Potassium voltage gated channel subfamily C

Overview
NamePotassium voltage gated channel subfamily C
Smed IDSMED30003240
Length (bp)2297
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Potassium voltage gated channel subfamily C (SMED30003240) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium voltage gated channel subfamily C (SMED30003240) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium voltage gated channel subfamily C (SMED30003240) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium voltage gated channel subfamily C (SMED30003240) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003240

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003240SMESG000010003.1 SmedASXL_000704SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30003240SMESG000010003.1 dd_Smed_v4_20858_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30003240SMESG000010003.1 dd_Smed_v6_20858_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 205.682 bits (522), Expect = 8.819e-57
Identity = 153/567 (26.98%), Postives = 255/567 (44.97%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQ----------------------------------NACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFE-----------DQDSILNLL-------------KCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSY 1616
            I   + VI ++GG    T R+ L  LP +RL +LA                                      C+     + S + G A   D      E       ++FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE           D+D     L             K  R +++L+ ++W   + P SS AA+  A   L  ++ S+  FCL TH+ F    + +EP         +IN                        L+ +  T PA  L   + +  + FT EFL +++ +P+K +F+ +L++  D + +  ++                V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE            +   F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY      + + K  R+ +K +     +S+ ++
Sbjct:    4 IENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRAS--DHPGGGRE-------FFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGR-WRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEP---------VINGTSVV-------------------LQYEIETDPA--LTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFY--------------LEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSL---AMAKQKLPRKRKKHIPPAPQASSPTF 508          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 206.453 bits (524), Expect = 9.156e-57
Identity = 153/567 (26.98%), Postives = 255/567 (44.97%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQ----------------------------------NACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFE-----------DQDSILNLL-------------KCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSY 1616
            I   + VI ++GG    T R+ L  LP +RL +LA                                      C+     + S + G A   D      E       ++FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE           D+D     L             K  R +++L+ ++W   + P SS AA+  A   L  ++ S+  FCL TH+ F    + +EP         +IN                        L+ +  T PA  L   + +  + FT EFL +++ +P+K +F+ +L++  D + +  ++                V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE            +   F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY      + + K  R+ +K +     +S+ ++
Sbjct:    4 IENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRAS--DHPGGGRE-------FFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGR-WRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEP---------VINGTSVV-------------------LQYEIETDPA--LTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFY--------------LEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSL---AMAKQKLPRKRKKHIPPAPQASSPTF 508          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 204.912 bits (520), Expect = 9.951e-57
Identity = 154/567 (27.16%), Postives = 258/567 (45.50%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQ----------------------------------NACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFE-----------DQDSILNLL-------------KCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSY 1616
            I   + VI ++GG    T R+ L  LP +RL +LA                                      C+     + S + G A   D      E       ++FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE           D+D     L             K  R +++L+ ++W   + P SS AA+  A   L  ++ S+  FCL TH+ F    + +EP         +IN                        L+ +  T PA  L   + +  + FT EFL +++ +P+K +F+ +L++  D         ++++  ++L      V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE            +   F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY      + + K  R+ +K +     +S+ ++
Sbjct:    4 IENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRAS--DHPGGGRE-------FFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGR-WRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEP---------VINGTSVV-------------------LQYEIETDPA--LTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIID---------FVAILPFYLE-----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSL---AMAKQKLPRKRKKHIPPAPQASSPTF 508          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 205.682 bits (522), Expect = 1.398e-56
Identity = 153/567 (26.98%), Postives = 258/567 (45.50%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQ----------------------------------NACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFE-----------DQDSILNLL-------------KCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSY 1616
            I   + VI ++GG    T R+ L  LP +RL +LA                                      C+     + S + G A   D      E       ++FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE           D+D     L             K  R +++L+ ++W   + P SS AA+  A   L  ++ S+  FCL TH+ F    + +EP     N   ++                         L+ +  T PA  L   + +  + FT EFL +++ +P+K +F+ +L++  D         ++++  ++L      V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE            +   F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY      + + K  R+ +K +     +S+ ++
Sbjct:    4 IENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRAS--DHPGGGRE-------FFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGR-WRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPV---INGTSVV-------------------------LQYEIETDPA--LTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIID---------FVAILPFYLE-----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSL---AMAKQKLPRKRKKHIPPAPQASSPTF 508          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 205.682 bits (522), Expect = 1.398e-56
Identity = 153/567 (26.98%), Postives = 258/567 (45.50%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQ----------------------------------NACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFE-----------DQDSILNLL-------------KCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSY 1616
            I   + VI ++GG    T R+ L  LP +RL +LA                                      C+     + S + G A   D      E       ++FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE           D+D     L             K  R +++L+ ++W   + P SS AA+  A   L  ++ S+  FCL TH+ F    + +EP     N   ++                         L+ +  T PA  L   + +  + FT EFL +++ +P+K +F+ +L++  D         ++++  ++L      V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE            +   F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY      + + K  R+ +K +     +S+ ++
Sbjct:    4 IENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRAS--DHPGGGRE-------FFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGR-WRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPV---INGTSVV-------------------------LQYEIETDPA--LTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIID---------FVAILPFYLE-----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSL---AMAKQKLPRKRKKHIPPAPQASSPTF 508          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 201.06 bits (510), Expect = 2.549e-55
Identity = 148/518 (28.57%), Postives = 251/518 (48.46%), Query Frame = 3
Query:  138 VIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLF-------------------RDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPT--NMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE---YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRK--DLNEVTSSSTKS 1613
            VI ++GG    T    L ++P +RL  L    A Y+                         LN+   Y+FDR P +F  +L+YYRTG+LH P+ +CGP   +EL FWG+D + + PCC   +M Y + R T+ TL                    +  +ED     N+ +    +++L+ ++W   D P SS  A+  +++ ++ +I S++CFCL TH  FR    +   T  N S   N +  NN    Y+                 K      P++  V  +++ N+ F+ EFL +++  P+   FL + ++  D I   S       FY      R     ++DS          +    ++RI+R+F++++ S GL++LI T K S  EL LL F ++ G+ +F+AL+Y AE   + +++ F  IP G WW++IT+ T+G+GD  P++  G  +GS+ A+ G +   L +P+I +NF  +Y + Q + K  K  R++ +  ++  V   ST +
Sbjct:  103 VILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDP-----------------------VLNE---YFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCC---WMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQ----WQRLKPRVWALFDEPWSSKYARVISVVNIIFVIISIVCFCLKTHPSFRIPDIDISTTMGNFSAPLNGVQMNNI---YVG----------------KTATRAHPSFFYV--ELLSNIWFSGEFLTRMVFCPNVATFLRTPVNLIDFIATVS-------FYIDWALDRTLSGSNRDS----------VEFFSIIRILRLFKLTQHSTGLKILIQTFKASAQELFLLVFFVLLGIVIFAALVYYAERVEHNEENQFSSIPVGLWWAVITICTIGFGDLVPQTSLGRLVGSVCALMGVLTIALPVPVIVSNFAMFYSHAQARSKLPKKRRRVLQPHEIKPVVGRSTTA 549          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 196.823 bits (499), Expect = 1.140e-54
Identity = 145/510 (28.43%), Postives = 237/510 (46.47%), Query Frame = 3
Query:  108 SFEMINARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLF-------------------RDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQ---KDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQL 1571
            S   ++    VI ++GG    T    L ++P +RL  L    A Y+                         LN+   Y+FDR P +F  +L+YYRTG+LH P+ +CGP   +EL FWG+D + + PCC   +M Y + R T+ TL                    +  +ED     N+ +    +++L+ ++W   D P SS  A+  + L +  ++AS   F L T   F+       P    F   R+++    K Y +          DK         T P       D++ N+ FTIE L + L  P   KF+ S ++  D+I           F++   +      L Q    V L F++++       ++R+F++++   GL++LI T K S  EL LL F ++  + +F+AL+Y AE  Q    + F  IP G WWS++T++TVG+GD  PK+  G  +GS+ A+ G +   L +P+I +NF+  Y + Q + K  K  R++
Sbjct:   17 SLSWMDTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDP-----------------------VLNE---YFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCC---WMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQ----WQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQI------PDIDVFYSLRVVDEGGFKNYHKTIG------TDKP-------VTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVI-------STGAFFF---ESLLHAILIQTGSLVTLDFLSMIC------VLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRV 458          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 195.667 bits (496), Expect = 2.362e-54
Identity = 144/506 (28.46%), Postives = 236/506 (46.64%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLF-------------------RDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQ---KDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQL 1571
            ++    VI ++GG    T    L ++P +RL  L    A Y+                         LN+   Y+FDR P +F  +L+YYRTG+LH P+ +CGP   +EL FWG+D + + PCC   +M Y + R T+ TL                    +  +ED     N+ +    +++L+ ++W   D P SS  A+  + L +  ++AS   F L T   F+       P    F   R+++    K Y +          DK         T P       D++ N+ FTIE L + L  P   KF+ S ++  D+I           F++   +      L Q    V L F++++       ++R+F++++   GL++LI T K S  EL LL F ++  + +F+AL+Y AE  Q    + F  IP G WWS++T++TVG+GD  PK+  G  +GS+ A+ G +   L +P+I +NF+  Y + Q + K  K  R++
Sbjct:    1 MDTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDP-----------------------VLNE---YFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCC---WMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQ----WQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQI------PDIDVFYSLRVVDEGGFKNYHKTIG------TDKP-------VTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVI-------STGAFFF---ESLLHAILIQTGSLVTLDFLSMIC------VLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRV 438          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 195.667 bits (496), Expect = 2.362e-54
Identity = 144/506 (28.46%), Postives = 236/506 (46.64%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLF-------------------RDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQ---KDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQL 1571
            ++    VI ++GG    T    L ++P +RL  L    A Y+                         LN+   Y+FDR P +F  +L+YYRTG+LH P+ +CGP   +EL FWG+D + + PCC   +M Y + R T+ TL                    +  +ED     N+ +    +++L+ ++W   D P SS  A+  + L +  ++AS   F L T   F+       P    F   R+++    K Y +          DK         T P       D++ N+ FTIE L + L  P   KF+ S ++  D+I           F++   +      L Q    V L F++++       ++R+F++++   GL++LI T K S  EL LL F ++  + +F+AL+Y AE  Q    + F  IP G WWS++T++TVG+GD  PK+  G  +GS+ A+ G +   L +P+I +NF+  Y + Q + K  K  R++
Sbjct:    1 MDTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDP-----------------------VLNE---YFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCC---WMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQ----WQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQI------PDIDVFYSLRVVDEGGFKNYHKTIG------TDKP-------VTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVI-------STGAFFF---ESLLHAILIQTGSLVTLDFLSMIC------VLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRV 438          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 195.667 bits (496), Expect = 2.410e-54
Identity = 144/506 (28.46%), Postives = 236/506 (46.64%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLF-------------------RDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQ---KDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQL 1571
            ++    VI ++GG    T    L ++P +RL  L    A Y+                         LN+   Y+FDR P +F  +L+YYRTG+LH P+ +CGP   +EL FWG+D + + PCC   +M Y + R T+ TL                    +  +ED     N+ +    +++L+ ++W   D P SS  A+  + L +  ++AS   F L T   F+       P    F   R+++    K Y +          DK         T P       D++ N+ FTIE L + L  P   KF+ S ++  D+I           F++   +      L Q    V L F++++       ++R+F++++   GL++LI T K S  EL LL F ++  + +F+AL+Y AE  Q    + F  IP G WWS++T++TVG+GD  PK+  G  +GS+ A+ G +   L +P+I +NF+  Y + Q + K  K  R++
Sbjct:   11 MDTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDP-----------------------VLNE---YFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCC---WMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQ----WQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQI------PDIDVFYSLRVVDEGGFKNYHKTIG------TDKP-------VTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVI-------STGAFFF---ESLLHAILIQTGSLVTLDFLSMIC------VLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRV 448          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332184)

HSP 1 Score: 207.223 bits (526), Expect = 2.718e-58
Identity = 148/499 (29.66%), Postives = 242/499 (48.50%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGF------------KKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQ---KDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQL 1571
            +++ + V+ ++GG    T +A L ++P +RL  L    A Y+                         LN+   Y+FDR P +F  VL+YYRTG+LH P+ +CGP   +EL FWG+D + + PCC   Y ++ + + T   L R   + +      L    GF            ++++ ++W   D P SS AAK+  ++ +  +  S++ FCL TH   R                 I+ N      ++     + W +DK         T         + + N  FT E L + + +P+K +F+ S ++  D I   S       FY  L  +RFA  L            +IL    ++RIMR+F++++ S GL++LI T + S  EL LL F L+ G+ +F++L+Y AE  Q    + F  IP G WW+++T+TTVGYGD  PK+  G F+G++ A++G +   L +P+I +NF  YY + Q + K  K  R++
Sbjct:    6 MDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDP-----------------------ILNE---YFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVP---------------IVRNIT----VKTANGSNGWFLDKT-------QTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLS-------FYIDLVLQRFASHLEN---------ADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRV 436          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089274)

HSP 1 Score: 206.453 bits (524), Expect = 3.561e-58
Identity = 148/499 (29.66%), Postives = 242/499 (48.50%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGF------------KKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQ---KDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQL 1571
            +++ + V+ ++GG    T +A L ++P +RL  L    A Y+                         LN+   Y+FDR P +F  VL+YYRTG+LH P+ +CGP   +EL FWG+D + + PCC   Y ++ + + T   L R   + +      L    GF            ++++ ++W   D P SS AAK+  ++ +  +  S++ FCL TH   R                 I+ N      ++     + W +DK         T         + + N  FT E L + + +P+K +F+ S ++  D I   S       FY  L  +RFA  L            +IL    ++RIMR+F++++ S GL++LI T + S  EL LL F L+ G+ +F++L+Y AE  Q    + F  IP G WW+++T+TTVGYGD  PK+  G F+G++ A++G +   L +P+I +NF  YY + Q + K  K  R++
Sbjct:    6 MDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDP-----------------------ILNE---YFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVP---------------IVRNIT----VKTANGSNGWFLDKT-------QTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLS-------FYIDLVLQRFASHLEN---------ADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRV 436          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332185)

HSP 1 Score: 208.379 bits (529), Expect = 6.397e-58
Identity = 148/499 (29.66%), Postives = 242/499 (48.50%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGF------------KKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT---FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQL 1571
            +++ + V+ ++GG    T +A L ++P +RL  L    A Y+                         LN+   Y+FDR P +F  VL+YYRTG+LH P+ +CGP   +EL FWG+D + + PCC   Y ++ + + T   L R   + +      L    GF            ++++ ++W   D P SS AAK+  ++ +  +  S++ FCL TH   R                 I+ N      ++     + W +DK         T         + + N  FT E L + + +P+K +F+ S ++  D I   S       FY  L  +RFA  L            +IL    ++RIMR+F++++ S GL++LI T + S  EL LL F L+ G+ +F++L+Y AE  Q +    F  IP G WW+++T+TTVGYGD  PK+  G F+G++ A++G +   L +P+I +NF  YY + Q + K  K  R++
Sbjct:    6 MDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDP-----------------------ILNE---YFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVP---------------IVRNIT----VKTANGSNGWFLDKT-------QTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLS-------FYIDLVLQRFASHLEN---------ADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRV 436          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089275)

HSP 1 Score: 208.379 bits (529), Expect = 7.956e-58
Identity = 148/499 (29.66%), Postives = 242/499 (48.50%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGF------------KKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT---FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQL 1571
            +++ + V+ ++GG    T +A L ++P +RL  L    A Y+                         LN+   Y+FDR P +F  VL+YYRTG+LH P+ +CGP   +EL FWG+D + + PCC   Y ++ + + T   L R   + +      L    GF            ++++ ++W   D P SS AAK+  ++ +  +  S++ FCL TH   R                 I+ N      ++     + W +DK         T         + + N  FT E L + + +P+K +F+ S ++  D I   S       FY  L  +RFA  L            +IL    ++RIMR+F++++ S GL++LI T + S  EL LL F L+ G+ +F++L+Y AE  Q +    F  IP G WW+++T+TTVGYGD  PK+  G F+G++ A++G +   L +P+I +NF  YY + Q + K  K  R++
Sbjct:    6 MDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDP-----------------------ILNE---YFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVP---------------IVRNIT----VKTANGSNGWFLDKT-------QTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLS-------FYIDLVLQRFASHLEN---------ADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRV 436          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0289989)

HSP 1 Score: 208.379 bits (529), Expect = 1.059e-57
Identity = 148/499 (29.66%), Postives = 242/499 (48.50%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGF------------KKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT---FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQL 1571
            +++ + V+ ++GG    T +A L ++P +RL  L    A Y+                         LN+   Y+FDR P +F  VL+YYRTG+LH P+ +CGP   +EL FWG+D + + PCC   Y ++ + + T   L R   + +      L    GF            ++++ ++W   D P SS AAK+  ++ +  +  S++ FCL TH   R                 I+ N      ++     + W +DK         T         + + N  FT E L + + +P+K +F+ S ++  D I   S       FY  L  +RFA  L            +IL    ++RIMR+F++++ S GL++LI T + S  EL LL F L+ G+ +F++L+Y AE  Q +    F  IP G WW+++T+TTVGYGD  PK+  G F+G++ A++G +   L +P+I +NF  YY + Q + K  K  R++
Sbjct:   21 MDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDP-----------------------ILNE---YFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVP---------------IVRNIT----VKTANGSNGWFLDKT-------QTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLS-------FYIDLVLQRFASHLEN---------ADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRV 451          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Zebrafish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 214.542 bits (545), Expect = 2.170e-60
Identity = 149/493 (30.22%), Postives = 241/493 (48.88%), Query Frame = 3
Query:  123 NARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFE--------DQ-------DSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYK 1526
            + R+ VI ++GG    T R+ L  LP +RL +LA         E+D  +     Q +      +E   +   Y+FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE        D+       + +++       +++ +  +W   D P SS AA+  A   L  ++ S+  FCL TH+ F                N IIN  +    LRN T         +   + +  T PA  L   + +  L FT EFL ++  +PDK +F+ S+++  D + +  ++                V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE                F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY 
Sbjct:    5 DERERVILNVGGTRHETYRSTLKTLPGTRLALLA--------SESDLELVLDQLQQV---PGFIEYSARSNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCC---WMTYRQHRDAEEAL--DVFEMNVDTEEDDEYGKRLGIEDVVSADGTVSRWRRWQPVIWNLFDDPYSSRAARFIAFASLFFIMVSITTFCLETHEAF----------------NTIINKTDP---LRNETL-------TDISQQYEIETDPA--LTYVEGVCVLWFTFEFLVRITFSPDKLEFIKSVLNIIDFVAILPFY--------------LEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPNDPTASHHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYS 439          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Zebrafish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 214.542 bits (545), Expect = 4.649e-60
Identity = 149/493 (30.22%), Postives = 241/493 (48.88%), Query Frame = 3
Query:  123 NARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFE--------DQ-------DSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYK 1526
            + R+ VI ++GG    T R+ L  LP +RL +LA         E+D  +     Q +      +E   +   Y+FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE        D+       + +++       +++ +  +W   D P SS AA+  A   L  ++ S+  FCL TH+ F                N IIN  +    LRN T         +   + +  T PA  L   + +  L FT EFL ++  +PDK +F+ S+++  D + +  ++                V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE                F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY 
Sbjct:    5 DERERVILNVGGTRHETYRSTLKTLPGTRLALLA--------SESDLELVLDQLQQV---PGFIEYSARSNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCC---WMTYRQHRDAEEAL--DVFEMNVDTEEDDEYGKRLGIEDVVSADGTVSRWRRWQPVIWNLFDDPYSSRAARFIAFASLFFIMVSITTFCLETHEAF----------------NTIINKTDP---LRNETL-------TDISQQYEIETDPA--LTYVEGVCVLWFTFEFLVRITFSPDKLEFIKSVLNIIDFVAILPFY--------------LEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPNDPTASHHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYS 439          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Zebrafish
Match: kcnc4 (potassium voltage-gated channel, Shaw-related subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-060503-773])

HSP 1 Score: 214.157 bits (544), Expect = 8.498e-60
Identity = 152/507 (29.98%), Postives = 244/507 (48.13%), Query Frame = 3
Query:   93 SKSGESFEMINARDT--VIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFE---------DQD---------SILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT----------FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYY 1523
            SKS    EM    D+  +I ++GG    T R+ L  +P SRL  LA  ++  N +  D    H +++                 ++FDR P IF +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE         DQD         S      CC  ++    ++W   + P SS AA+  A + L  ++ S+  FCL TH+ F F   N   T  + N   II                   MD  P L             + + +  + FT EFL +++  P+K  F+ + ++  D         ++++  ++L  +R  +  +  +    L F+ ++   + +RI+RIF++++   GL+VL  T++ S+ E  LL   L  G+ +F+ +IY AE    D           F +IP GFWW+++T+TT+GYGD  PK+  G  +G++ AI+G +   + +P+I NNF  YY
Sbjct:   21 SKSCLKEEMARCEDSDKIIINVGGTRHETYRSTLRTIPGSRLAWLADTDSQVNPD-ADTGQTHPNSE-----------------FFFDRHPGIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFEPPDPEDAEDDQDMPRRFGIEDSPDRSRGCCEVWQP---KIWALFEDPYSSRAARVIAFVSLFFILVSITNFCLETHEAF-FEFHNHTDTKSATNSTTIIQ-----------------VMDTKPVL------------TVVEGICVVWFTFEFLVRIICCPNKLLFIKNQLNIID---------FVAILPFYL--ERSLIGNTSKAAKDVLGFLRVV---RFVRILRIFKLTRHFVGLRVLGHTLRASVNEFCLLIIFLALGVLIFATMIYYAERISADPDDPSGCNHTHFKNIPIGFWWAVVTMTTLGYGDMVPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFGMYY 457          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Zebrafish
Match: kcnc4 (potassium voltage-gated channel, Shaw-related subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-060503-773])

HSP 1 Score: 214.157 bits (544), Expect = 8.498e-60
Identity = 152/507 (29.98%), Postives = 244/507 (48.13%), Query Frame = 3
Query:   93 SKSGESFEMINARDT--VIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFE---------DQD---------SILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT----------FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYY 1523
            SKS    EM    D+  +I ++GG    T R+ L  +P SRL  LA  ++  N +  D    H +++                 ++FDR P IF +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE         DQD         S      CC  ++    ++W   + P SS AA+  A + L  ++ S+  FCL TH+ F F   N   T  + N   II                   MD  P L             + + +  + FT EFL +++  P+K  F+ + ++  D         ++++  ++L  +R  +  +  +    L F+ ++   + +RI+RIF++++   GL+VL  T++ S+ E  LL   L  G+ +F+ +IY AE    D           F +IP GFWW+++T+TT+GYGD  PK+  G  +G++ AI+G +   + +P+I NNF  YY
Sbjct:   21 SKSCLKEEMARCEDSDKIIINVGGTRHETYRSTLRTIPGSRLAWLADTDSQVNPD-ADTGQTHPNSE-----------------FFFDRHPGIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFEPPDPEDAEDDQDMPRRFGIEDSPDRSRGCCEVWQP---KIWALFEDPYSSRAARVIAFVSLFFILVSITNFCLETHEAF-FEFHNHTDTKSATNSTTIIQ-----------------VMDTKPVL------------TVVEGICVVWFTFEFLVRIICCPNKLLFIKNQLNIID---------FVAILPFYL--ERSLIGNTSKAAKDVLGFLRVV---RFVRILRIFKLTRHFVGLRVLGHTLRASVNEFCLLIIFLALGVLIFATMIYYAERISADPDDPSGCNHTHFKNIPIGFWWAVVTMTTLGYGDMVPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFGMYY 457          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Zebrafish
Match: kcnc4 (potassium voltage-gated channel, Shaw-related subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-060503-773])

HSP 1 Score: 213.001 bits (541), Expect = 1.241e-59
Identity = 150/507 (29.59%), Postives = 243/507 (47.93%), Query Frame = 3
Query:   93 SKSGESFEMINARDT--VIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFED------------------QDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT----------FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYY 1523
            SKS    EM    D+  +I ++GG    T R+ L  +P SRL  LA  ++  N +  D    H +++                 ++FDR P IF +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE                   +DS      CC  ++    ++W   + P SS AA+  A + L  ++ S+  FCL TH+ F F   N   T  + N   II                   MD  P L             + + +  + FT EFL +++  P+K  F+ + ++  D         ++++  ++L  +R  +  +  +    L F+ ++   + +RI+RIF++++   GL+VL  T++ S+ E  LL   L  G+ +F+ +IY AE    D           F +IP GFWW+++T+TT+GYGD  PK+  G  +G++ AI+G +   + +P+I NNF  YY
Sbjct:   21 SKSCLKEEMARCEDSDKIIINVGGTRHETYRSTLRTIPGSRLAWLADTDSQVNPD-ADTGQTHPNSE-----------------FFFDRHPGIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFEPPDPEDAEDDQDMPRRFGIEDSPDRSRGCCEVWQP---KIWALFEDPYSSRAARVIAFVSLFFILVSITNFCLETHEAF-FEFHNHTDTKSATNSTTIIQ-----------------VMDTKPVL------------TVVEGICVVWFTFEFLVRIICCPNKLLFIKNQLNIID---------FVAILPFYL--ERSLIGNTSKAAKDVLGFLRVV---RFVRILRIFKLTRHFVGLRVLGHTLRASVNEFCLLIIFLALGVLIFATMIYYAERISADPDDPSGCNHTHFKNIPIGFWWAVVTMTTLGYGDMVPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFGMYY 457          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Xenopus
Match: KCNC2 (potassium channel, voltage gated Shaw related subfamily C, member 2 [Source:NCBI gene;Acc:100489216])

HSP 1 Score: 218.394 bits (555), Expect = 1.990e-61
Identity = 150/509 (29.47%), Postives = 246/509 (48.33%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSI-------------------LNLLKCCRG----FKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLK 1547
            I+  + +I ++GG    T R+ L  +P +RL +LA ++   +E+  D     GS    ++TS   E       ++FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE  D I                   +  + C  G    +++L+ ++W   + P SS AA+  A   L  ++ S+  FCL TH+ F          N   N    +NN             S   ++ +P L         W            FT EFL +V+  PDK +F+ +L++  D         ++++  ++L      V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE            +   F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY     + K
Sbjct:    4 IDENERIILNVGGTRHETYRSTLKTVPGTRLALLACESQ--SEQGLDQQTVSGS---FNITSRGNE-------FFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFETPDLITGEPPPIDEYEEDLGKRLAIEDVVCPDGKVGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAF----------NTIINKTETVNNGTE--------LISLIEIETDPALTYVEGVCVVW------------FTFEFLVRVIFCPDKLEFIRNLLNIID---------FVAILPFYLE-----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPSDPSASKHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQK 451          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Xenopus
Match: KCNC2 (potassium channel, voltage gated Shaw related subfamily C, member 2 [Source:NCBI gene;Acc:100489216])

HSP 1 Score: 218.394 bits (555), Expect = 2.542e-61
Identity = 149/509 (29.27%), Postives = 243/509 (47.74%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSI-------------------LNLLKCCRG----FKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLK 1547
            I+  + +I ++GG    T R+ L  +P +RL +LA ++   +E+  D     GS    ++TS   E       ++FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE  D I                   +  + C  G    +++L+ ++W   + P SS AA+  A   L  ++ S+  FCL TH+ F          N   N    +NN             S   ++ +P L         W            FT EFL +V+  PDK +F+ +L++  D + +  ++                V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE            +   F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY     + K
Sbjct:    4 IDENERIILNVGGTRHETYRSTLKTVPGTRLALLACESQ--SEQGLDQQTVSGS---FNITSRGNE-------FFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFETPDLITGEPPPIDEYEEDLGKRLAIEDVVCPDGKVGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAF----------NTIINKTETVNNGTE--------LISLIEIETDPALTYVEGVCVVW------------FTFEFLVRVIFCPDKLEFIRNLLNIIDFVAILPFY--------------LEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPSDPSASKHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQK 451          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Xenopus
Match: KCNC4 (potassium channel, voltage gated Shaw related subfamily C, member 4 [Source:NCBI gene;Acc:100492941])

HSP 1 Score: 201.445 bits (511), Expect = 3.916e-55
Identity = 166/596 (27.85%), Postives = 278/596 (46.64%), Query Frame = 3
Query:   93 SKSGESFEMINARDT--VIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQD----------------SILNLLKCCRG-FKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEY----------QQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSST-KSYGNS--------PCPGMFRDHTTTQ-SKMRRNRKLNESIEKPESSTPNGF--LNKKRLI 1757
            SK+    EM    D+  +  ++GG    T ++ L  LP +RL  LA  +                      T+S  E  +++  ++FDR P IF +VL+YYRTG+LH P+ ICGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE+ +                 I       RG +K  + ++W   + P SS AA+  A + L  ++ S+  FCL TH+ F    + +E   +  N   I+                         + ++  T+P   L   + +    FT+EFL +++  PDK  F+ +L++  D         ++++  ++L      V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE                F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY     + K  K  ++     +++ S +T KS  NS         CP    + T  + S  ++N   N  +   +   P  F  L++KR+I
Sbjct:   21 SKTCLKEEMAKGEDSGKITINVGGTRHETYKSTLRTLPGTRLAWLADPD----------------------TASNSESDSQRTEFFFDRHPGIFSYVLNYYRTGKLHCPADICGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFENVEPEDGEEENKGSSPELLCIEERTDRSRGCWKVWQPKMWALFEDPYSSRAARVVAFVSLFFILMSITTFCLETHESFIVDRNVTETVTIG-NMTEIL-------------------------VVREVETEPI--LTYIEGVCVFWFTLEFLVRIICCPDKVFFVKNLLNIID---------FVAILPFYLE-----VGLSGLSSKAARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPTDPSGSNHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHVPKTSQMDSQTTLKSEDNSHRNSTQSDTCPLAAEELTEKKRSDSKQNGDANAVMSDEDHEDPLQFMPLDEKRII 547          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Xenopus
Match: KCNB2 (potassium channel, voltage gated Shab related subfamily B, member 2 [Source:NCBI gene;Acc:100489419])

HSP 1 Score: 204.527 bits (519), Expect = 1.083e-54
Identity = 141/422 (33.41%), Postives = 213/422 (50.47%), Query Frame = 3
Query:  339 YYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEE-----RRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISR---GLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT-FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRK 1577
            Y+FDR P  F  +L++YRTG+LH+   +C     +EL +WGIDE Y+  CC   Y + +E+     RR   TL     E+ D+      CC    + R +LW  L+ P SS+AAK          I S++   LST               ++ + N + +  E+ E+          + + NP+L        AW            FT+E+L + L +P+K KF    ++  D++ +  Y  Y+++F            L++ + SV L F N+  + Q+ RIMRI RI K++R   GLQ L  T+++S  EL LL   L  G+ +FS+L++ AE  +  T F  IP  FWW+ IT+TTVGYGD YPK+  G  +G +  I+G +V  L IPII NNF+ +YK  + Q K  K    L +
Sbjct:   87 YFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETLREREGEEFDNT-----CC---PEKRKKLWDLLEKPNSSVAAKIL-------AIISILFIVLST---------------IALSLNTLPDLQETDEF---------GQPNDNPQLAHVEAVCIAW------------FTMEYLLRFLSSPNKWKFFKGPLNIIDLLAILPY--YVTIF------------LTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALER 442          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 196.438 bits (498), Expect = 2.512e-53
Identity = 141/487 (28.95%), Postives = 229/487 (47.02%), Query Frame = 3
Query:  132 DTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSIL-----NLLKCC--------RGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEY----------QQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYY 1523
            D ++ ++GG    T R+ L  LP +RL  L   +A                 N D      E       ++FDR P++F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ +  CC   +M Y + R  +  L  D FE  +        +L + C          +K+L+ ++W   + P SS AA+  A   L  ++ S+  FCL TH+ F   ++ +E     F    I       E            M+  P L               + +  + FT EFL +V+  PDK +F+ S ++  D +        I  FY  +     +   ++D        +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE            +   F +IP GFWW+++T+TT+GYGD YP +  G  +G++ A++G +   + +P+I NNF  YY
Sbjct:   36 DKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDA---------------FSNFDYDPKTDE-------FFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACC---WMNYRQHRDAEEAL--DSFETPEPTEEEEDGDLKRLCLQEDGRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVNNKTE----VFTQGNITRTETILE------------METEPFL------------TYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVA-------ILPFYLEIGLSGLSSKAAKD-------VLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY 453          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Mouse
Match: Kcnc2 (potassium voltage gated channel, Shaw-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96668])

HSP 1 Score: 209.149 bits (531), Expect = 9.129e-58
Identity = 153/562 (27.22%), Postives = 261/562 (46.44%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAV---QNACYNEEET--------------------------DNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFE-----------DQDSILNLL-------------KCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSY 1616
            I + + VI ++GG    T R+ L  LP +RL +LA    Q  C                                +    + S+   +  +   +       ++FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE           D+D     L             K  R ++KL+ ++W   + P SS AA+  A   L  ++ S+  FCL TH+ F    + +EP         +IN                     +P L+ +  T PA  L   + +  + FT EFL +++ +P+K +F+ +L++  D         ++++  ++L      V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE            +   F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY      + + K  R+ +K +     +S+ ++
Sbjct:    4 IESNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPQGDCLTAAGDKLQPLPPPLSPPPRPPPLSPVPSGCFEGGAGNCSSHGGNGGNGGSDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGR-WRKLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEP---------VINGT-------------------SPVLQYEIETDPA--LTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIID---------FVAILPFYLE-----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSL---AMAKQKLPRKRKKHIPPAPLASSPTF 512          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Mouse
Match: Kcnc2 (potassium voltage gated channel, Shaw-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96668])

HSP 1 Score: 209.149 bits (531), Expect = 1.135e-57
Identity = 152/562 (27.05%), Postives = 258/562 (45.91%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAV---QNACYNEEET--------------------------DNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFE-----------DQDSILNLL-------------KCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSY 1616
            I + + VI ++GG    T R+ L  LP +RL +LA    Q  C                                +    + S+   +  +   +       ++FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE           D+D     L             K  R ++KL+ ++W   + P SS AA+  A   L  ++ S+  FCL TH+ F    + +EP         +IN                     +P L+ +  T PA  L   + +  + FT EFL +++ +P+K +F+ +L++  D + +  ++                V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE            +   F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY      + + K  R+ +K +     +S+ ++
Sbjct:    4 IESNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPQGDCLTAAGDKLQPLPPPLSPPPRPPPLSPVPSGCFEGGAGNCSSHGGNGGNGGSDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGR-WRKLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEP---------VINGT-------------------SPVLQYEIETDPA--LTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFY--------------LEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSL---AMAKQKLPRKRKKHIPPAPLASSPTF 512          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Mouse
Match: Kcnc4 (potassium voltage gated channel, Shaw-related subfamily, member 4 [Source:MGI Symbol;Acc:MGI:96670])

HSP 1 Score: 201.83 bits (512), Expect = 3.665e-55
Identity = 144/514 (28.02%), Postives = 237/514 (46.11%), Query Frame = 3
Query:  105 ESFEMINARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFE----------------DQDSILNLLKC---------------CRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEY----------QQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYY 1523
            E      A + +I ++GG    T R+ L  LP +RL  LA  +     E          +          E       ++FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE                D +  L L +                CRG++    ++W   + P SS AA+  A   L  ++ S+  FCL TH+ F    + +E        +R+ N    +                    +++  T+P   L   + +  + FT+EFL +++  PD   F+ +L++  D         ++++  ++L      V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE                F +IP GFWW+++T+TT+GYGD YPK+  G  +G++ A++G +   + +P+I NNF  YY
Sbjct:   27 EEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPESDGGGAGSSGSSGGGGGGGGCE-------FFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFESPDGGGGGAGPGDEAGDDERELALQRLGPHEGGSGPGAGSGGCRGWQP---RMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVTE-------IHRVGNITSVR-------------------FRREVETEPI--LTYIEGVCVMWFTLEFLVRIVCCPDTLDFVKNLLNIID---------FVAILPFYLE-----VGLSGLSSKAARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY 483          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Mouse
Match: Kcnc4 (potassium voltage gated channel, Shaw-related subfamily, member 4 [Source:MGI Symbol;Acc:MGI:96670])

HSP 1 Score: 202.216 bits (513), Expect = 4.706e-55
Identity = 144/514 (28.02%), Postives = 237/514 (46.11%), Query Frame = 3
Query:  105 ESFEMINARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFE----------------DQDSILNLLKC---------------CRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEY----------QQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYY 1523
            E      A + +I ++GG    T R+ L  LP +RL  LA  +     E          +          E       ++FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE                D +  L L +                CRG++    ++W   + P SS AA+  A   L  ++ S+  FCL TH+ F    + +E        +R+ N    +                    +++  T+P   L   + +  + FT+EFL +++  PD   F+ +L++  D         ++++  ++L      V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE                F +IP GFWW+++T+TT+GYGD YPK+  G  +G++ A++G +   + +P+I NNF  YY
Sbjct:   27 EEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPESDGGGAGSSGSSGGGGGGGGCE-------FFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFESPDGGGGGAGPGDEAGDDERELALQRLGPHEGGSGPGAGSGGCRGWQP---RMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVTE-------IHRVGNITSVR-------------------FRREVETEPI--LTYIEGVCVMWFTLEFLVRIVCCPDTLDFVKNLLNIID---------FVAILPFYLE-----VGLSGLSSKAARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY 483          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Mouse
Match: Kcnb1 (potassium voltage gated channel, Shab-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96666])

HSP 1 Score: 203.371 bits (516), Expect = 1.575e-54
Identity = 147/422 (34.83%), Postives = 210/422 (49.76%), Query Frame = 3
Query:  339 YYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEE-----RRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISR---GLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT-FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRK 1577
            Y+FDR P  F  +L++YRTG LH+   +C     +EL +WGIDE Y+  CC   Y + +E+     +R   TL     E+ D+      CC    + R +LW  L+ P SS+AAK  A       I S+M   LST  L    S N+ P   S +                  F  S     NP+L        AW            FT+E+L + L +P K KF    ++  D++ +  Y  Y+++F            L++ + SV L F N+  + Q+ RIMRI RI K++R   GLQ L  T+++S  EL LL   L  G+ +FS+L++ AE  + DT F  IP  FWW+ IT+TTVGYGD YPK+  G  +G +  I+G +V  L IPII NNF+ +YK  + Q K  K    L +
Sbjct:   83 YFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNT-----CC---AEKRKKLWDLLEKPNSSVAAKILA-------IISIMFIVLSTIAL----SLNTLPELQSLDE-----------------FGQS---TDNPQLAHVEAVCIAW------------FTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPY--YVTIF------------LTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALER 438          
BLAST of Potassium voltage gated channel subfamily C vs. UniProt/SwissProt
Match: sp|P17972|KCNAW_DROME (Potassium voltage-gated channel protein Shaw OS=Drosophila melanogaster OX=7227 GN=Shaw PE=2 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 3.570e-57
Identity = 148/499 (29.66%), Postives = 242/499 (48.50%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGF------------KKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQ---KDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQL 1571
            +++ + V+ ++GG    T +A L ++P +RL  L    A Y+                         LN+   Y+FDR P +F  VL+YYRTG+LH P+ +CGP   +EL FWG+D + + PCC   Y ++ + + T   L R   + +      L    GF            ++++ ++W   D P SS AAK+  ++ +  +  S++ FCL TH   R                 I+ N      ++     + W +DK         T         + + N  FT E L + + +P+K +F+ S ++  D I   S       FY  L  +RFA  L            +IL    ++RIMR+F++++ S GL++LI T + S  EL LL F L+ G+ +F++L+Y AE  Q    + F  IP G WW+++T+TTVGYGD  PK+  G F+G++ A++G +   L +P+I +NF  YY + Q + K  K  R++
Sbjct:    6 MDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDP-----------------------ILNE---YFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVP---------------IVRNIT----VKTANGSNGWFLDKT-------QTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLS-------FYIDLVLQRFASHLEN---------ADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRV 436          
BLAST of Potassium voltage gated channel subfamily C vs. UniProt/SwissProt
Match: sp|Q14B80|KCNC2_MOUSE (Potassium voltage-gated channel subfamily C member 2 OS=Mus musculus OX=10090 GN=Kcnc2 PE=1 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 7.942e-57
Identity = 152/562 (27.05%), Postives = 258/562 (45.91%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAV---QNACYNEEET--------------------------DNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFE-----------DQDSILNLL-------------KCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSY 1616
            I + + VI ++GG    T R+ L  LP +RL +LA    Q  C                                +    + S+   +  +   +       ++FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE           D+D     L             K  R ++KL+ ++W   + P SS AA+  A   L  ++ S+  FCL TH+ F    + +EP         +IN                     +P L+ +  T PA  L   + +  + FT EFL +++ +P+K +F+ +L++  D + +  ++                V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE            +   F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY      + + K  R+ +K +     +S+ ++
Sbjct:    4 IESNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPQGDCLTAAGDKLQPLPPPLSPPPRPPPLSPVPSGCFEGGAGNCSSHGGNGGNGGSDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGR-WRKLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEP---------VINGT-------------------SPVLQYEIETDPA--LTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFY--------------LEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSL---AMAKQKLPRKRKKHIPPAPLASSPTF 512          
BLAST of Potassium voltage gated channel subfamily C vs. UniProt/SwissProt
Match: sp|P22462|KCNC2_RAT (Potassium voltage-gated channel subfamily C member 2 OS=Rattus norvegicus OX=10116 GN=Kcnc2 PE=1 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 2.034e-56
Identity = 149/557 (26.75%), Postives = 253/557 (45.42%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAV---QNACYNEE----------------------ETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILN-------------LLKCCRG----------FKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSY 1616
            I   + VI ++GG    T R+ L  LP +RL +LA    Q  C                                + G+        +  +       ++FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE  D I                ++   G          ++KL+ ++W   + P SS AA+  A   L  ++ S+  FCL TH+ F    + +EP         +IN   +                    L+ +  T PA  L   + +  + FT EFL +++ +P+K +F+ +L++  D + +  ++                V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE            +   F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY      + + K  R+ +K +     +S+ ++
Sbjct:    4 IENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPQGDCLTAAGDKLQPLPPPLSPPPRPPPLSPVPSGCFEGGAGNCSSHGGNGSDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFETPDLIGGDPGDDEDLGGKRLGIEDAAGLGGPDGKSGRWRKLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEP---------VINGTSAV-------------------LQYEIETDPA--LTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFY--------------LEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSL---AMAKQKLPRKRKKHIPPAPLASSPTF 508          
BLAST of Potassium voltage gated channel subfamily C vs. UniProt/SwissProt
Match: sp|Q96PR1|KCNC2_HUMAN (Potassium voltage-gated channel subfamily C member 2 OS=Homo sapiens OX=9606 GN=KCNC2 PE=1 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 9.103e-56
Identity = 152/567 (26.81%), Postives = 255/567 (44.97%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQ----------------------------------NACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFE-----------DQDSILNLL-------------KCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSY 1616
            I   + VI ++GG    T R+ L  LP +RL +LA                                      C+     + S + G A   D      E       ++FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE           D+D     L             K  R +++L+ ++W   + P SS AA+  A   L  ++ S+  FCL TH+ F    + +EP     N   ++                         L+ +  T PA  L   + +  + FT EFL +++ +P+K +F+ +L++  D + +  ++                V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE            +   F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY      + + K  R+ +K +     +S+ ++
Sbjct:    4 IENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRAS--DHPGGGRE-------FFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGR-WRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPV---INGTSVV-------------------------LQYEIETDPA--LTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFY--------------LEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSL---AMAKQKLPRKRKKHIPPAPQASSPTF 508          
BLAST of Potassium voltage gated channel subfamily C vs. UniProt/SwissProt
Match: sp|Q03721|KCNC4_HUMAN (Potassium voltage-gated channel subfamily C member 4 OS=Homo sapiens OX=9606 GN=KCNC4 PE=1 SV=2)

HSP 1 Score: 202.601 bits (514), Expect = 1.402e-54
Identity = 150/514 (29.18%), Postives = 240/514 (46.69%), Query Frame = 3
Query:  105 ESFEMINARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFE----------------DQDSILNLLKC---------------CRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEY----------QQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYY 1523
            E      A + +I ++GG    T R+ L  LP +RL  LA  +      ETD      S  +                ++FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE                D +  L L +                CRG++    ++W   + P SS AA+  A   L  ++ S+  FCL TH+              +FN +R +      E LR     S          +++  T+P   L   + +  L FT+EFL +++  PD   F+ +L++  D         ++++  ++L      V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE                F +IP GFWW+++T+TT+GYGD YPK+  G  +G++ A++G +   + +P+I NNF  YY
Sbjct:   27 EEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPDG-GGRPETDGGGVGSSGSSGGGGCE----------FFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFESPDGGGSGAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQP---RMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHE--------------AFNIDRNVT-----EILRVGNITSV-------HFRREVETEPI--LTYIEGVCVLWFTLEFLVRIVCCPDTLDFVKNLLNIID---------FVAILPFYLE-----VGLSGLSSKAARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY 479          
BLAST of Potassium voltage gated channel subfamily C vs. TrEMBL
Match: A0A068YE36 (Potassium voltage gated channel subfamily C OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000803600 PE=3 SV=1)

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 321/599 (53.59%), Postives = 395/599 (65.94%), Query Frame = 3
Query:  132 DTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQ--------------------NACYNEEET-------DNSIKHGSAQNLDLTSSAMEQLNK----------------------------------QPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIIN-NNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFY---YHLNQKRFAVALSQ--DSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSYGNSPCPGM--FRDHTTTQSKMRRNRKLNESIEKPESS 1721
            D V   IGG++F+TRRA LYRLP+SRLYM+A Q                    ++ Y  E T        N +      N DL S+A    N+                                  QP+Y+FDRDPEIFRFVLDYYRTGELHLP+ ICGPFVRKELIFWGIDES I PCCMPAYMRY+EE+RTK+TLFRDCFED DS+ NL+K  RG+KK RY++WLF+DHP SS AA+ WA  LL+LMIAS++CFC ST  +FR S+  ++  N    ++ ++N +N   + L     C       N K++KDC T+PA GLV+ D+ LN++ T EFL KVLLAPDK KFLTS++S  DM+ L +YW YISVFY   YH  Q   +  L++  D     LW +NILSMTQ++RI+RIF++SKISRGL+VL+LTVKKSIPEL LLAFLLMNGMF+FS +IYMAEY   DTF DIP  FWWSIITLTTVGYGD YPK   GY +GS+AAISGCIVTGLAIPIIGNNFNTYY YM+NQLKEDKYL++LR+D+N V        GN+   G+  F + T      R+ R+     + P S+
Sbjct:   24 DVVNLCIGGRLFITRRATLYRLPDSRLYMIATQGEEAARAASQKHEYRSQLSSDSQYAGEYTVGGATLLPNPVASSLFGNKDLISAAAVCKNQLYNTSPTESHSTRTMDNNHSYPGTLLQDKASVAPQPVYFFDRDPEIFRFVLDYYRTGELHLPTNICGPFVRKELIFWGIDESLIDPCCMPAYMRYDEEKRTKKTLFRDCFEDIDSMQNLVKFSRGWKKWRYRMWLFMDHPTSSFAAQIWASFLLILMIASILCFCFSTSSIFRRSAWAAK--NFQAKYSGLLNISNLLDDPLE---ICDDSSRITNSKVQKDCFTEPASGLVILDMALNVVLTTEFLLKVLLAPDKHKFLTSIVSIIDMVNLFTYWIYISVFYFTYYHKKQSAASFDLTKMMDRPPNNLWLLNILSMTQIMRILRIFKVSKISRGLRVLMLTVKKSIPELTLLAFLLMNGMFMFSCMIYMAEYSVNDTFADIPEAFWWSIITLTTVGYGDTYPKGTAGYIVGSMAAISGCIVTGLAIPIIGNNFNTYYMYMKNQLKEDKYLKELRRDINSVG-------GNNIMKGLSGFAEKTGIPMLHRKYRQFRGDKQYPVSN 610          
BLAST of Potassium voltage gated channel subfamily C vs. TrEMBL
Match: A0A068W7G3 (Potassium voltage gated channel subfamily C OS=Echinococcus granulosus OX=6210 GN=EgrG_000803600 PE=3 SV=1)

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 319/599 (53.26%), Postives = 397/599 (66.28%), Query Frame = 3
Query:  132 DTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQ--------------------NACYNEEET-------DNSIKHGSAQNLDLTSSAMEQLNK----------------------------------QPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIIN-NNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYY-HLNQKRFAVALS----QDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSYGNSPCPGM--FRDHTTTQSKMRRNRKLNESIEKPESS 1721
            D V   IGG++F+TRRA LYRLP+SRLYM+A Q                    ++ Y  E T        N +      N DL S+A    N+                                  QP+Y+FDRDPEIFRFVLDYYRTGELHLP+ ICGPFVRKELIFWGIDES I PCCMPAYMRY+EE+RTK+TLFRDCFED DS+ NL+K  RG+KK RY++WLF+DHP SS AA+ WA  LL+LMIAS++CFC ST  +FR S+  ++  N    ++ ++N +N   + L     C       N K++KDC T+PA GLV+ D+ LN++ T EFL KVLLAPDK KFLTS++S  DM+ L +YW YISVFY+ + ++K+ A +       D     LW +NILSMTQ++RI+RIF++SKISRGL+VL+LTVKKSIPEL+LLAFLLMNGMF+FS +IYMAEY   DTF DIP  FWWSIITLTTVGYGD YPK   GY +GS+AAISGCIVTGLAIPIIGNNFNTYY YM+NQLKEDKYL++LR+D+N V        GN+   G+  F + T      R+ R+     + P S+
Sbjct:   24 DVVNLCIGGRLFITRRATLYRLPDSRLYMIATQGEEAARAASQKHEYRSQLSSDSQYTGEYTVGGATLLPNPVASSLFGNKDLISAAAVCKNQLYNTSPTESHSTRTMDNNHSYPGTLLQDKASVAPQPVYFFDRDPEIFRFVLDYYRTGELHLPTNICGPFVRKELIFWGIDESLIDPCCMPAYMRYDEEKRTKKTLFRDCFEDIDSMQNLVKFSRGWKKWRYRMWLFMDHPTSSFAAQIWASFLLILMIASILCFCFSTSSIFRRSAWAAK--NFQAKYSGLLNISNLLDDPLE---ICDDSSRITNSKVQKDCFTEPASGLVILDMALNVVLTTEFLLKVLLAPDKHKFLTSIVSIIDMVNLFTYWIYISVFYFTYYHKKQSAASFDPTKMMDRPPNNLWLLNILSMTQIMRILRIFKVSKISRGLRVLMLTVKKSIPELMLLAFLLMNGMFMFSCMIYMAEYSVNDTFADIPEAFWWSIITLTTVGYGDTYPKGTAGYIVGSMAAISGCIVTGLAIPIIGNNFNTYYMYMKNQLKEDKYLKELRRDINSVG-------GNNIMKGLGGFAEKTGIPMLHRKYRQFRGDKQYPVSN 610          
BLAST of Potassium voltage gated channel subfamily C vs. TrEMBL
Match: A0A0X3P7G3 (Potassium voltage-gated channel subfamily C member 2 (Fragment) OS=Schistocephalus solidus OX=70667 GN=KCNC2 PE=3 SV=1)

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 284/459 (61.87%), Postives = 347/459 (75.60%), Query Frame = 3
Query:  228 QNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNK-QPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSV-----RLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLN 1586
            +N  Y+ EE + +           + SA + ++  QP+Y+FDRDPEIFRFVLDYYRTGELHLPS ICGPFVRKELIFWGIDES I PCCMPAYMRY+EE+RTK+TLFRDCFED DS+ NL+K  RG+KK RY+LWLF+DHP SS  AK WA+LLLVLMIASV+C+C ST  +FR S+  ++      +++R+ N     +       C       NPK+++DC T+P   LV+ DI+LN +F++EF+ K LLAPDK KFLTS +S  D++IL SYW YI++FY+   QK+    +  D G +      LW +NILS TQ LRI+RIFRISKISRGL+VLILTV+KSIPELVLLAFLLMNGMF+FS +IYMAEY   DTF DIP  FWWSIITLTTVGYGD YP+   GY +GSIAA+SGCI+TGLAIPIIGNNFNTYY YM+NQLKEDKYL++LRKD+N
Sbjct:   17 RNQVYSSEENNLNTPATPRPRETYSHSAGDYVSTPQPVYFFDRDPEIFRFVLDYYRTGELHLPSNICGPFVRKELIFWGIDESLIDPCCMPAYMRYDEEKRTKKTLFRDCFEDIDSMQNLVKFSRGWKKWRYRLWLFMDHPSSSFVAKVWAMLLLVLMIASVLCYCFSTSSIFRRSAWAAKTVTSHPDYSRLYNITYKTD--DPLDICDDIINSNNPKIRRDCFTEPVPVLVILDIVLNCVFSVEFILKCLLAPDKPKFLTSFVSIIDVVILLSYWIYIAIFYFLYYQKKPDPHM-LDGGHIAQPPNNLWLLNILSTTQALRILRIFRISKISRGLRVLILTVRKSIPELVLLAFLLMNGMFMFSCMIYMAEYTVNDTFVDIPEAFWWSIITLTTVGYGDTYPRGTAGYVVGSIAAVSGCILTGLAIPIIGNNFNTYYMYMKNQLKEDKYLKELRKDIN 472          
BLAST of Potassium voltage gated channel subfamily C vs. TrEMBL
Match: A0A267H5B0 (BTB domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013997g2 PE=3 SV=1)

HSP 1 Score: 542.732 bits (1397), Expect = 0.000e+0
Identity = 283/505 (56.04%), Postives = 354/505 (70.10%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVF---YYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSYGNS 1625
            +N  DTV  ++GG  FVTRRA LYR P +RLY               N I             A ++L K   Y+FDRDPE+FRF+LD+YRTGELHLP+ ICGPFVRKEL+FWGI E+ I PCC+P Y+RY+EE+RTK TLF+DCFED + + +L++C RG ++LRY++WLFLD+P SSL AK WA+LLL+LMI SVMC+CL TH  FR  S            N+I  +N +         CS     +NPK++KDC T+P   LV+ DI LN  FT EF  K++++PDK KFL S IS  D+IIL SYW Y+S+F   YY  N      ++  +   V +W++N+LSM+Q LRI+RIF+ISKISRGL+VL+LTVKKSIPELVLL FLLMNGMFLFS+++YMAEY Q DTF DIPH FWWSI+TLTTVGYGD  PK G G+ IGS+ A+SGCIVTGLAIPIIGNNFNTYYKYMQNQ+KE+KY++ + KDL    S+    YG  
Sbjct:   43 VNPADTVTITVGGCNFVTRRATLYRFPNTRLY---------------NQI-------------AADELQKDS-YFFDRDPEVFRFILDFYRTGELHLPTNICGPFVRKELVFWGIHEASIGPCCLPHYVRYDEEKRTKNTLFKDCFEDIEPMQSLVRCSRGVRRLRYRMWLFLDYPTSSLPAKLWAMLLLLLMICSVMCYCLQTHLAFRTPS------------NKIQWSNSTD------GLCSHANRFENPKIRKDCETEPLAALVVVDITLNAFFTFEFFIKLIVSPDKPKFLRSPISIMDIIILGSYWIYVSLFFFYYYRPNADELKNSMELEEPLVSIWWLNVLSMSQALRILRIFKISKISRGLRVLMLTVKKSIPELVLLGFLLMNGMFLFSSMVYMAEYNQIDTFSDIPHAFWWSIVTLTTVGYGDIVPKGGPGFIIGSVTAVSGCIVTGLAIPIIGNNFNTYYKYMQNQMKENKYMKIMTKDL--TNSNQGGRYGQG 498          
BLAST of Potassium voltage gated channel subfamily C vs. TrEMBL
Match: A0A267GJ59 (BTB domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013997g1 PE=3 SV=1)

HSP 1 Score: 542.347 bits (1396), Expect = 0.000e+0
Identity = 283/505 (56.04%), Postives = 354/505 (70.10%), Query Frame = 3
Query:  120 INARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVF---YYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSYGNS 1625
            +N  DTV  ++GG  FVTRRA LYR P +RLY               N I             A ++L K   Y+FDRDPE+FRF+LD+YRTGELHLP+ ICGPFVRKEL+FWGI E+ I PCC+P Y+RY+EE+RTK TLF+DCFED + + +L++C RG ++LRY++WLFLD+P SSL AK WA+LLL+LMI SVMC+CL TH  FR  S            N+I  +N +         CS     +NPK++KDC T+P   LV+ DI LN  FT EF  K++++PDK KFL S IS  D+IIL SYW Y+S+F   YY  N      ++  +   V +W++N+LSM+Q LRI+RIF+ISKISRGL+VL+LTVKKSIPELVLL FLLMNGMFLFS+++YMAEY Q DTF DIPH FWWSI+TLTTVGYGD  PK G G+ IGS+ A+SGCIVTGLAIPIIGNNFNTYYKYMQNQ+KE+KY++ + KDL    S+    YG  
Sbjct:   29 VNPADTVTITVGGCNFVTRRATLYRFPNTRLY---------------NQI-------------AADELQKDS-YFFDRDPEVFRFILDFYRTGELHLPTNICGPFVRKELVFWGIHEASIGPCCLPHYVRYDEEKRTKNTLFKDCFEDIEPMQSLVRCSRGVRRLRYRMWLFLDYPTSSLPAKLWAMLLLLLMICSVMCYCLQTHLAFRTPS------------NKIQWSNSTD------GLCSHANRFENPKIRKDCETEPLAALVVVDITLNAFFTFEFFIKLIVSPDKPKFLRSPISIMDIIILGSYWIYVSLFFFYYYRPNADELKNSMELEEPLVSIWWLNVLSMSQALRILRIFKISKISRGLRVLMLTVKKSIPELVLLGFLLMNGMFLFSSMVYMAEYNQIDTFSDIPHAFWWSIVTLTTVGYGDIVPKGGPGFIIGSVTAVSGCIVTGLAIPIIGNNFNTYYKYMQNQMKENKYMKIMTKDL--TNSNQGGRYGQG 484          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Cavefish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 210.69 bits (535), Expect = 3.831e-59
Identity = 149/498 (29.92%), Postives = 244/498 (49.00%), Query Frame = 3
Query:  138 VIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQP--IYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCR-----------------------GFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYK 1526
            +I ++GG    T R  L  LP +RL +LA +                      L SSA +Q+  +    Y+FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D F D +++    +                          G+++ +  +W   + P SS AA+  A   L  ++ S+  FCL TH+ F                N IIN  ++   LRN +      ++ +P+ + +  T PA  L   + +  L FT EFL +V  +PDK +F+ S+++  D         ++++  ++L      V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S+ E  LL   L  G+ +F+ +IY AE                F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY 
Sbjct:    7 IILNVGGTRHETYRNTLRTLPGTRLALLATE----------------------LPSSACQQVRARANNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCC---WMTYRQHRDAEEAL--DVF-DMNALGGGPEGPGGEDGDELGEAAEQREHADKERDTGWRRWQPVMWNLFEDPYSSRAARFVAFASLFFIMVSITTFCLETHEAF----------------NTIINKTDA---LRNDSL-----LEVSPQYEIE--TDPA--LTYVEGVCVLWFTFEFLVRVTFSPDKLEFVKSVLNIID---------FVAILPFYLE-----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASVNEFFLLIIFLALGVLIFATMIYYAERIGANPNDPTASDHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYS 434          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Cavefish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 208.764 bits (530), Expect = 2.416e-58
Identity = 147/500 (29.40%), Postives = 245/500 (49.00%), Query Frame = 3
Query:  123 NARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCR-----------------------GFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYY 1523
            +  + +I ++GG    T R  L  LP +RL +LA +                SA  + + + A  +      Y+FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D F D +++    +                          G+++ +  +W   + P SS AA+  A   L  ++ S+  FCL TH+ F                N IIN  ++   LRN +      ++ +P+ + +  T PA  L   + +  L FT EFL +V  +PDK +F+ S+++  D         ++++  ++L      V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S+ E  LL   L  G+ +F+ +IY AE                F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY
Sbjct:   16 HGNERIILNVGGTRHETYRNTLRTLPGTRLALLATE-------------LPSSACAVTVRARANNE------YFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCC---WMTYRQHRDAEEAL--DVF-DMNALGGGPEGPGGEDGDELGEAAEQREHADKERDTGWRRWQPVMWNLFEDPYSSRAARFVAFASLFFIMVSITTFCLETHEAF----------------NTIINKTDA---LRNDSL-----LEVSPQYEIE--TDPA--LTYVEGVCVLWFTFEFLVRVTFSPDKLEFVKSVLNIID---------FVAILPFYLE-----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASVNEFFLLIIFLALGVLIFATMIYYAERIGANPNDPTASDHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY 448          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Cavefish
Match: kcnb1 (potassium voltage-gated channel subfamily B member 1 [Source:NCBI gene;Acc:103042196])

HSP 1 Score: 207.608 bits (527), Expect = 3.031e-56
Identity = 140/417 (33.57%), Postives = 212/417 (50.84%), Query Frame = 3
Query:  339 YYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISR---GLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT-FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRK 1577
            Y+FDR P  F  +L++YRTG+LH+   +C     +EL +WG+DE Y+  CC   Y + +E+   +     D  +D++       CC    + R +LW  L+ PGSS+AAK  A       I S++   LST               ++ + N +    E  E+ ++           NP+L        AW            FT+E+L + L AP+K KF    ++  D++ +  Y  Y+++F            L++ + SV L F N+  + Q+ RIMRI RI K++R   GLQ L  T+++S  EL LL   L  G+ +FS+L++ AE  + DT F  IP  FWW+ IT+TTVGYGD YPK+  G  +G +  I+G +V  L IPII NNF+ +YK  + Q K  K    L +
Sbjct:   86 YFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDYWGVDEIYLESCCQARYHQKKEQMNEELKREADTLKDREGEEFDNTCC---SEKRKKLWDLLEKPGSSVAAKILA-------IISILFIVLST---------------IALSLNTLPELQEIDEFGQST---------DNPQLAHVEAVCIAW------------FTMEYLLRFLSAPNKWKFFKGPLNVIDLLAILPY--YVTIF------------LTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALER 441          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Cavefish
Match: ENSAMXT00000002571.2 (potassium voltage-gated channel subfamily C member 4 [Source:NCBI gene;Acc:103043651])

HSP 1 Score: 202.601 bits (514), Expect = 1.120e-55
Identity = 146/506 (28.85%), Postives = 245/506 (48.42%), Query Frame = 3
Query:   93 SKSGESFEMINARDT--VIFSIGGQIFVTRRANLYRLPESRLYMLA-----VQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQD-----------SILNLLKCCRG-FKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEY----------QQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYY 1523
            SK+    EM  A D+  +I ++GG    T ++ L  LP +RL  LA       ++      +  +    ++      ++ +        Y+FDR P IF +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE  +            I +  +  RG F   + ++W   + P SS AA++ A + L  ++ S+  FCL TH+ F    + +E   +  N  +++           YT               +  T+P   L L + +  + FT EFL +++  PDK  F+ +L++  D +        I  FY  L+    +   + D        +  L + + +RI+RIF++++   GL+VL  T++ S+ E  LL   L  G+ +F+ +IY AE                F +IP  FWW+++T+TT+GYGD +P++  G  +G++ AI+G +   + +P+I NNF  YY
Sbjct:   21 SKTCLKEEMARAEDSDKIILNVGGTRHETYKSTLRSLPGTRLAWLADPDVRSGDSLGARATSATTTTTTTSTTTTTPATVISTTTTTNEYFFDRHPAIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFEPPEPDTDPDDDERLGIEDAPERTRGRFTSCQPKIWALFEDPYSSRAARAVAFVSLFFILVSITNFCLETHEAFNDLQNRTEEVTVG-NDTKVV-----------YTV--------------EVVTKPV--LTLVEGICVVWFTFEFLVRIICCPDKLVFVKNLLNIIDFVA-------ILPFYLELSLSGLSSKAASD-------VLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASVNEFCLLIIFLALGVLIFATMIYYAERIGANPTDPRGSNHTHFKNIPISFWWAVVTMTTLGYGDMFPQTWLGMMVGALCAIAGVLTIAMPVPVIVNNFGMYY 479          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Cavefish
Match: ENSAMXT00000054821.1 (potassium voltage-gated channel subfamily C member 4 [Source:NCBI gene;Acc:103043651])

HSP 1 Score: 201.83 bits (512), Expect = 1.499e-55
Identity = 146/506 (28.85%), Postives = 244/506 (48.22%), Query Frame = 3
Query:   93 SKSGESFEMINARDT--VIFSIGGQIFVTRRANLYRLPESRLYMLA-----VQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQD-----------SILNLLKCCRG-FKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEY----------QQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYY 1523
            SK+    EM  A D+  +I ++GG    T ++ L  LP +RL  LA       ++      +  +    ++      ++ +        Y+FDR P IF +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE  +            I +  +  RG F   + ++W   + P SS AA+  A + L  ++ S+  FCL TH+ F    + +E   +  N  +++           YT               +  T+P   L L + +  + FT EFL +++  PDK  F+ +L++  D +        I  FY  L+    +   + D        +  L + + +RI+RIF++++   GL+VL  T++ S+ E  LL   L  G+ +F+ +IY AE                F +IP  FWW+++T+TT+GYGD +P++  G  +G++ AI+G +   + +P+I NNF  YY
Sbjct:   21 SKTCLKEEMARAEDSDKIILNVGGTRHETYKSTLRSLPGTRLAWLADPDVRSGDSLGARATSATTTTTTTSTTTTTPATVISTTTTTNEYFFDRHPAIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMTYRQHRDAEEAL--DIFEPPEPDTDPDDDERLGIEDAPERTRGRFTSCQPKIWALFEDPYSSRAARVIAFVSLFFILVSITNFCLETHEAFNDLQNRTEEVTVG-NDTKVV-----------YTV--------------EVVTKPV--LTLVEGICVVWFTFEFLVRIICCPDKLVFVKNLLNIIDFVA-------ILPFYLELSLSGLSSKAASD-------VLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASVNEFCLLIIFLALGVLIFATMIYYAERIGANPTDPRGSNHTHFKNIPISFWWAVVTMTTLGYGDMFPQTWLGMMVGALCAIAGVLTIAMPVPVIVNNFGMYY 479          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004235.1 (pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-1 gene:ENSPMAG00000003870.1 transcript:ENSPMAT00000004235.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 200.29 bits (508), Expect = 2.535e-57
Identity = 166/496 (33.47%), Postives = 231/496 (46.57%), Query Frame = 3
Query:  138 VIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNL-DLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEE--------ERRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPT---NMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISR---GLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT-FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRK 1577
            V  ++GG +       L RLP +RL  L   N             HG+   L D  S A  +      Y+FDR P  F  VL++YRTG LH+   +C     +EL +WG+DE Y+  CC   Y + +E        E  + R    D FE          CC      R +LW  L++P SSLAAK  A       I S++   LST  L    S N+ P       F+H  II+N                     PKL +      AW            FT+E+L + + AP+K KF    ++  D++ +  Y  YI++F            L++ S  V   F N+  + Q+ RIMRI RI K++R   GLQ L  T+++S  EL LL   L  G+ +FS+L++ AE  + DT F  IP  FWW+ IT+TTVGYGD YP +  G  IG +  I+G +V  L IPII NNF+ +YK  + Q K  K    L +
Sbjct:    2 VRLNVGGLVHEVLWRTLERLPRTRLGRLHATNT------------HGALSELCDDYSIADNE------YFFDRHPGAFASVLNFYRTGRLHMSEEMCALSFGQELDYWGVDEIYLETCCQARYHQKKEQMSEELRREAESAREREGDEFEG--------TCC---ADKRRKLWELLENPNSSLAAKGMA-------IVSILFIVLSTIAL----SLNTLPDLQHKDEFSH--IIDN---------------------PKLAQVEAVCIAW------------FTMEYLLRFMSAPNKWKFFKGALNVIDLMAILPY--YITIF------------LTESSRGVS-QFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEPDTKFHSIPASFWWATITMTTVGYGDIYPMTLLGKIIGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAVKRREALER 407          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Sea Lamprey
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 197.593 bits (501), Expect = 1.883e-54
Identity = 140/494 (28.34%), Postives = 234/494 (47.37%), Query Frame = 3
Query:  132 DTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFED-----QDSILNLLKCCRGF---------------KKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYY 1523
            + V+ ++GG    T R  L  LP +RL  L   +A                 N D  +   E       ++FDR P +F  +L+YYRTG+LH PS +CGP   +ELIFWGIDE+ + PCC   +M Y + R  +  L    FE+      D +    +  + F               ++ + ++W   + P SS AA+  AL  L+ ++ S+  FCL TH+ F                N ++N  E      NYT  +        K+  D  T P   L+  + +    F+ EFL +++  PDK+ F+ + ++  D + +  ++                V LS  +       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +I+ AE               +F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF+ YY
Sbjct:   36 ERVVINVGGTRHETYRGTLRTLPGTRLSWLTEPDA---------------FANFDYDAKGNE-------FFFDRHPTVFAHILNYYRTGKLHCPSEVCGPLFEEELIFWGIDETDVEPCC---WMNYRQHRDAEEALVS--FENPDINGNDEVNEDGEVSKRFGLDERSPDGGKLGFLRRWQPRMWALFEDPYSSRAARIVALASLLFILISITTFCLETHEAF----------------NTVLNKTE------NYTINNV----TTQKVYVDVETDPV--LMYVEGVCVAWFSFEFLVRIICCPDKKVFIKNYLNVIDFVAILPFY--------------LEVGLSSLTSKPARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIFYAERFGANPNDPTASDHTSFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFSMYY 460          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011463.1 (pep scaffold:Pmarinus_7.0:GL479450:27175:28578:-1 gene:ENSPMAG00000010436.1 transcript:ENSPMAT00000011463.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.532 bits (397), Expect = 1.274e-41
Identity = 134/481 (27.86%), Postives = 213/481 (44.28%), Query Frame = 3
Query:  147 SIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRD-----------------CFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISR---GLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT-FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYK 1526
            ++GG     R A L R P++RL +LA +             +H     L++        ++   +YFDR P +F +VL++YRTG+LH+ + +C     +E+ +WGI E +I  CC     RY E  R +    RD                 C    D+     + C   +K   +LWL L++PG SL++K +A   L  ++ S++  C+           NS P    F+ N      E    +    FC +W                              FT EFL + L+ P+ R F  + ++  D++ +  ++  + V            ++ +  G +     N+  + QVLR+ RIFRI K++R   GL+ L  T+K S  E+ LL   L  G+ +FS L Y  E   + +   DIP  +WW+ I++TTVGYGD  P +  G  + +   + G IV  L I II N F  YY+
Sbjct:   23 NVGGLKRTLRHAVLLRFPQTRLALLASRR------------RHSWEAVLEMCDDYDAARDE---FYFDRSPGVFSYVLNFYRTGKLHVMAEVCAHSFSQEIAYWGIHEFFIDSCCS---YRYHE--RMEDYAGRDSEEKSEESSEASSFEDMCLLQADAKRFEHQRCGQHRK---RLWLLLENPGFSLSSKVFAATSLATVVISIITMCI-----------NSTPEFQLFDANG--KELEDPSLMAVECFCIAW------------------------------FTSEFLVRFLVTPNVRSFSQNPLNIIDLVSILPFYITLVV-----------DSVLESGGELH----NLGQVVQVLRLARIFRILKLARHSTGLRSLGTTLKHSYEEVGLLLLFLSVGISIFSVLTYAVEKDDEGSELRDIPTCWWWATISMTTVGYGDTVPVTVPGKLMATACIMCGIIVVALPITIIFNKFTKYYR 422          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005395.1 (pep scaffold:Pmarinus_7.0:GL482646:8602:10978:-1 gene:ENSPMAG00000004908.1 transcript:ENSPMAT00000005395.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.14 bits (383), Expect = 5.110e-40
Identity = 84/214 (39.25%), Postives = 126/214 (58.88%), Query Frame = 3
Query:  948 FTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISR---GLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT-FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRK 1577
            FT E++ + L +P+K KF    ++  D++ +  Y  YI++F            L++ + SV L F N+  + Q+ RIMRI RI K++R   GLQ L  T+++S  EL LL   L  G+ +FS+L++ AE  ++DT F  IP  FWW+ IT+TTVGYGD YP++  G  +G +  I+G +V  L IPII NNF+ +YK  + Q K  K    L +
Sbjct:   52 FTTEYMLRFLSSPNKWKFFKGALNVIDLLAILPY--YITIF------------LTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEQDTKFKSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAVKRREALER 250          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001869.1 (pep scaffold:Pmarinus_7.0:GL480351:152:3521:-1 gene:ENSPMAG00000001700.1 transcript:ENSPMAT00000001869.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.288 bits (373), Expect = 1.338e-39
Identity = 89/238 (37.39%), Postives = 131/238 (55.04%), Query Frame = 3
Query:  948 FTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISR---GLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT-FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSYGNSPCPGMFRD 1649
            FT E++ + L +P+K KF    ++  D++ +  Y  YI++F            L++ + SV L F N+  + Q+ RIMRI RI K++R   GLQ L  T+++S  EL LL   L  G+ +FS+L++ AE  + DT F  IP  FWW+ IT+TTVGYGD YP++  G  +G +  I+G +V  L IPII NNF+ +YK  + Q K  K    L +     +  S  S    P  G   D
Sbjct:   53 FTTEYMLRFLSSPNKWKFFKGALNVIDLLAILPY--YITIF------------LTESNHSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFRSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAVKRREALERAKRNGSIVSMNSRDVFPQGGDLSD 275          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Nematostella
Match: EDO39804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W8])

HSP 1 Score: 205.297 bits (521), Expect = 6.562e-59
Identity = 145/494 (29.35%), Postives = 235/494 (47.57%), Query Frame = 3
Query:  114 EMINARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTL--FRDCFEDQDSILNLLKCCRG-------------FKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT-FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLK 1547
            E  NA D V+ ++GGQ   T    L  +P++RLY +           T+N  +       D  +S          ++FDR P +F  VL++YRTG+LH P+ +CGP    EL FWGIDE  + PCC   ++ Y++ R  +  L  F     D +S+ ++     G             +KK + ++W   + P SS+ A+  A + + L+I+SV  FCL T   F                                          NPK      T   + L + + +    FT+EFLF+++  PDK  F    ++  D+  +  +  Y+++     N K   V                L + +++R+ RIF++S+ S GLQ+L  T++ S  EL LL F L  G+ +FS++I+ AE   K T F  IPH FWW+++T+TT+GYGD  P +  G  +GS+ A+ G ++  L +P+I +NF+ YY + + ++K
Sbjct:   10 EQTNAGDRVVINVGGQKHETYIGTLKNIPDTRLYWI-----------TENGTQ---LPEFDPNTSE---------FFFDRHPGVFAQVLNFYRTGKLHCPNDVCGPLFEDELAFWGIDELQVEPCC---WLNYKQHREAQANLDPFDHHDSDNESVGDMDMSVYGLVADSIRQRNRTWWKKYQPRIWTMFEEPYSSIPAQVLAFITMFLIISSVCLFCLETVPKF-----------------------------------------DNPK------TSEGFVLYILEAVCVAWFTLEFLFRLIFCPDKLSFFKKPMNWIDLGAILPF--YLTLIVRESNFKTIVV----------------LRVVRLIRVFRIFKLSRHSYGLQILGHTLRSSCSELFLLVFFLTIGVVIFSSVIFYAEKDTKGTHFTTIPHTFWWAVVTMTTLGYGDMVPITWQGQIVGSLCAVCGVLMIALPVPVIVSNFSLYYSHAKARMK 412          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Nematostella
Match: EDO38237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDJ4])

HSP 1 Score: 192.586 bits (488), Expect = 2.139e-54
Identity = 143/484 (29.55%), Postives = 223/484 (46.07%), Query Frame = 3
Query:  138 VIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQD-----------SILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEY---QQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLK 1547
            +I ++GG    T  + L  +P++RL  +A +N+  NE+                        NK+  Y+FDR P  F  VL++YRTG+LH P+ +CGP   +ELIFWGIDE  + PCC   Y ++ E     +      F D               +N L C   +K+++ QLW  LD P SS  AK ++    + +  S+  FC +T    R               N I+ + E  +++    FCS                              + F+ E   +++  P K  F   +++  D + +  +  Y+++FY +                       I+ M  V+RIMR+FR  K+S GLQ++I T+K S  ELVLL  +++  M +FS+++Y  E     +   F  +P  FWW +IT+TTVGYGD  P++  G  IG   AI G ++  L I +IG+NFN YY + Q +LK
Sbjct:   18 IIINVGGFRHETSVSTLQNIPDTRLSWIA-ENSTVNED------------------------NKRE-YFFDRHPTAFCQVLNFYRTGKLHCPTEMCGPMFEEELIFWGIDEKQMEPCCWGTYTQHREAEENLKAFVGPGFNDLKDEPAENHMGSYGSINELNC---WKRIQPQLWETLDEPHSSKMAKIFSYTSCLFIALSIATFCATTMPAIR--------------KNNIMGSREGLDHIE--MFCS------------------------------IFFSFELFMRLISCPSKLHFCRGIMNWIDFVAIIPF--YVNIFYPN----------------------PIVRMFLVIRIMRLFRFIKLSYGLQIMIQTLKASSHELVLLLLMVLIPMVMFSSIVYYVEVIIEGRGAQFTSVPESFWWCLITMTTVGYGDMTPQTWPGKIIGGACAICGVLIVALPISVIGSNFNLYYAHAQARLK 402          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Nematostella
Match: EDO47871 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL57])

HSP 1 Score: 187.963 bits (476), Expect = 1.828e-52
Identity = 134/407 (32.92%), Postives = 200/407 (49.14%), Query Frame = 3
Query:  342 YFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTL--FRDCFE-------DQDSILNLLKCCRGFK--KLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT-FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYK 1526
            +F RDPEIF+ ++ YYR G+ H P  IC    ++EL +WGI    +  CC   Y  + +E      L   ++ F+       +QD +  LL+     K  +L+ ++W   ++P SS  AK   LL    ++ S +  CL+T D  R    N E  +     N ++   E+         C +W                              FT+E+L ++L AP    FL S+++  D++ +  Y       Y+ L    F   L      +R     IL + ++LRI+RIF++++ S GLQ L  T K+S  EL LL  LL+ GM LFS+L+Y AE  + ++ F  IP  FWWSIIT+TTVGYGD YP +  G  +GS+  ISG I   L IP I +NF+ +YK
Sbjct:   69 FFQRDPEIFKTIMCYYRNGKFHFPRTICIEHFQRELKYWGISIKNMGDCC---YNHFHQENEAVENLMKIKEAFKKDLNMKKEQDEVDLLLEVESRSKLARLKRKMWDLFENPHSSFMAKIVYLLSSFFVMLSTVALCLNTIDSLRIKLDNGETAD-----NAVLAGIEAG--------CIAW------------------------------FTVEYLIRLLSAPRIVPFLKSIMNTIDLLAILPY-------YFELLSLAFDNQLDYRFVEMR----RILQILRILRIVRIFKMARHSVGLQTLAYTFKQSTAELGLLGTLLIMGMTLFSSLVYFAEEAEPNSMFKSIPEAFWWSIITMTTVGYGDVYPVTPLGKLVGSLCCISGIIFIALPIPTIVSNFSQFYK 418          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Nematostella
Match: EDO48067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ6])

HSP 1 Score: 175.252 bits (443), Expect = 5.150e-48
Identity = 135/487 (27.72%), Postives = 226/487 (46.41%), Query Frame = 3
Query:  123 NARDTVIFSIGGQIF---VTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTL-FR---DCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEY-----QQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLK 1547
            + RD V+ + GG+ F   ++   N+  LP S++              T+N IK      LD    + E       Y+FDR P +F  VL+Y +TG+LH P  +CGP   +EL +WGIDE  +  CC   Y ++ + + + + L FR   D  E++  +         +++ +  +W  LD P       S         + S+   C+ T ++F+    +S+    +   N    N  +K Y                      +  P + L++ D +    FT+EFL +++  P K KF+ +L +  D+I++   +  +++      +K F                 +L +   +RI+RIFR  K+   LQ+L  TVK S   L++L  +LM  + +FS+L+  +E      + K  F ++P+  WW +IT+TT+GYGD  P S  G  IG IA+I G I+   +  +IG+ F+ YY   Q QLK
Sbjct:    1 DHRDRVVINCGGKRFEPYLSTLKNITDLPLSKI--------------TENKIK------LDYDEESGE-------YFFDRHPAVFAQVLNYLQTGKLHCPRNVCGPLFEQELAYWGIDEQQMESCCWSNYTKHRDAQESLKALDFRPRYDEDEERRKVHYDDPNLSWWQRHQPIVWEILDEP-----YSSSTAKDYTPFLVSIFTICIWTVEMFK---GDSKTVTRNVTRNATHGNTTTKSYYM------------------PVSDVPRYVLMIIDSVCTGWFTLEFLLRLVFCPSKLKFILTLQNWIDLIVIIPLYLMLAM------EKSF-----------------VLDVLNTMRIVRIFRFFKLLYDLQILTKTVKASRQHLMILLIILMIPVIVFSSLVLYSEKRWGSDKSKAQFYNVPNSVWWGLITMTTIGYGDMVPTSFMGKVIGGIASICGVIILSTSASVIGSTFSLYYNLAQAQLK 411          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Nematostella
Match: EDO42724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S6])

HSP 1 Score: 174.096 bits (440), Expect = 7.551e-48
Identity = 150/498 (30.12%), Postives = 236/498 (47.39%), Query Frame = 3
Query:  132 DTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTL-------FRDCFEDQDSILNLLKCCRGFKKL---------RYQ--LWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT-FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQ 1568
            D V  ++GG    T ++ L  +P++RL  +A                  SA   D   S  E       Y+FDR P +F  VL+YYRTG+LH P  +CGP    EL FWGID+  +  CC   ++ Y + R  + TL       F + +ED D   +L +    F            RYQ  +W  ++ P SS  AK  A   L L++ SV  FCL + + F                        S++YL++                          LV+ + +  + FT+E + + +  P K +F   +++  D + +  +  Y+S+ + + N                   ++ L + +++RI RIF++S+ S GLQ+L  T++ S  EL+LL F L+ G+ LF++LI+  E +   T F DIP  FWW+++T+TTVGYGD  P+S  G FIGS+ A+ G +   L +P+I NNF+ YY + Q +LK  K  R+
Sbjct:    1 DRVSINVGGVRHETYKSTLKNIPDTRLSWIA----------------EASAGAADFDPSTGE-------YFFDRHPGVFANVLNYYRTGKLHCPLDVCGPLFEDELGFWGIDDQQVESCC---WLTYRQHRDAQETLAAFEGVEFENEYED-DEEPDLGRYGFNFAAESEPDKTWWERYQPRIWTLMEEPHSSTLAKVIAYTTLTLILVSVGIFCLESMEKF------------------------SEKYLKDL-------------------------LVILEGICVVWFTLELMVRFVFCPAKCEFFKKIMNWIDFLAIVPF--YVSLGFNNNNND-----------------IDALMIIRLIRIFRIFKLSRHSSGLQILGHTLRASFRELLLLIFFLLIGVVLFASLIFYCEKKIPGTKFVDIPSSFWWAVVTMTTVGYGDMAPQSPSGKFIGSLCAVCGVLTIALPVPVIVNNFSLYYSHAQARLKLPKKRRR 403          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Medaka
Match: kcnb1 (potassium voltage-gated channel subfamily B member 1 [Source:NCBI gene;Acc:101167947])

HSP 1 Score: 200.675 bits (509), Expect = 1.196e-56
Identity = 148/494 (29.96%), Postives = 226/494 (45.75%), Query Frame = 3
Query:   90 KSKSGESFEMINARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPI----YYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISR---GLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT-FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLK 1547
            + K G   E+I      + ++GG +       L RLP +RL                     G  ++ +   S ME  +   +    Y+FDR P  F  +L++YRTG+LH+   +C     +EL FWGIDE Y+  CC   Y + +E+   +     +   +++       CC    + R +LW  L+ P SS               A V  FC S   L       S    +           ++ E+          +   NP+L        AW            FT+E+L + L +P K KF    ++  D++ +  Y  Y+++F            L++ + SV L F N+  + Q+ RIMRI RI K++R   GLQ L  T+++S  EL LL   L  G+ +FS+L++ AE  ++DT F  IP  FWW+ IT+TTVGYGD YPK+  G  +G +  I+G +V  L IPII NNF+ +YK  + Q K
Sbjct:    7 RDKRGREKELI-----AVLNVGGLLHEVLWRTLERLPRTRL---------------------GKLRDCNTHDSIMEICDDYSLDGNEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDFWGIDEIYLESCCQARYHQKKEQMNEELKREAENMREREGEEFTTTCC---SEKRKKLWDLLEKPSSS-------------FAAKVKSFCFSKETL-------SSRYCVDVGGEPGFKLQDTDEF---------GQASDNPQLAHVEAVCIAW------------FTMEYLLRFLSSPSKWKFFKGPLNVIDLLAILPY--YVTIF------------LTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEEDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEK 415          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Medaka
Match: kcnb1 (potassium voltage-gated channel subfamily B member 1 [Source:NCBI gene;Acc:101167947])

HSP 1 Score: 202.216 bits (513), Expect = 1.910e-56
Identity = 154/518 (29.73%), Postives = 247/518 (47.68%), Query Frame = 3
Query:  138 VIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPI----YYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISR---GLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT-FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQ---LKEDKYLRQLRKDLNEVTSSSTKSYGNSPCPGMFRDHTT 1658
            V  ++GG +       L RLP +RL                     G  ++ +   S ME  +   +    Y+FDR P  F  +L++YRTG+LH+   +C     +EL FWGIDE Y+  CC   Y + +E+   +     +   +++       CC    + R +LW  L+ P SS AAK  A       I S++   LST               ++ + N +    ++ E+          +   NP+L        AW            FT+E+L + L +P K KF    ++  D++ +  Y  Y+++F            L++ + SV L F N+  + Q+ RIMRI RI K++R   GLQ L  T+++S  EL LL   L  G+ +FS+L++ AE  ++DT F  IP  FWW+ IT+TTVGYGD YPK+  G  +G +  I+G +V  L IPII NNF+ +YK  + Q   +K  + L + +++ + V+ +   ++G S    ++ D T 
Sbjct:   30 VRLNVGGLLHEVLWRTLERLPRTRL---------------------GKLRDCNTHDSIMEICDDYSLDGNEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDFWGIDEIYLESCCQARYHQKKEQMNEELKREAENMREREGEEFTTTCC---SEKRKKLWDLLEKPSSSFAAKILA-------IVSILFIILST---------------IALSLNTLPELQDTDEF---------GQASDNPQLAHVEAVCIAW------------FTMEYLLRFLSSPSKWKFFKGPLNVIDLLAILPY--YVTIF------------LTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEEDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMNFKDAFGRSLMLNLWFDKTA 465          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Medaka
Match: kcnb1 (potassium voltage-gated channel subfamily B member 1 [Source:NCBI gene;Acc:101167947])

HSP 1 Score: 206.068 bits (523), Expect = 7.783e-56
Identity = 139/436 (31.88%), Postives = 221/436 (50.69%), Query Frame = 3
Query:  339 YYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISR---GLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT-FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQ---LKEDKYLRQLRKDLNEVTSSSTKSYGNS 1625
            Y+FDR P  F  +L++YRTG+LH+   +C     +EL FWGIDE Y+  CC   Y + +E+   +     +   +++       CC    + R +LW  L+ P SS AAK  A       I S++   LST               ++ + N +    ++ E+          +   NP+L        AW            FT+E+L + L +P K KF    ++  D++ +  Y  Y+++F            L++ + SV L F N+  + Q+ RIMRI RI K++R   GLQ L  T+++S  EL LL   L  G+ +FS+L++ AE  ++DT F  IP  FWW+ IT+TTVGYGD YPK+  G  +G +  I+G +V  L IPII NNF+ +YK  + Q   +K  + L + +++ + V+ +   ++G S
Sbjct:   80 YFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDFWGIDEIYLESCCQARYHQKKEQMNEELKREAENMREREGEEFTTTCC---SEKRKKLWDLLEKPSSSFAAKILA-------IVSILFIILST---------------IALSLNTLPELQDTDEF---------GQASDNPQLAHVEAVCIAW------------FTMEYLLRFLSSPSKWKFFKGPLNVIDLLAILPY--YVTIF------------LTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEEDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMNFKDAFGRS 454          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Medaka
Match: ENSORLT00000007744.2 (potassium voltage-gated channel subfamily C member 4 [Source:NCBI gene;Acc:101165306])

HSP 1 Score: 201.445 bits (511), Expect = 1.441e-55
Identity = 148/515 (28.74%), Postives = 237/515 (46.02%), Query Frame = 3
Query:   93 SKSGESFEMINARDT--VIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFED----------------QDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFR------FSSSN-SEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISR---GLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDT----------FPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYY 1523
            SKS    EM    D+  ++ ++GG    T ++ L  LP +RL  LA  +A   +  TD+  +  SA                  +++DR P IF +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  + FE                 +D       CC  ++    +LW   D P SS AA+  A + L  ++ S+  FCL THD F       F  +N S  +      ++I++  E          C  W                              FT+EFL +++  P+K  F+ + ++  D + +  +  Y+ +    L+ K                  N+L   +V+R +RI RI K++R   GL+VL  T++ S+ E +LL   L  G+ +F+ +IY AE                F +IP  FWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY
Sbjct:   21 SKSCLKEEMARGEDSDKIVINVGGTRHETYKSTLRTLPGTRLAWLAEPDA---QVSTDSVAEPPSAAE----------------FFYDRHPGIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCC---WMSYRQHRDAEAAL--EIFEPPDPDDTDDEAPRRFGIEDCSDRSRSCCEVWQP---KLWALFDDPYSSRAARGVAFVSLFFILLSITTFCLETHDAFNEWMDKVFQGNNTSGKSKAELGGSKILHGVEG--------VCVFW------------------------------FTLEFLVRIICCPNKCFFIKNTLNIIDFVAILPF--YLEMCLEGLSSKAAK---------------NVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASVNEFLLLVIFLALGVLIFATMIYYAERIGASPNDPTGFNHTHFKNIPISFWWAVVTMTTLGYGDMYPQTWLGMMVGALCALAGVLTIAMPVPVIVNNFGMYY 453          
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Medaka
Match: kcnc2 (potassium voltage-gated channel subfamily C member 2 [Source:NCBI gene;Acc:101159160])

HSP 1 Score: 201.83 bits (512), Expect = 1.555e-55
Identity = 146/489 (29.86%), Postives = 239/489 (48.88%), Query Frame = 3
Query:  132 DTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSI---------------LNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAE----------YQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYY 1523
            + +I ++GG    T ++ L  LP +RL +LA      ++ + D+ +       L      +E   +   Y+FDR P +F +VL+YYRTG+LH P+ +CGP   +EL FWGIDE+ + PCC   +M Y + R  +  L  D FE                    +++      ++K +  +W   + P SS AA+  A   L  ++ S+  FCL TH+ F                N IIN    K  +RN + C     D  P+ + +  T PA  L   + +    FTIEFL +V   P K +F+ ++++  D + +  ++                V LS  S       +  L + + +RI+RIF++++   GL+VL  T++ S  E +LL   L  G+ +F+ +IY AE            Q   F +IP GFWW+++T+TT+GYGD YP++  G  +G++ A++G +   + +P+I NNF  YY
Sbjct:    8 ERIILNVGGTRHETYKSTLKTLPGTRLALLA------SDSDIDSVLDQ-----LQQVPGFIEYNARTKQYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCC---WMTYRQHRDAEEAL--DVFELNVDNGDEDDDVGGGLGIEDVHVDGNAGLWRKWQPVIWNLFEDPYSSRAARFVAFASLFFILVSITTFCLETHEAF----------------NTIIN----KTNMRNNS-CQ----DLVPQYEIE--TDPA--LTYVEGVCVFWFTIEFLVRVTFCPVKLEFVKNVLNIIDFVAILPFY--------------LEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAKANDPTASQHTKFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYY 437          
BLAST of Potassium voltage gated channel subfamily C vs. Planmine SMEST
Match: SMESG000010003.1 (SMESG000010003.1)

HSP 1 Score: 1332.39 bits (3447), Expect = 0.000e+0
Identity = 680/682 (99.71%), Postives = 682/682 (100.00%), Query Frame = 3
Query:  117 MINARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSYGNSPCPGMFRDHTTTQSKMRRNRKLNESIEKPESSTPNGFLNKKRLIESSPEPNLLRXXXXXXXXXXXXXXXXXXXXRNDQSVETEMTELLTPKKKPSERSDGKLSVSETFHDTDITPYHLCLPNHSKNQQRITSSSTDSINENISLLTENDRDIISPVVRKSSPTNPNIIPFSKRLTGDYV 2162
            MINARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGSSLAAKSWALLLLVLMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRM+KNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSYGNSPCPGMFRDHTTTQSKMRRNRKLNESIEKPESSTPNGFLNKKR+IESSPEPNLLRSLSKLKIPHSKSSKPSPTSSRNDQSVETEMTELLTPKKKPSERSDGKLSVSETFHDTDITPYHLCLPNHSKNQQRITSSSTDSINENISLLTENDRDIISPVVRKSSPTNPNIIPFSKRLTGDYV
Sbjct:    1 MINARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGSSLAAKSWALLLLVLMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMEKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSYGNSPCPGMFRDHTTTQSKMRRNRKLNESIEKPESSTPNGFLNKKRVIESSPEPNLLRSLSKLKIPHSKSSKPSPTSSRNDQSVETEMTELLTPKKKPSERSDGKLSVSETFHDTDITPYHLCLPNHSKNQQRITSSSTDSINENISLLTENDRDIISPVVRKSSPTNPNIIPFSKRLTGDYV 682          
BLAST of Potassium voltage gated channel subfamily C vs. Planmine SMEST
Match: SMESG000022798.1 (SMESG000022798.1)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 306/530 (57.74%), Postives = 383/530 (72.26%), Query Frame = 3
Query:  117 MINARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFY--YHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSYGNSPCPGMFRDHTTTQSKMRRNRKLNES 1700
            MINA DTV   IGG+IFVTRR+ LYR+P+SRLYM+A+++     + +           +  +SS+M   +  PIYYFDRDPEIFRFVLD+YRTGELHLP+ ICGPFVRKELIFWGIDES+I PCCM AYMRY+EE+RTK+TLF+DCFED DS+ NL+K CRG K+LRY+LWLF DHP SSL AK WA+LLL+LMI SV C CLSTH+ FR    N     ++F  N  I              C+  +++ NPK  KDCT++P + L   D+ LN+LFT+EFLFK++LAPDK KF++S +S  D+ IL SYW Y  +FY  Y+  +   +  ++++     LWF+N +SMTQ LRI+RIF++SKISRGL+VLILT+KKSIPELVLLAFLLMNGMF FS  IY+AEY   DTF  IP  FWW+I+TLTTVGYGD YPK G GYF+GSI AI GCI+TGLAIPIIGNNFNTYY YM+NQ+KEDKY+++L+KDL  +TS+   S  N       RD  + Q  +   RKL  +
Sbjct:    1 MINATDTVTLCIGGRIFVTRRSTLYRVPDSRLYMIAIKHEKQFSQSSKICSSSHDHGGVVCSSSSMP--SDAPIYYFDRDPEIFRFVLDFYRTGELHLPNSICGPFVRKELIFWGIDESFIGPCCMSAYMRYDEEKRTKKTLFKDCFEDIDSMKNLVKYCRGLKRLRYRLWLFFDHPSSSLLAKLWAMLLLLLMILSVTCHCLSTHEAFRMPLKN-----LTFYTNSAI--------------CTFEKINSNPKFHKDCTSEPRYDLAFLDVALNVLFTLEFLFKLMLAPDKIKFISSFVSMLDICILFSYWVYAIIFYKLYYYPKNHTSEPINRNI----LWFLNTMSMTQALRILRIFKVSKISRGLRVLILTIKKSIPELVLLAFLLMNGMFFFSCCIYVAEYWVDDTFNSIPQAFWWTIVTLTTVGYGDSYPKQGPGYFVGSITAICGCILTGLAIPIIGNNFNTYYMYMKNQIKEDKYIKELQKDLTSLTSTLRTS--NIKKLAALRDGKSHQCNIVMKRKLTRA 503          
BLAST of Potassium voltage gated channel subfamily C vs. Planmine SMEST
Match: SMESG000038656.1 (SMESG000038656.1)

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 312/533 (58.54%), Postives = 379/533 (71.11%), Query Frame = 3
Query:  117 MINARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQP-IYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSYGNSPCPGMFRDHTTTQSKMRRNRKLNESIEKP 1712
            MINA DTV   IGG++FVTRRA LYRLP+SRL+M+A ++   N+ + D                      K+P +Y+FDRDPEIFRFVLDYYRTGELHLPS ICGPFVRKELIFWGIDES I  CCMPAYMRY+EE+RTK+TLFRD FED DS+ NL+K CRG K+ RYQ+WLFLDHP SSLAAK WA +LL LMI S MCFCLSTH+ FR  +             RII+ N S       + C+   + KNPK+ KDCTT+    LVL D++LN++FTIEF+ K+LLAP K KFL S I   D+ IL +YW Y+S FY++   +      +    +  LW +N+LSMTQ LRI+RIF+ISKISRGL+VL+LT+KKSIPELVLLAFLLMNGMFLFS+LIYMAEY++  TFPDIP  FWWSI+TLTTVGYGD YPK G GY +GS+AAI GCI+TGLAIPIIGNNFNTYY YM+NQLKEDKYL++L KD+N   S+  K+  +      F     T +     R+   ++E P
Sbjct:   21 MINAGDTVTLCIGGRVFVTRRATLYRLPDSRLFMIANKHDSENQNDKDK---------------------KEPLVYFFDRDPEIFRFVLDYYRTGELHLPSSICGPFVRKELIFWGIDESLIGACCMPAYMRYDEEKRTKKTLFRDFFEDIDSMKNLVKYCRGLKRWRYQMWLFLDHPSSSLAAKMWASILLGLMIFSFMCFCLSTHEAFRRKTK------------RIIDFNSS-------SICNEENIKKNPKINKDCTTETLNALVLLDVVLNIIFTIEFIMKLLLAPYKIKFLKSSICILDICILSAYWLYMSSFYFYYYYQE-----NVRQSATALWALNVLSMTQSLRILRIFKISKISRGLRVLMLTIKKSIPELVLLAFLLMNGMFLFSSLIYMAEYKEPQTFPDIPKAFWWSIVTLTTVGYGDSYPKGGPGYLVGSLAAICGCILTGLAIPIIGNNFNTYYMYMKNQLKEDKYLKELHKDMNHNPSNVNKTNAHKGKFAHFGKQNKTPAANTVFRRKFTTVECP 508          
BLAST of Potassium voltage gated channel subfamily C vs. Planmine SMEST
Match: SMESG000031518.1 (SMESG000031518.1)

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 309/509 (60.71%), Postives = 375/509 (73.67%), Query Frame = 3
Query:  117 MINARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNSIKHGSAQNLDLTSSAMEQLNKQ-PIYYFDRDPEIFRFVLDYYRTGELHLPSGICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYY------HLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSYGN 1622
            MINA DTV F IGG++FVTRRA LYRLP+SRLYM+A      N  E +               +    +NK+ P+Y+FDRDPEIFRFVLDYYRTGELHLPS ICGPFVRKELIFWGIDES I  CCMPAYMRY+EE+RTK+TLFRD FED DSI NL+K CRG K+ RY++WLF+DHP SSL AK WA +LL LMI S MCFCLSTH+ FR  +      N+S+N++ I               C+   ++ N K+++DCTT+P   LVL D++LN++FT+EF  K+LLAP K KFL S IS  D+ I+ SYW Y ++FY+       LNQ      L+QD+    LW +N+LSMTQ LRI+RIF+ISKISRGL+VL+LT+KKSIPELVLLAFLLMNGMFLFS+LIYMAEY++  TFPDIP  FWWSI+TLTTVGYGD YP+ G GY +GS+ AI GCI+TGLAIPIIGNNFNTYY YM+NQLKEDKYL++L KDL+     +TK  G+
Sbjct:    1 MINAGDTVTFCIGGRVFVTRRATLYRLPDSRLYMIA------NRAEIE---------------AVNGMVNKESPVYFFDRDPEIFRFVLDYYRTGELHLPSSICGPFVRKELIFWGIDESLIGACCMPAYMRYDEEKRTKKTLFRDFFEDIDSIKNLVKYCRGIKRWRYRMWLFIDHPSSSLPAKIWAAVLLGLMITSFMCFCLSTHEAFRKKTRR----NLSYNNSSI---------------CNKENIETNRKIRRDCTTEPLTALVLLDVLLNIIFTVEFFLKLLLAPYKTKFLKSSISILDICIMSSYWIYTTLFYFYYYYPSALNQN-----LTQDA--TILWALNVLSMTQSLRILRIFKISKISRGLRVLMLTIKKSIPELVLLAFLLMNGMFLFSSLIYMAEYKESSTFPDIPKAFWWSIVTLTTVGYGDSYPRGGPGYLVGSVTAICGCILTGLAIPIIGNNFNTYYMYMKNQLKEDKYLKELEKDLSHC-GKATKVNGH 461          
BLAST of Potassium voltage gated channel subfamily C vs. Planmine SMEST
Match: SMESG000039622.1 (SMESG000039622.1)

HSP 1 Score: 391.349 bits (1004), Expect = 3.601e-128
Identity = 217/400 (54.25%), Postives = 270/400 (67.50%), Query Frame = 3
Query:  549 DCFEDQDSILNLLKCCRGFKKLRYQLWLFLDHPGXXXXXXXXXXXXXXXMIASVMCFCLSTHDLFRFSSSNSEPTN--MSFNHNRIINNNESKEYLRNYTFCSSWRMDKNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLISQFDMIILCSYWAYISVFYY------HLNQKRFAVALSQDSGSVRLWFMNILSMTQVLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIYMAEYQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISGCIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSYGNSPCPGMFRDHTTTQSKMRRNRKLNESIEKPESST 1724
            DCFED DSI NL+KC RG K+ RY +WLFLDHP SS  AK W+ +LL LMI S MCFCL TH+ FR       PT   +S+N ++I               C       N K KKDCTT+P   LV+ D++LN++FT+EF+ K+ LAPDK KFL + +S  D+ IL +YW Y+S+FY+       L+   F      D G+  LWF+NI+SMTQ LRI+RIF+ISKISRGL+VL+LTVKKSIPELVLL FLLMNGMFLFS+LIY+AEY+  +TFPDIP  FWWSI+TLTTVGYGD YPK  +GY IGS+ AI GCIVTGLAIPIIGNNFNTYY YM+NQ+KEDKYL++  +D   V   +  +  N       R       K+  N KLN+++   +S T
Sbjct:   77 DCFEDIDSIKNLVKCSRGLKRWRYTVWLFLDHPTSSFVAKIWSSILLSLMIMSFMCFCLGTHEDFR------RPTTKLLSYNISKI---------------CDPEVTSVNKKFKKDCTTEPLTALVILDVVLNVIFTVEFILKLFLAPDKMKFLKTSVSLLDIFILSAYWVYMSIFYFYYYYDDKLHDGEF-----HDGGT--LWFLNIMSMTQSLRILRIFKISKISRGLRVLMLTVKKSIPELVLLGFLLMNGMFLFSSLIYLAEYRVPETFPDIPKAFWWSIVTLTTVGYGDSYPKGAFGYLIGSMTAICGCIVTGLAIPIIGNNFNTYYMYMKNQIKEDKYLKEHDRDHVAVKIKNHIALQNKA-----RRFANKNLKISNNLKLNQNLSNSKSLT 443          

HSP 2 Score: 63.5438 bits (153), Expect = 3.609e-10
Identity = 27/37 (72.97%), Postives = 33/37 (89.19%), Query Frame = 3
Query:  114 EMINARDTVIFSIGGQIFVTRRANLYRLPESRLYMLA 224
            +MINA+DTV   IGG++FVTRRA LYRLP+SRLYM+A
Sbjct:    6 QMINAKDTVTLCIGGRVFVTRRATLYRLPDSRLYMIA 42          
The following BLAST results are available for this feature:
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC28.819e-5726.98potassium voltage-gated channel subfamily C member... [more]
KCNC29.156e-5726.98potassium voltage-gated channel subfamily C member... [more]
KCNC29.951e-5727.16potassium voltage-gated channel subfamily C member... [more]
KCNC21.398e-5626.98potassium voltage-gated channel subfamily C member... [more]
KCNC21.398e-5626.98potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shw-12.549e-5528.57SHaW family of potassium channels [Source:UniProt... [more]
shw-11.140e-5428.43SHaW family of potassium channels [Source:UniProt... [more]
shw-12.362e-5428.46SHaW family of potassium channels [Source:UniProt... [more]
shw-12.362e-5428.46SHaW family of potassium channels [Source:UniProt... [more]
shw-12.410e-5428.46SHaW family of potassium channels [Source:UniProt... [more]
back to top
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Shaw2.718e-5829.66gene:FBgn0003386 transcript:FBtr0332184[more]
Shaw3.561e-5829.66gene:FBgn0003386 transcript:FBtr0089274[more]
Shaw6.397e-5829.66gene:FBgn0003386 transcript:FBtr0332185[more]
Shaw7.956e-5829.66gene:FBgn0003386 transcript:FBtr0089275[more]
Shaw1.059e-5729.66gene:FBgn0003386 transcript:FBtr0289989[more]
back to top
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc22.170e-6030.22potassium voltage-gated channel, Shaw-related subf... [more]
kcnc24.649e-6030.22potassium voltage-gated channel, Shaw-related subf... [more]
kcnc48.498e-6029.98potassium voltage-gated channel, Shaw-related subf... [more]
kcnc48.498e-6029.98potassium voltage-gated channel, Shaw-related subf... [more]
kcnc41.241e-5929.59potassium voltage-gated channel, Shaw-related subf... [more]
back to top
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC21.990e-6129.47potassium channel, voltage gated Shaw related subf... [more]
KCNC22.542e-6129.27potassium channel, voltage gated Shaw related subf... [more]
KCNC43.916e-5527.85potassium channel, voltage gated Shaw related subf... [more]
KCNB21.083e-5433.41potassium channel, voltage gated Shab related subf... [more]
tamm412.512e-5328.95TAM41 mitochondrial translocator assembly and main... [more]
back to top
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnc29.129e-5827.22potassium voltage gated channel, Shaw-related subf... [more]
Kcnc21.135e-5727.05potassium voltage gated channel, Shaw-related subf... [more]
Kcnc43.665e-5528.02potassium voltage gated channel, Shaw-related subf... [more]
Kcnc44.706e-5528.02potassium voltage gated channel, Shaw-related subf... [more]
Kcnb11.575e-5434.83potassium voltage gated channel, Shab-related subf... [more]
back to top
BLAST of Potassium voltage gated channel subfamily C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17972|KCNAW_DROME3.570e-5729.66Potassium voltage-gated channel protein Shaw OS=Dr... [more]
sp|Q14B80|KCNC2_MOUSE7.942e-5727.05Potassium voltage-gated channel subfamily C member... [more]
sp|P22462|KCNC2_RAT2.034e-5626.75Potassium voltage-gated channel subfamily C member... [more]
sp|Q96PR1|KCNC2_HUMAN9.103e-5626.81Potassium voltage-gated channel subfamily C member... [more]
sp|Q03721|KCNC4_HUMAN1.402e-5429.18Potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage gated channel subfamily C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068YE360.000e+053.59Potassium voltage gated channel subfamily C OS=Ech... [more]
A0A068W7G30.000e+053.26Potassium voltage gated channel subfamily C OS=Ech... [more]
A0A0X3P7G30.000e+061.87Potassium voltage-gated channel subfamily C member... [more]
A0A267H5B00.000e+056.04BTB domain-containing protein (Fragment) OS=Macros... [more]
A0A267GJ590.000e+056.04BTB domain-containing protein (Fragment) OS=Macros... [more]
back to top
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc23.831e-5929.92potassium voltage-gated channel, Shaw-related subf... [more]
kcnc22.416e-5829.40potassium voltage-gated channel, Shaw-related subf... [more]
kcnb13.031e-5633.57potassium voltage-gated channel subfamily B member... [more]
ENSAMXT00000002571.21.120e-5528.85potassium voltage-gated channel subfamily C member... [more]
ENSAMXT00000054821.11.499e-5528.85potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004235.12.535e-5733.47pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-... [more]
kcnc1a1.883e-5428.34potassium voltage-gated channel, Shaw-related subf... [more]
ENSPMAT00000011463.11.274e-4127.86pep scaffold:Pmarinus_7.0:GL479450:27175:28578:-1 ... [more]
ENSPMAT00000005395.15.110e-4039.25pep scaffold:Pmarinus_7.0:GL482646:8602:10978:-1 g... [more]
ENSPMAT00000001869.11.338e-3937.39pep scaffold:Pmarinus_7.0:GL480351:152:3521:-1 gen... [more]
back to top
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398046.562e-5929.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382372.139e-5429.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478711.828e-5232.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480675.150e-4827.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427247.551e-4830.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium voltage gated channel subfamily C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnb11.196e-5629.96potassium voltage-gated channel subfamily B member... [more]
kcnb11.910e-5629.73potassium voltage-gated channel subfamily B member... [more]
kcnb17.783e-5631.88potassium voltage-gated channel subfamily B member... [more]
ENSORLT00000007744.21.441e-5528.74potassium voltage-gated channel subfamily C member... [more]
kcnc21.555e-5529.86potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage gated channel subfamily C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010003.10.000e+099.71SMESG000010003.1[more]
SMESG000022798.10.000e+057.74SMESG000022798.1[more]
SMESG000038656.10.000e+058.54SMESG000038656.1[more]
SMESG000031518.10.000e+060.71SMESG000031518.1[more]
SMESG000039622.13.601e-12854.25SMESG000039622.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003240 ID=SMED30003240|Name=Potassium voltage gated channel subfamily C|organism=Schmidtea mediterranea sexual|type=transcript|length=2297bp
CTACTATTTTCAATTTAGTTTCATTGGATATTTTGCTGTCCATGATAAAA
GTCCACAATAAAACTAGGAAAATGAATTATTGTTGGTAAAAATCAAAGAG
TGGCGAGTCATTTGAAATGATCAACGCGAGAGATACGGTGATTTTTTCTA
TTGGCGGACAAATATTCGTCACGAGGCGAGCAAATTTGTATCGGTTGCCG
GAAAGTCGTTTGTATATGTTGGCGGTCCAGAACGCTTGCTACAATGAGGA
AGAGACTGACAATTCTATCAAGCACGGTTCGGCTCAGAATTTGGATTTAA
CTTCTTCGGCTATGGAACAGTTGAACAAACAGCCGATTTATTACTTCGAC
CGAGACCCGGAAATTTTTCGATTCGTTTTAGACTATTATCGAACCGGTGA
ATTGCACTTGCCATCAGGAATCTGTGGACCGTTTGTGAGGAAGGAATTAA
TTTTCTGGGGAATCGACGAGTCGTATATTTTGCCTTGTTGCATGCCGGCG
TACATGAGATACGAAGAGGAGCGTCGAACGAAGCGTACGTTGTTTCGAGA
TTGTTTTGAAGATCAAGACTCGATTTTGAATCTTTTAAAATGTTGTCGAG
GATTCAAAAAGCTCAGATATCAATTATGGCTATTTTTAGACCATCCCGGA
TCTTCTCTTGCAGCAAAAAGTTGGGCCTTGCTTCTTTTAGTTCTCATGAT
TGCGTCAGTTATGTGTTTTTGTCTGTCCACTCATGATCTGTTTCGGTTCT
CATCTTCCAATTCCGAACCCACAAATATGTCCTTTAATCACAACCGAATC
ATCAACAATAACGAAAGTAAAGAATATTTACGAAACTACACATTTTGCTC
ATCTTGGAGAATGGATAAGAACCCGAAACTGAAAAAAGACTGCACAACCC
AACCGGCTTGGGGGCTCGTTTTGACGGACATTATGTTGAATTTGCTGTTT
ACCATAGAGTTTTTATTTAAAGTCTTATTAGCTCCCGATAAAAGAAAGTT
TCTAACTTCTTTAATTTCTCAATTCGACATGATTATTTTGTGTTCCTATT
GGGCGTATATTTCGGTATTTTATTATCATTTAAATCAAAAACGGTTCGCA
GTAGCTTTGAGTCAGGACTCCGGCAGCGTGCGTTTGTGGTTCATGAACAT
TTTATCAATGACTCAGGTTCTTCGGATAATGAGGATATTTCGAATATCCA
AGATATCTCGAGGGCTGCAAGTGTTGATTTTGACAGTGAAAAAGTCCATT
CCTGAATTAGTTTTGTTAGCCTTTCTTTTAATGAACGGGATGTTTTTGTT
TTCCGCTCTGATCTACATGGCCGAGTATCAACAGAAAGACACATTTCCAG
ATATTCCTCATGGGTTTTGGTGGTCCATTATCACATTAACAACTGTTGGT
TATGGGGATTTCTATCCGAAAAGCGGTTATGGATACTTCATTGGTTCAAT
TGCCGCCATTAGTGGATGCATCGTTACGGGTCTGGCTATTCCAATTATAG
GAAATAATTTCAACACTTACTACAAATACATGCAAAACCAATTGAAAGAA
GACAAATATCTACGACAGCTGAGGAAAGATTTAAACGAAGTGACATCCTC
CAGTACCAAATCCTATGGGAATAGCCCTTGTCCTGGAATGTTTCGTGACC
ACACGACTACCCAATCAAAAATGAGACGAAATCGGAAATTAAACGAGTCC
ATTGAAAAGCCTGAATCGTCAACTCCAAATGGGTTCCTTAATAAAAAACG
ATTAATTGAATCGTCACCGGAACCAAATTTGTTGAGGTCTTTATCAAAAC
TAAAAATTCCTCATTCAAAATCATCAAAGCCGAGTCCGACCTCATCAAGA
AACGATCAGTCTGTCGAAACTGAAATGACGGAGCTGCTAACACCAAAGAA
AAAACCATCAGAAAGATCCGATGGAAAACTCAGTGTTTCTGAGACCTTTC
ATGACACCGACATTACTCCCTATCATTTATGTCTTCCTAATCACTCAAAG
AATCAACAGAGAATTACTAGCTCATCCACAGATTCCATTAATGAAAATAT
TTCCCTCCTCACAGAAAATGATCGAGATATCATTTCTCCCGTCGTCAGGA
AATCCAGCCCAACCAATCCAAATATTATCCCATTCTCTAAACGGTTGACA
GGAGATTATGTATAATTATTTTTATAAATAATTCTGCCTTTCAAATAATA
TTTACCATTGCCACATGGTAACCAAGCTTGAATTATTTTTGTTTCTATAA
ACTTGATTCATTTCCTCGTCTTTAAAAGATTCTCACTTTTTATATAT
back to top

protein sequence of SMED30003240-orf-1

>SMED30003240-orf-1 ID=SMED30003240-orf-1|Name=SMED30003240-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=683bp
MINARDTVIFSIGGQIFVTRRANLYRLPESRLYMLAVQNACYNEEETDNS
IKHGSAQNLDLTSSAMEQLNKQPIYYFDRDPEIFRFVLDYYRTGELHLPS
GICGPFVRKELIFWGIDESYILPCCMPAYMRYEEERRTKRTLFRDCFEDQ
DSILNLLKCCRGFKKLRYQLWLFLDHPGSSLAAKSWALLLLVLMIASVMC
FCLSTHDLFRFSSSNSEPTNMSFNHNRIINNNESKEYLRNYTFCSSWRMD
KNPKLKKDCTTQPAWGLVLTDIMLNLLFTIEFLFKVLLAPDKRKFLTSLI
SQFDMIILCSYWAYISVFYYHLNQKRFAVALSQDSGSVRLWFMNILSMTQ
VLRIMRIFRISKISRGLQVLILTVKKSIPELVLLAFLLMNGMFLFSALIY
MAEYQQKDTFPDIPHGFWWSIITLTTVGYGDFYPKSGYGYFIGSIAAISG
CIVTGLAIPIIGNNFNTYYKYMQNQLKEDKYLRQLRKDLNEVTSSSTKSY
GNSPCPGMFRDHTTTQSKMRRNRKLNESIEKPESSTPNGFLNKKRLIESS
PEPNLLRSLSKLKIPHSKSSKPSPTSSRNDQSVETEMTELLTPKKKPSER
SDGKLSVSETFHDTDITPYHLCLPNHSKNQQRITSSSTDSINENISLLTE
NDRDIISPVVRKSSPTNPNIIPFSKRLTGDYV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR028325VG_K_chnl
IPR003974K_chnl_volt-dep_Kv3
IPR003968K_chnl_volt-dep_Kv
IPR000210BTB/POZ_dom
IPR003131T1-type_BTB
IPR005821Ion_trans_dom
IPR027359Volt_channel_dom_sf
IPR011333SKP1/BTB/POZ_sf
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0051260protein homooligomerization
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0034765regulation of ion transmembrane transport
GO:0071805potassium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003974Potassium channel, voltage dependent, Kv3PRINTSPR01498SHAWCHANNELcoord: 174..186
score: 40.17
coord: 108..129
score: 48.99
coord: 75..88
score: 49.21
coord: 90..105
score: 68.75
IPR003968Potassium channel, voltage dependent, KvPRINTSPR01491KVCHANNELcoord: 450..461
score: 38.54
coord: 380..394
score: 41.67
coord: 356..364
score: 44.44
coord: 74..84
score: 53.56
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 74..93
score: 48.56
coord: 380..403
score: 46.01
coord: 269..292
score: 26.59
coord: 295..315
score: 17.18
coord: 351..377
score: 42.99
coord: 439..465
score: 40.24
coord: 177..205
score: 32.46
coord: 410..432
score: 60.11
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 365..472
e-value: 1.6E-27
score: 97.3
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 2..142
e-value: 3.2E-27
score: 96.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 563..588
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 589..607
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 493..513
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 514..530
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 493..607
NoneNo IPR availablePANTHERPTHR11537:SF252SHAW-LIKE, ISOFORM Ccoord: 7..481
NoneNo IPR availableCDDcd18379BTB_POZ_Kv3_KCNCcoord: 8..142
e-value: 6.07476E-28
score: 106.325
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 178..466
NoneNo IPR availableTMHMMTMhelixcoord: 186..208
NoneNo IPR availableTMHMMTMhelixcoord: 338..360
NoneNo IPR availableTMHMMTMhelixcoord: 416..433
NoneNo IPR availableTMHMMTMhelixcoord: 440..462
NoneNo IPR availableTMHMMTMhelixcoord: 296..318
NoneNo IPR availableTMHMMTMhelixcoord: 267..289
NoneNo IPR availableTMHMMTMhelixcoord: 381..401
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 6..131
e-value: 9.4E-4
score: 28.5
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 184..470
e-value: 7.5E-26
score: 90.8
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 10..124
e-value: 6.7E-16
score: 58.4
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 161..364
e-value: 1.6E-29
score: 104.4
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 7..481
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 8..135