (855), Expect = 1.203e-105
Identity = 200/209 (95.69%), Postives = 202/209 (96.65%), Query Frame = 1
Query:    1 VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDKIIADQXXXXXXXXXXXXXXXXXXXXVEIQALSEFIENRNQSNIDGSVIINKFQLLMECSGSNTNEPGLANHNIANKSIINENQSNLSSIDSSGIEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINKLLLPIECLGSNTDESGL 627
            VDNSSVFPEKSISNEFIE  NQS+IIDSVLIN SQTSIRYLESDKTFVLSNAEDK IADQSIINEISEIPSNLSSIDSSSVEIQALSEFIENRNQSNIDGSVIIN+FQL MECSGSNTNEPGLANHNIANKSIINENQSNLSSIDSSGIEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINKL LPIECLGSN DESGL
Sbjct:  696 VDNSSVFPEKSISNEFIENLNQSDIIDSVLINNSQTSIRYLESDKTFVLSNAEDKNIADQSIINEISEIPSNLSSIDSSSVEIQALSEFIENRNQSNIDGSVIINEFQLPMECSGSNTNEPGLANHNIANKSIINENQSNLSSIDSSGIEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINKLRLPIECLGSNNDESGL 904          

HSP 2 Score: 137.887 bits (346), Expect = 2.723e-37
Identity = 118/229 (51.53%), Postives = 141/229 (61.57%), Query Frame = 1
Query:    1 VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAED-KIIADQXXXXXXXXXXXXXXXX----------XXXXVEIQALSEFIENRNQSNIDGSVIINKFQLLMECSGSNTN--EPGLANHNIANKSIINENQSNLSSID-------SSGIEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINKLLLPIECLGSNTDESGL 627
            V NS + PEKSISNEFIEYRNQSNIIDSVLINKSQTSIRY ESDKTFVLSNAED + I+D+SIINE S++ S LS             S   E    +EFIEN NQS+I  SV+IN  Q  +    S+         + NIA++SIINE    +S I        SS +EI AL+E                  FIEN+NQSNID S++IN+  LP+EC GSNT+E GL
Sbjct:  612 VKNSLLLPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYSESDKTFVLSNAEDGQNISDKSIINENSKMSSKLSHKNLSNKSQVDNSSVFPEKSISNEFIENLNQSDIIDSVLINNSQTSIRYLESDKTFVLSNAEDKNIADQSIINE----ISEIPSNLSSIDSSSVEIQALSE------------------FIENRNQSNIDGSVIINEFQLPMECSGSNTNEPGL 818          

HSP 3 Score: 132.109 bits (331), Expect = 2.922e-35
Identity = 133/281 (47.33%), Postives = 149/281 (53.02%), Query Frame = 1
Query:    1 VDNSSVFPE------KSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAED-KIIADQXXXXXXXXXXXXXXXXXXXXVEIQALS------------------------EFIENRNQSNIDGSVIINKFQLLMECSGSNTN---EPGLANHNIANKSI-------------------------INENQSN------------------------------LSSIDSSGIEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINK 576
            VDNSSV PE      KSISNEFIE  NQSNI DSVLINKSQTSIRYLESDKTFVLSNAED + IAD+SIINE  E+PS LS I+SSS++IQ LS                        EFIENRNQSNI  S +INK Q       SN            N+A+KSI                         +NEN S                               LS I+SSGIEI  L+EQS V NS ++PEK ISN FIE +NQSNI  S+LINK
Sbjct:  364 VDNSSVIPETGEFIEKSISNEFIENLNQSNINDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIINEYREMPSKLSPINSSSIDIQHLSNRSPVDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINKSQSSKRSFQSNKTFVLRNSDEGQNVADKSIPNENPEITYKLSRENSTFREMQSIRLNENPSKINDIINNSHPLINLDSERSILSEIPEIISILSPINSSGIEIETLSEQSPVKNSLLLPEKSISNEFIEYRNQSNIIDSVLINK 644          

HSP 4 Score: 86.2705 bits (212), Expect = 2.063e-19
Identity = 94/254 (37.01%), Postives = 124/254 (48.82%), Query Frame = 1
Query:   43 EFIEYRNQSNIIDSVLINKSQTSIRYLES---DKTFVLSNAEDKIIADQXXXXXXXXXXXXXXXXXXXXVEIQALSE------------------FIENRNQSNIDGSVIINKFQLLMECSGSNTNEPGLANHNIANKSIINE-NQSNLSSIDSSGIEILALTEQSQVDNSSVIPEK-----PI---SNRFI-------------------------ENQNQSNIDRSILINKLLLPIECLG----SNTDESGL 627
            EFIE RNQSNI  SV+IN+ Q  +    S   +      N  +K I +++  N  S   S         +EI AL+E                  FIEN+NQSNID S++INK +L +EC GSN +E GL NHNIANKSIINE  + NL+  D+S + I   +E+      S IPE      P+   S+R+I                         EN NQSN+  S ++N L  P+ECL     SN + SGL
Sbjct:  783 EFIENRNQSNIDGSVIINEFQLPMECSGSNTNEPGLANHNIANKSIINENQSNLSSIDSSG--------IEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINKLRLPIECLGSNNDESGLENHNIANKSIINEYPEMNLNENDNSHLLINTDSER-----FSKIPEMSSKSFPMINSSSRYIDSSRQLLMSNSSKKFNREDFSIEFNENLNQSNVSNSPIVNVLQRPMECLESCKLSNPNASGL 1023          

HSP 5 Score: 85.8853 bits (211), Expect = 2.497e-19
Identity = 94/258 (36.43%), Postives = 126/258 (48.84%), Query Frame = 1
Query:    1 VDNSSVFPE------KSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNA----EDKIIADQXXXXXXXXXXXXXXXXXXXXVEIQALSEFIEN--------------RNQSNIDGSVIINKFQLLMECSGSNTNEPGLANHNIANKSIINENQSNLSSIDSSGIEILA------------------------------------LTEQSQVDNSSVIP------EKPISNRFIENQNQSNIDRSILINK 576
            VDNSSV PE      KSISNEFIE RNQSNIIDS LINKSQ+S R  +S+KTFVL N+      ++++     N       ++S  ++S+ E   LSE                   N+S +D S +I +    +E S SN     L   NI +  +IN++Q+++  ++S    +L+                                    L+ +S VDNSSVIP      EK ISN FIEN+NQSNI  S LINK
Sbjct:  243 VDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINKSQSSKRSFQSNKTFVLRNSIPNENPEMLSKLPHTNSAFREMQSISLNENSNSERSILSEIPPKLPPINSSSIDIQHLSNRSPVDNSSVIPETGEFIEKSISNEFIENLNQSNINDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIINEYREMPSKLSPINSSSIDIQHLSNRSPVDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINK 500          

HSP 6 Score: 67.3958 bits (163), Expect = 6.768e-13
Identity = 62/151 (41.06%), Postives = 76/151 (50.33%), Query Frame = 1
Query:  262 EFIENRNQSNIDGSVIINKFQ-----------LLMECSGSNTNEPGLANHNIAN------------------KSIINENQSNLSSIDSSGIEILALTEQSQVDNSSVIP------EKPISNRFIENQNQSNIDRSILINKLLLPIECLGSN 609
            EFIENRNQSNI  S +INK Q            ++  S  N N   L+     N                  +SI++E    L  I+SS I+I  L+ +S VDNSSVIP      EK ISN FIEN NQSNI+ S+LINK    I  L S+
Sbjct:  263 EFIENRNQSNIIDSGLINKSQSSKRSFQSNKTFVLRNSIPNENPEMLSKLPHTNSAFREMQSISLNENSNSERSILSEIPPKLPPINSSSIDIQHLSNRSPVDNSSVIPETGEFIEKSISNEFIENLNQSNINDSVLINKSQTSIRYLESD 413          

HSP 7 Score: 62.3882 bits (150), Expect = 3.290e-11
Identity = 46/75 (61.33%), Postives = 52/75 (69.33%), Query Frame = 1
Query:  376 HNI-ANKSIINENQ-SNLSSIDSSGIEILALTEQSQVDNSSVIPE------KPISNRFIENQNQSNIDRSILINK 576
            H I A+KSIINEN  S L  I+SS I+I  L+ +S VDNSSVIPE      K ISN FIEN+NQSNI  S LINK
Sbjct:  207 HKINADKSIINENMPSKLHPINSSSIDIQHLSNRSPVDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINK 281          
BLAST of SMED30003244 vs. Planmine SMEST
Match: SMESG000065696.1 (SMESG000065696.1)

HSP 1 Score: 333.954 bits (855), Expect = 1.238e-105
Identity = 200/209 (95.69%), Postives = 202/209 (96.65%), Query Frame = 1
Query:    1 VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDKIIADQXXXXXXXXXXXXXXXXXXXXVEIQALSEFIENRNQSNIDGSVIINKFQLLMECSGSNTNEPGLANHNIANKSIINENQSNLSSIDSSGIEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINKLLLPIECLGSNTDESGL 627
            VDNSSVFPEKSISNEFIE  NQS+IIDSVLIN SQTSIRYLESDKTFVLSNAEDK IADQSIINEISEIPSNLSSIDSSSVEIQALSEFIENRNQSNIDGSVIIN+FQL MECSGSNTNEPGLANHNIANKSIINENQSNLSSIDSSGIEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINKL LPIECLGSN DESGL
Sbjct:  700 VDNSSVFPEKSISNEFIENLNQSDIIDSVLINNSQTSIRYLESDKTFVLSNAEDKNIADQSIINEISEIPSNLSSIDSSSVEIQALSEFIENRNQSNIDGSVIINEFQLPMECSGSNTNEPGLANHNIANKSIINENQSNLSSIDSSGIEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINKLRLPIECLGSNNDESGL 908          

HSP 2 Score: 137.887 bits (346), Expect = 2.777e-37
Identity = 118/229 (51.53%), Postives = 141/229 (61.57%), Query Frame = 1
Query:    1 VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAED-KIIADQXXXXXXXXXXXXXXXX----------XXXXVEIQALSEFIENRNQSNIDGSVIINKFQLLMECSGSNTN--EPGLANHNIANKSIINENQSNLSSID-------SSGIEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINKLLLPIECLGSNTDESGL 627
            V NS + PEKSISNEFIEYRNQSNIIDSVLINKSQTSIRY ESDKTFVLSNAED + I+D+SIINE S++ S LS             S   E    +EFIEN NQS+I  SV+IN  Q  +    S+         + NIA++SIINE    +S I        SS +EI AL+E                  FIEN+NQSNID S++IN+  LP+EC GSNT+E GL
Sbjct:  616 VKNSLLLPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYSESDKTFVLSNAEDGQNISDKSIINENSKMSSKLSHKNLSNKSQVDNSSVFPEKSISNEFIENLNQSDIIDSVLINNSQTSIRYLESDKTFVLSNAEDKNIADQSIINE----ISEIPSNLSSIDSSSVEIQALSE------------------FIENRNQSNIDGSVIINEFQLPMECSGSNTNEPGL 822          

HSP 3 Score: 132.109 bits (331), Expect = 2.867e-35
Identity = 133/281 (47.33%), Postives = 149/281 (53.02%), Query Frame = 1
Query:    1 VDNSSVFPE------KSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAED-KIIADQXXXXXXXXXXXXXXXXXXXXVEIQALS------------------------EFIENRNQSNIDGSVIINKFQLLMECSGSNTN---EPGLANHNIANKSI-------------------------INENQSN------------------------------LSSIDSSGIEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINK 576
            VDNSSV PE      KSISNEFIE  NQSNI DSVLINKSQTSIRYLESDKTFVLSNAED + IAD+SIINE  E+PS LS I+SSS++IQ LS                        EFIENRNQSNI  S +INK Q       SN            N+A+KSI                         +NEN S                               LS I+SSGIEI  L+EQS V NS ++PEK ISN FIE +NQSNI  S+LINK
Sbjct:  368 VDNSSVIPETGEFIEKSISNEFIENLNQSNINDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIINEYREMPSKLSPINSSSIDIQHLSNRSPVDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINKSQSSKRSFQSNKTFVLRNSDEGQNVADKSIPNENPEITYKLSRENSTFREMQSIRLNENPSKINDIINNSHPLINLDSERSILSEIPEIISILSPINSSGIEIETLSEQSPVKNSLLLPEKSISNEFIEYRNQSNIIDSVLINK 648          

HSP 4 Score: 86.2705 bits (212), Expect = 2.143e-19
Identity = 94/254 (37.01%), Postives = 124/254 (48.82%), Query Frame = 1
Query:   43 EFIEYRNQSNIIDSVLINKSQTSIRYLES---DKTFVLSNAEDKIIADQXXXXXXXXXXXXXXXXXXXXVEIQALSE------------------FIENRNQSNIDGSVIINKFQLLMECSGSNTNEPGLANHNIANKSIINE-NQSNLSSIDSSGIEILALTEQSQVDNSSVIPEK-----PI---SNRFI-------------------------ENQNQSNIDRSILINKLLLPIECLG----SNTDESGL 627
            EFIE RNQSNI  SV+IN+ Q  +    S   +      N  +K I +++  N  S   S         +EI AL+E                  FIEN+NQSNID S++INK +L +EC GSN +E GL NHNIANKSIINE  + NL+  D+S + I   +E+      S IPE      P+   S+R+I                         EN NQSN+  S ++N L  P+ECL     SN + SGL
Sbjct:  787 EFIENRNQSNIDGSVIINEFQLPMECSGSNTNEPGLANHNIANKSIINENQSNLSSIDSSG--------IEILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINKLRLPIECLGSNNDESGLENHNIANKSIINEYPEMNLNENDNSHLLINTDSER-----FSKIPEMSSKSFPMINSSSRYIDSSRQLLMSNSSKKFNREDFSIEFNENLNQSNVSNSPIVNVLQRPMECLESCKLSNPNASGL 1027          

HSP 5 Score: 85.8853 bits (211), Expect = 2.570e-19
Identity = 94/258 (36.43%), Postives = 126/258 (48.84%), Query Frame = 1
Query:    1 VDNSSVFPE------KSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNA----EDKIIADQXXXXXXXXXXXXXXXXXXXXVEIQALSEFIEN--------------RNQSNIDGSVIINKFQLLMECSGSNTNEPGLANHNIANKSIINENQSNLSSIDSSGIEILA------------------------------------LTEQSQVDNSSVIP------EKPISNRFIENQNQSNIDRSILINK 576
            VDNSSV PE      KSISNEFIE RNQSNIIDS LINKSQ+S R  +S+KTFVL N+      ++++     N       ++S  ++S+ E   LSE                   N+S +D S +I +    +E S SN     L   NI +  +IN++Q+++  ++S    +L+                                    L+ +S VDNSSVIP      EK ISN FIEN+NQSNI  S LINK
Sbjct:  247 VDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINKSQSSKRSFQSNKTFVLRNSIPNENPEMLSKLPHTNSAFREMQSISLNENSNSERSILSEIPPKLPPINSSSIDIQHLSNRSPVDNSSVIPETGEFIEKSISNEFIENLNQSNINDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIINEYREMPSKLSPINSSSIDIQHLSNRSPVDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINK 504          

HSP 6 Score: 67.3958 bits (163), Expect = 6.833e-13
Identity = 62/151 (41.06%), Postives = 76/151 (50.33%), Query Frame = 1
Query:  262 EFIENRNQSNIDGSVIINKFQ-----------LLMECSGSNTNEPGLANHNIAN------------------KSIINENQSNLSSIDSSGIEILALTEQSQVDNSSVIP------EKPISNRFIENQNQSNIDRSILINKLLLPIECLGSN 609
            EFIENRNQSNI  S +INK Q            ++  S  N N   L+     N                  +SI++E    L  I+SS I+I  L+ +S VDNSSVIP      EK ISN FIEN NQSNI+ S+LINK    I  L S+
Sbjct:  267 EFIENRNQSNIIDSGLINKSQSSKRSFQSNKTFVLRNSIPNENPEMLSKLPHTNSAFREMQSISLNENSNSERSILSEIPPKLPPINSSSIDIQHLSNRSPVDNSSVIPETGEFIEKSISNEFIENLNQSNINDSVLINKSQTSIRYLESD 417          

HSP 7 Score: 62.3882 bits (150), Expect = 3.417e-11
Identity = 46/75 (61.33%), Postives = 52/75 (69.33%), Query Frame = 1
Query:  376 HNI-ANKSIINENQ-SNLSSIDSSGIEILALTEQSQVDNSSVIPE------KPISNRFIENQNQSNIDRSILINK 576
            H I A+KSIINEN  S L  I+SS I+I  L+ +S VDNSSVIPE      K ISN FIEN+NQSNI  S LINK
Sbjct:  211 HKINADKSIINENMPSKLHPINSSSIDIQHLSNRSPVDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINK 285          
The following BLAST results are available for this feature:
BLAST of SMED30003244 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003244 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003244 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003244 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003244 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003244 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003244 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003244 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003244 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003244 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003244 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003244 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003244 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003244 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000065696.11.191e-10595.69SMESG000065696.1[more]
SMESG000065696.11.203e-10595.69SMESG000065696.1[more]
SMESG000065696.11.238e-10595.69SMESG000065696.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003244 ID=SMED30003244|Name=SMED30003244|organism=Schmidtea mediterranea sexual|type=transcript|length=629bp
GTTGACAATTCTTCAGTTTTTCCTGAAAAATCAATTTCCAATGAATTTAT
TGAATATCGAAATCAATCGAATATTATTGACTCAGTACTGATCAATAAAT
CTCAAACATCAATACGATATTTGGAATCCGATAAAACATTTGTACTGTCT
AATGCAGAAGATAAAATTATTGCAGATCAATCAATTATCAATGAAATTTC
AGAAATTCCATCAAATTTGTCCTCGATTGATTCATCTAGTGTCGAAATTC
AAGCGTTATCCGAATTCATTGAAAATCGAAATCAGTCAAATATTGATGGC
TCTGTAATTATCAATAAATTTCAACTGCTAATGGAATGCTCAGGATCCAA
TACAAACGAACCGGGGCTAGCAAATCATAATATTGCCAATAAATCGATTA
TAAATGAAAATCAATCAAATTTATCCTCGATTGATTCATCTGGTATCGAA
ATTCTAGCTTTAACTGAACAATCACAGGTGGACAATTCCTCAGTTATTCC
TGAAAAACCAATTTCCAATCGATTCATTGAAAATCAAAATCAGTCAAATA
TTGATCGCTCTATATTAATCAATAAATTGCTATTGCCAATAGAATGCTTA
GGATCAAATACAGACGAGTCGGGGCTAGA
back to top

protein sequence of SMED30003244-orf-1

>SMED30003244-orf-1 ID=SMED30003244-orf-1|Name=SMED30003244-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=209bp
VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLS
NAEDKIIADQSIINEISEIPSNLSSIDSSSVEIQALSEFIENRNQSNIDG
SVIINKFQLLMECSGSNTNEPGLANHNIANKSIINENQSNLSSIDSSGIE
ILALTEQSQVDNSSVIPEKPISNRFIENQNQSNIDRSILINKLLLPIECL
GSNTDESGL
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0002109X1 cell