Chromodomain helicase DNA binding protein 5

Overview
NameChromodomain helicase DNA binding protein 5
Smed IDSMED30003234
Length (bp)4640
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chromodomain helicase DNA binding protein 5 (SMED30003234) t-SNE clustered cells

Violin plots show distribution of expression levels for Chromodomain helicase DNA binding protein 5 (SMED30003234) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chromodomain helicase DNA binding protein 5 (SMED30003234) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chromodomain helicase DNA binding protein 5 (SMED30003234) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003234

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30003234h1SMcG0016158 SmedASXL_016657SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30003234h1SMcG0016158 SmedASXL_016657SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30003234h1SMcG0016158 dd_Smed_v4_9090_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30003234h1SMcG0016158 CUFF.60081.1be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Human
Match: CHD4 (chromodomain helicase DNA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:1919])

HSP 1 Score: 679.093 bits (1751), Expect = 0.000e+0
Identity = 448/1180 (37.97%), Postives = 651/1180 (55.17%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA--------------IGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD---SHRRKLSELE-VKLHEKYFQWGIDPEWLQPHKVL--GMDDVG---CFVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLIK---------------EITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYL--LSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF--------DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+ +    + K D  +  + L  V    E  D   D   + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ WKW                       P +    R+F + +  MSYW C WVSE+QLE+    ++R Y+RK+ D + PP  +   D   S +RK  + +  ++ E+++++GI PEW+  H++L   +D  G     +KWR L Y+  S E     +   +  +++   HR+L++                  ++           K E  P+YL         TLHPYQ+EG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R +IR+ +  +++            KK+    FHVLLT+YELI +D   L  I+W  LIVDEAHRLKNN++K F+ L  Y++ +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF + P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +++  A +  +G YD  ALI ASGK  +L+KMLK L+E GH+VLIFS MTK+LDLLE  LEH   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF         +N E  D  +I YDD AI++LLDRN+  +++ E   ++   S FK+A+Y    ++   E+  E +    E SV     DYW  LL    +   ++E +    GKG R +K+VNY                   +D   +D D+   + +N    S      DE     D ++++E  R PS+  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  397 SCPHCEKEGIQW----EAKEDNSEGEEILEEVGGDLEEED---DHHMEFCRVCKDGG-----ELLCCDTCPSSYHIHCL-----NPPL----PEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKN-DMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYL----DATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVD---PDYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY-------------------NDGSQEDRDWQDDQSDNQSDYSVASEEGDE-----DFDERSEAPRRPSRKGLRNDKDKPL-----PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRYGMPPQDAFTTQ-WLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1500          

HSP 2 Score: 69.3218 bits (168), Expect = 5.998e-11
Identity = 43/112 (38.39%), Postives = 67/112 (59.82%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1685 FNIADGGFTELHSLWQN--EERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQD-IQNDPRYAILNEPFKG---EMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1790          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Human
Match: CHD4 (chromodomain helicase DNA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:1919])

HSP 1 Score: 679.093 bits (1751), Expect = 0.000e+0
Identity = 448/1180 (37.97%), Postives = 651/1180 (55.17%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA--------------IGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD---SHRRKLSELE-VKLHEKYFQWGIDPEWLQPHKVL--GMDDVG---CFVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLIK---------------EITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYL--LSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF--------DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+ +    + K D  +  + L  V    E  D   D   + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ WKW                       P +    R+F + +  MSYW C WVSE+QLE+    ++R Y+RK+ D + PP  +   D   S +RK  + +  ++ E+++++GI PEW+  H++L   +D  G     +KWR L Y+  S E     +   +  +++   HR+L++                  ++           K E  P+YL         TLHPYQ+EG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R +IR+ +  +++            KK+    FHVLLT+YELI +D   L  I+W  LIVDEAHRLKNN++K F+ L  Y++ +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF + P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +++  A +  +G YD  ALI ASGK  +L+KMLK L+E GH+VLIFS MTK+LDLLE  LEH   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF         +N E  D  +I YDD AI++LLDRN+  +++ E   ++   S FK+A+Y    ++   E+  E +    E SV     DYW  LL    +   ++E +    GKG R +K+VNY                   +D   +D D+   + +N    S      DE     D ++++E  R PS+  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  390 SCPHCEKEGIQW----EAKEDNSEGEEILEEVGGDLEEED---DHHMEFCRVCKDGG-----ELLCCDTCPSSYHIHCL-----NPPL----PEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKN-DMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYL----DATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVD---PDYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY-------------------NDGSQEDRDWQDDQSDNQSDYSVASEEGDE-----DFDERSEAPRRPSRKGLRNDKDKPL-----PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRYGMPPQDAFTTQ-WLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1493          

HSP 2 Score: 69.707 bits (169), Expect = 5.894e-11
Identity = 43/112 (38.39%), Postives = 67/112 (59.82%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1678 FNIADGGFTELHSLWQN--EERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQD-IQNDPRYAILNEPFKG---EMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1783          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Human
Match: CHD4 (chromodomain helicase DNA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:1919])

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 448/1180 (37.97%), Postives = 651/1180 (55.17%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA--------------IGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD---SHRRKLSELE-VKLHEKYFQWGIDPEWLQPHKVL--GMDDVG---CFVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLIK---------------EITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYL--LSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF--------DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+ +    + K D  +  + L  V    E  D   D   + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ WKW                       P +    R+F + +  MSYW C WVSE+QLE+    ++R Y+RK+ D + PP  +   D   S +RK  + +  ++ E+++++GI PEW+  H++L   +D  G     +KWR L Y+  S E     +   +  +++   HR+L++                  ++           K E  P+YL         TLHPYQ+EG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R +IR+ +  +++            KK+    FHVLLT+YELI +D   L  I+W  LIVDEAHRLKNN++K F+ L  Y++ +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF + P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +++  A +  +G YD  ALI ASGK  +L+KMLK L+E GH+VLIFS MTK+LDLLE  LEH   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF         +N E  D  +I YDD AI++LLDRN+  +++ E   ++   S FK+A+Y    ++   E+  E +    E SV     DYW  LL    +   ++E +    GKG R +K+VNY                   +D   +D D+   + +N    S      DE     D ++++E  R PS+  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  410 SCPHCEKEGIQW----EAKEDNSEGEEILEEVGGDLEEED---DHHMEFCRVCKDGG-----ELLCCDTCPSSYHIHCL-----NPPL----PEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKN-DMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYL----DATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVD---PDYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY-------------------NDGSQEDRDWQDDQSDNQSDYSVASEEGDE-----DFDERSEAPRRPSRKGLRNDKDKPL-----PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRYGMPPQDAFTTQ-WLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1513          

HSP 2 Score: 69.707 bits (169), Expect = 5.906e-11
Identity = 43/112 (38.39%), Postives = 67/112 (59.82%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1700 FNIADGGFTELHSLWQN--EERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQD-IQNDPRYAILNEPFKG---EMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1805          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Human
Match: CHD4 (chromodomain helicase DNA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:1919])

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 448/1180 (37.97%), Postives = 651/1180 (55.17%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGVT--------------NPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD---SHRRKLSELE-VKLHEKYFQWGIDPEWLQPHKVL--GMDDVG---CFVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLIK---------------EITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYL--LSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF--------DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+ +    + K D  +  + L  V    E  D   D   + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ WKW                       P +    R+F + +  MSYW C WVSE+QLE+    ++R Y+RK+ D + PP  +   D   S +RK  + +  ++ E+++++GI PEW+  H++L   +D  G     +KWR L Y+  S E     +   +  +++   HR+L++                  ++           K E  P+YL         TLHPYQ+EG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R +IR+ +  +++            KK+    FHVLLT+YELI +D   L  I+W  LIVDEAHRLKNN++K F+ L  Y++ +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF + P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +++  A +  +G YD  ALI ASGK  +L+KMLK L+E GH+VLIFS MTK+LDLLE  LEH   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF         +N E  D  +I YDD AI++LLDRN+  +++ E   ++   S FK+A+Y    ++   E+  E +    E SV     DYW  LL    +   ++E +    GKG R +K+VNY                   +D   +D D+   + +N    S      DE     D ++++E  R PS+  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  403 SCPHCEKEGIQW----EAKEDNSEGEEILEEVGGDLEEED---DHHMEFCRVCKDG-----GELLCCDTCPSSYHIHCL-----NPPL----PEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKN-DMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYL----DATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVD---PDYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY-------------------NDGSQEDRDWQDDQSDNQSDYSVASEEGDE-----DFDERSEAPRRPSRKGLRNDKDKPL-----PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRYGMPPQDAFTTQ-WLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1506          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Human
Match: CHD4 (chromodomain helicase DNA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:1919])

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 448/1180 (37.97%), Postives = 651/1180 (55.17%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA--------------IGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD---SHRRKLSELE-VKLHEKYFQWGIDPEWLQPHKVL--GMDDVG---CFVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLIK---------------EITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYL--LSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF--------DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+ +    + K D  +  + L  V    E  D   D   + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ WKW                       P +    R+F + +  MSYW C WVSE+QLE+    ++R Y+RK+ D + PP  +   D   S +RK  + +  ++ E+++++GI PEW+  H++L   +D  G     +KWR L Y+  S E     +   +  +++   HR+L++                  ++           K E  P+YL         TLHPYQ+EG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R +IR+ +  +++            KK+    FHVLLT+YELI +D   L  I+W  LIVDEAHRLKNN++K F+ L  Y++ +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF + P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +++  A +  +G YD  ALI ASGK  +L+KMLK L+E GH+VLIFS MTK+LDLLE  LEH   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF         +N E  D  +I YDD AI++LLDRN+  +++ E   ++   S FK+A+Y    ++   E+  E +    E SV     DYW  LL    +   ++E +    GKG R +K+VNY                   +D   +D D+   + +N    S      DE     D ++++E  R PS+  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  403 SCPHCEKEGIQW----EAKEDNSEGEEILEEVGGDLEEED---DHHMEFCRVCKDGG-----ELLCCDTCPSSYHIHCL-----NPPL----PEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKN-DMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYL----DATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVD---PDYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY-------------------NDGSQEDRDWQDDQSDNQSDYSVASEEGDE-----DFDERSEAPRRPSRKGLRNDKDKPL-----PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRYGMPPQDAFTTQ-WLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1506          

HSP 2 Score: 69.707 bits (169), Expect = 5.902e-11
Identity = 43/112 (38.39%), Postives = 67/112 (59.82%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1691 FNIADGGFTELHSLWQN--EERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQD-IQNDPRYAILNEPFKG---EMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1796          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Celegans
Match: chd-3 (Chromodomain-helicase-DNA-binding protein 3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22516])

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 479/1422 (33.68%), Postives = 750/1422 (52.74%), Query Frame = 1
Query:  397 CEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEP--TQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRS----------EAIGVTNPDKYFMP---------REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVL-----GMDDVGCFVKWRGLGYEFVSTEPLTRVTHINGLQEAI-----DRHRKLIKEIT-------------------DKSYVARNKSK-----LTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDM-YYQNKKKNFP-----------TFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLLSSEI--AEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVV---------KSFTKIEFHQIISFGTKDLFDE--------------NNENNDQKIIYDDAAIDKLLDRNR---FTSDNPETSFLDSCFSGFKMAEYQ---FAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETINR--TILEIVTYKIWDIRTISIEDLENLFT------DLGHFEID------------------------------FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKY---IDQIFIDPQYQILFIPLRIANLDLVKDNADIRKCFRNRQ-RLLENALLIEAQIMKVGAACDGYSVDSFSVERLKYYHDLFFNQGNTIHINPSLVNTKPKLTAI-----AQLEMIINDVETNLESFKPISIQHL 4221
            C  CKE+S      +  C  C   YH  C+           +P  T++   +  C RC +     ++  I++W+W+           E    +  D +  P         REF + +  ++YW CEW+SE  +++    L R Y RK +D  +PP  E  S   R        KL E+++Q+G+ PEW+Q H+++             VKW+ L YE  + E     T I   ++AI      R R L  E+                    +    +R K +     L K E  PD++    +     LHPYQLEG+NWLR  +SN  + ILADEMGLGKT+Q+++FLY+L K+  ++GPFLI  PLST+ NWERE E W PDF +V Y GD+++R+VIR+ +  +     +  P            FHVLLT+YE I MD+  LS I+W  L+VDEAHRLKNN++  FK+L++YNI YR+L++GTPLQNNLEELF+LLNF+ P+ F  +  F ++F++ISKE+Q+ KL  +L    LRRLK+DV    P+K+E I+RVEL+ +QKK+YK ILT+N++AL+ K  G +MS  NI+M+L+KCCNHPYL       A + ++G Y+  ALI  +GK  +L+KML+KL++ GH+VLIFS MT +LD+LE   +    +YERIDGS++   RQ+AIDR+N P +   VFLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHRLGQK KVMIYRFVT+ S+EE+I   +K+K+++T+LVV         KS +K E   ++ +GT++LF E              + + N+Q+I++DDAA+D LLDRN+         +  + +   S FK+A Y          + +++  IK  T+E    ++P +YW  LL+   +   ++E+  ++ GKG R +++VNY +++ +  D  + N+     D   D ++Y    GE           +DE +      ++  + +LP                +   +  QI+                 + GF P++R   Y A+M +G+ P+ L +   W    L +K+    + +   FM +L E    +      + GV ++ ++   ++SRI +  ++  KV ++E  N   ++ E     +      S+ +L  +        D+    +D                              FNI DGG++E+HS W++  EK +R   +     W++ HD++LL+++A +GY +Y      I  DP++ I+  P +    D   + AD++  F  R+ +LLE +L+IE Q+ +        S D    +  +++ +L       ++I     N      AI     AQL+ +++D++T++    P +I  +
Sbjct:  331 CRICKETS-----NILLCDTCPSSYHAYCI-----------DPPLTEIPEGEWSCPRCIIPEPAQRIEKILSWRWKEISYPEPLECKEGEEASKDDVFLKPPRKMEPRREREFFVKWKYLAYWQCEWLSETLMDVYFTALVRMYWRK-VDSENPPIFE-ESTLSRHHSDHDPYKLRERFYQYGVKPEWMQIHRIINHLSYAKSQQDYLVKWKELSYEHATWE--RDDTDIANYEDAIIKYWHHRERMLNDEVPRNVQKMIAKQREAKGLGPKEDEVTSRRKKREKIDILKKYEVQPDFI----SETGGNLHPYQLEGINWLRHCWSNGTDAILADEMGLGKTVQSLTFLYTLMKEGHTKGPFLIAAPLSTIINWEREAELWCPDFYVVTYVGDRESRMVIREHEFSFVDGAVRGGPKVSKIKTLENLKFHVLLTSYECINMDKAILSSIDWAALVVDEAHRLKNNQSTFFKNLREYNIQYRVLLTGTPLQNNLEELFHLLNFLAPDRFNQLESFTAEFSEISKEDQIEKLHNLLGPHMLRRLKADVLTGMPSKQELIVRVELSAMQKKYYKNILTRNFDALNVKNGGTQMSLINIIMELKKCCNHPYLFMKACLEAPKLKNGMYEGSALIKNAGKFVLLQKMLRKLKDGGHRVLIFSQMTMMLDILEDFCDVEGYKYERIDGSITGQQRQDAIDRYNAPGAKQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKGSVEERITSVAKKKMLLTHLVVRAGLGAKDGKSMSKTELDDVLRWGTEELFKEEEAPVEGADGEGTSSKKPNEQEIVWDDAAVDFLLDRNKEEEGQDGEKKEHWTNEYLSSFKVATYNTKEADDADDDEDETEVIKEGTEE----QDP-NYWEKLLKHHYE--QDQETELQKLGKGKRVRRQVNYASEN-MGQDWSAQNNQQQEED---DGSEYGSDNGEL--------LQTDEDYEERRRRREERSEKLPP---------------LLAKVNGQIE-----------------VLGFNPRQRKAFYNAVMRWGMPPQDLTQSS-WQVRDLRNKSEKVFKAYSSLFMRHLCE--PVVDNSDSFMDGVPREGLNRQAVLSRIGLMSILRKKVQEFEKFNGEWSMPETREKMLATAAQASVSNLPGMIKIKEEPIDIDETPMDVDQSNITKTEELASEVKVEEEPKAPRLPYKFNICDGGYTELHSLWIN-EEKVARNGKEYEI--WHRRHDFWLLAAVAVYGYGRYQINFQDIMNDPKFSIVNEPFKQTGADPATNFADVKNKFLARRFKLLEQSLVIEEQLRRAAHINKQQSPDQVG-QLAQHFSELEHTADAHVNIARESNNGNRNANAILHKCLAQLDDLLSDLKTDVARL-PATISQV 1669          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Celegans
Match: let-418 (pep chromosome:WBcel235:V:5826833:5832866:1 gene:WBGene00002637.1 transcript:F26F12.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-418)

HSP 1 Score: 644.81 bits (1662), Expect = 0.000e+0
Identity = 442/1201 (36.80%), Postives = 656/1201 (54.62%), Query Frame = 1
Query:  262 CETCGLVF----IKRTDKKIDEKDVNKCLSCVKAVKEL-SDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWR--------------SEAIGVTNPDKYFMPR---EFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGMDDVG-----CFVKWRGLGYEFVSTEPLTRVTHINGLQEAI-----DRHRKLIKEITD--KSYVARNKSK--------------------LTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDM-YYQNKKKNFPT-----------FHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYL-LSSEI-AEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVV---------KSFTKIEFHQIISFGTKDLFDEN-----NENND------QKIIYDDAAIDKLLDRNR-----FTSDNPETS-FLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRIS-GVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            C+TC   +    I    ++  E D + C  C++   E+  +E    +++ C+ CKE+       +  C  C+  +H  C+      T++  E T        C RC  V   +K+  I+ W+W+              S    +  P +   PR   EF + +  +SYW C WVSE+ LE+    L   Y RK+ D ++PP  E  S + R        KL E+++Q+GI PEW+Q H+++             VKW+ L Y+  + E     ++I   +EAI      R  KL ++I    +  +A+++                        K E  PDY+    T     LHPYQLEG+NWLR  +SN  + ILADEMGLGKT+Q+++FLYSL K+   +GPFLI  PLST+ NWERE E W PDF +V Y G +DAR+V+R+ +  + +   ++ P            FHVLLT+YE I MD+  LS I W  L+VDEAHRLKNN++  FK+L +Y I+YR+L++GTPLQNNLEELF+LLNF+    F  +  F ++FN+ISKE+Q+ KL  +L    LRRLK+DV    P+K E I+RVEL+ +QKK+YK ILT+N++AL+ K  G +MS  N++M+L+KCCNHPYL + +E+ A + ++G Y+  ALI  SGK  +L+KML+KL++ GH+VLIFS MT++LD++E L E+   +YERIDGS+    RQ+AIDR+N P +   +FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHRLGQK KVMIYRFVT+ S+EEKI   +K+K+++ +LVV         K+ +K E   ++ +GT++LF E+      E ++      Q+I++DDAA+D LLDR+         D  E + + +   S FK+A YQ    + + E+  E      E+    +P DYW  LL+   +   E E  K   GKG R +K++NY +++ +  D    N      D +      D  +G           NSDE    +D ++K +  R   K                P L  ++  ++              I GF P++R   Y A+M +G+ P+   +   W    L +K+      +   FM +L    E     HD  + GV ++ ++   ++ RI +  L+  KV ++E  N
Sbjct:  271 CDTCPRAYHTVCIDENMEEPPEGDWS-CAHCIEHGPEVVKEEPAKQNDEFCKICKETE-----NLLLCDSCVCSFHAYCI--DPPLTEVPKEET------WSCPRCETVKPEHKIEKILCWRWKEIPYPEPLEAGKEASSDDAMLKPPRKMEPRREREFFVKWKYLSYWQCSWVSEMLLEVHFRMLILLYWRKN-DSDAPPEFE-ESVTSRHHSDNDPYKLRERFYQYGIKPEWMQIHRIINHQSYAKSQQDYLVKWKELSYDQATWE--RDDSNIANYEEAIIKYWQHRESKLNEDIPKNVQKMIAKHREAKGLPPKEDEKKKKKREKIDIRKKYEVQPDYV----TETGGKLHPYQLEGLNWLRHCWSNGTDAILADEMGLGKTVQSLTFLYSLMKEGHCKGPFLIAAPLSTIINWEREAEQWCPDFYVVTYVGLRDARVVLREHEFSFVEGAVRSGPKASKMKTTENMKFHVLLTSYETINMDKTILSSIEWGALVVDEAHRLKNNQSLFFKNLNEYTIHYRVLLTGTPLQNNLEELFHLLNFLSKERFNQLEAFTAEFNEISKEDQIEKLHNLLGPHMLRRLKADVLTGMPSKSELIVRVELSAMQKKWYKNILTRNFDALNVKNGGTQMSLMNVLMELKKCCNHPYLFVKAELEAPKEKNGMYEGTALIKNSGKFVLLQKMLRKLKDGGHRVLIFSQMTRMLDIMEDLCEYEGYRYERIDGSIMGQMRQDAIDRYNAPGAQQFIFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKKSVEEKITSVAKKKMLLNHLVVRAGLGGKEGKTMSKTELDDVLRWGTEELFSEDLDAAEGEGSEKKGAAAQEIVWDDAAVDALLDRSNKEETPAGEDGEEKAEWQNEYLSSFKVASYQTKETEGQEEEEEEETEVIKEDEKEPDP-DYWEKLLKHHYEQDREIELQK--LGKGKRVRKQINYASEN-MGTDWSKQNQTQDDDDDNESYRGSDNGDG----------LNSDE----DDYDEKKKRRRDEEKM---------------PPLMAKVNGQVE-------------ILGFNPRQRKAFYGAVMRWGMPPQDSHQSQ-WLVRDLRNKSEKVFRAYASLFMRHLC---EPGADGHDTFNDGVPREGLNRQHVLGRIGLLSLVRRKVQEFEQYN 1399          

HSP 2 Score: 68.1662 bits (165), Expect = 5.313e-11
Identity = 39/116 (33.62%), Postives = 65/116 (56.03%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKY---IDQIFIDPQYQILFIPLRIANLDLVKDNADIRKCFRNRQ-RLLENALLIEAQIMKVGAA 4014
            FNI DGGF+E+HS W +  EK +R   +     W + HDY+LL+ +  HGY ++    + I  DP++ +L  P +    +     +DI+  F  R+ +L+E +L+IE Q+ +   A
Sbjct: 1498 FNICDGGFTELHSLWAN-EEKVARNGKEYEI--WYRRHDYWLLAGVVVHGYGRFQANFNDIINDPRFSVLNEPFKEVGAEAT--GSDIKAKFMQRRFKLIEQSLVIEEQLRRAAHA 1608          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Celegans
Match: chd-1 (Chromodomain and Helicase Domain protein [Source:UniProtKB/TrEMBL;Acc:O17909])

HSP 1 Score: 420.239 bits (1079), Expect = 8.988e-123
Identity = 279/694 (40.20%), Postives = 400/694 (57.64%), Query Frame = 1
Query:  940 FVKWRGLGYEFVS--TEPLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLEESPDYLGPPSTTAKAT--LHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS-----NIVMQLRKCCNHPYLLSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKS--------------------FTKIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKN-INEEESVKE--EFGKGFRQKKK 2925
             +KW GL Y   +   E +     I      I+     +K     S V R + K  K E  PD+L    T  ++T  L  YQLEG+NW+  ++    ++ILADEMGLGKTIQ+IS L SL+      GP+L+ VPLSTM  W++EF  WAP+  +V Y GD  +R +IR  + +    KK     + +LTTYE++  D+ FLS I+W  L+VDEAHRLKN+E+ L+KSL ++  N+++L++GTPLQN+L+EL+ LL+F+ P  F     F +  N+ S  + +  L + L+   LRR+K DV    P K EQI+RV++T  QK+FYK ILTKNY  LS    GVK S     N+VM+L+KCCNH  L + +     +D    +  L+ +SGK  +L K+L +L++ GH+VLIFS M  +LD+L+  L+      +R+DGS+ +  R+ A+D +N P S    FLLST+AGGLGINL++ADTV I+D+DWNPQND+QA+SRAHR+GQ + V IYR VT+ S+EE+I+E +KRKL++ +LV++                     F K E   I+ FG  +LF E      +  +     ID++L          E    +   S FK A   FA+D     +  +I   TDE          WAA++    +N I EEE +KE  E     RQ+K+
Sbjct:  335 LIKWSGLPYSDCTWEDEKMVAPEQIKAYYHRIEN----LKSPNKNSNVLRKRPKFEKFESMPDFL---KTDGESTHKLRDYQLEGLNWMVYAWCKGNSSILADEMGLGKTIQSISLLASLFHRYDLAGPYLVVVPLSTMAAWQKEFAQWAPEMNLVVYMGDVVSRDMIRQYEWFVGGTKKM--KINAILTTYEILLKDKAFLSSIDWAALLVDEAHRLKNDESLLYKSLTQFRFNHKLLITGTPLQNSLKELWALLHFIMPEKFDCWEEFETAHNE-SNHKGISALHKKLEPFLLRRVKKDVEKSLPPKTEQILRVDMTAHQKQFYKWILTKNYRELS---KGVKGSINGFVNLVMELKKCCNHASL-TRQYDHIYDDAQGRLQQLLKSSGKLILLDKLLCRLKDKGHRVLIFSQMVMMLDILQEYLQLRRFPSQRLDGSMRADLRKQALDHYNAPGSTDFAFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMSRAHRIGQTKTVNIYRLVTKGSVEEEIVERAKRKLVLDHLVIQRMDTTGKTVLSKNATASGSVPFDKQELSAILKFGAVELFKEKEGEEQEPEV----DIDRILMGAETREAEEEVMKENELLSSFKYA--NFAID-----EEKDIAAATDE----------WAAIIPEEDRNRILEEERMKELAEMNLAPRQRKQ 993          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Celegans
Match: chd-7 (Chromodomain and Helicase Domain protein [Source:UniProtKB/TrEMBL;Acc:O61845])

HSP 1 Score: 410.994 bits (1055), Expect = 2.764e-117
Identity = 257/610 (42.13%), Postives = 363/610 (59.51%), Query Frame = 1
Query:  940 FVKWRGLGYEFVSTEPLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYY-------QNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLF-KSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMSNIVMQLRKCCNHPYLLSSEIAEET------------EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKSFT----------KIEFHQIISFGT-KDLFDENNENNDQKIIYDDAAIDKLLDRNRFT 2676
             +KW+ LGYE V+ EP   +  I   +  + R R++I     +        +  K+  S  +          +L  YQ EGV+WL   Y N  N ILADEMGLGKT+Q I+FL  +Y D    GPFL+ VPLST++NW REFE W  D   + Y+G   AR V++  +++Y       +N KKNF     L+TT+E +  D  FL  I W + ++DEAHRLKN   KL    L  + + +R+L++GTPLQNN++ELF+LLNF+ P  F + + FL QF     ++QV KLQE+LK   LRRLK DV      KEE II V+L+ +QKKFY+ IL +N+  L    S   + N++M+LRKCCNHP+L++   AEE             ++ +    ALI ASGK  +++K+L KL++ GHKVLIFS M K+LDLLE  L  M   +ERIDG+V    RQ AIDRF+  NS   VFLL T+AGGLGINL++ADTV I+D+DWNPQND+QA +R HR+GQK+ V +YR +T N+ E ++ + +  KL +   V++S T          K +  +++  G    + DE NE++     +++  I+ +L R   T
Sbjct: 1133 LIKWKSLGYEEVTWEP---IEMIPADKVELWRERQVIDPAKIREKQRPEPEEWKKMSTSKVWKN------GNSLREYQFEGVDWLLYCYYNAQNCILADEMGLGKTVQTITFLSRIY-DYGIHGPFLVVVPLSTIQNWVREFETWT-DMNAIVYHGSAYAREVLQQYEVFYDKRHCGAKNWKKNFVKIDALITTFETVVSDVEFLKKIPWRVCVIDEAHRLKNRNCKLLVNGLLAFRMEHRVLLTGTPLQNNIDELFSLLNFLHPQQFDNSATFLEQFGSCQTDDQVQKLQEILKPMMLRRLKEDVEKSLGPKEETIIEVQLSDMQKKFYRAILERNFSHLCKGTSAPSLMNVMMELRKCCNHPFLING--AEEAIMNDFRLAHPDWDEETLAHKALIQASGKVVLIEKLLPKLRKDGHKVLIFSQMVKVLDLLEEFLISMSYPFERIDGNVRGDLRQAAIDRFSKENSDRFVFLLCTRAGGLGINLTAADTVIIFDSDWNPQNDLQAQARCHRIGQKKLVKVYRLITSNTYEREMFDKASLKLGLDKAVLQSTTALKAEGTALSKKDVEELLKKGAYGSIMDEENESSK----FNEEDIETILQRRTQT 1725          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Celegans
Match: isw-1 (Chromatin-remodeling complex ATPase chain isw-1 [Source:UniProtKB/Swiss-Prot;Acc:P41877])

HSP 1 Score: 338.191 bits (866), Expect = 2.406e-97
Identity = 219/550 (39.82%), Postives = 328/550 (59.64%), Query Frame = 1
Query:  973 VSTEPLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSK-LTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSL--YKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDAR-IVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQF-NDI--SKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEAL--SGKFSGVKMSNIVMQLRKCCNHPYLLSSEIAEETEDGSYDVPA------LIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKSFTKIEFHQIISFG 2577
            V T+   R +  NG+ +   RHRK  +E  ++      KS  L   ++SP Y+          +  YQ+ G+NWL S   N IN ILADEMGLGKT+Q IS +  +  YK+K S  P L+ VP ST++NW  EF+ W P    V   GD+ AR  V+RD  +  +        F V  TTYE++   +  L  +NW  +I+DEAHR+KN ++KL +++++ N   R+L++GTPLQNNL EL+ LLNF+ P+ F     F S F ND      + V +L ++L+   LRR+KSDV      K+E  + V L+ +Q+++Y  +L K+ + +  +GK    ++ NI+M LRKC NHPYL          DG+   P       L+  SGK  +L K+L K +E G +VLIFS  +++LDLLE        +Y R+DGS     R NAI+ +N P+S   +F+L+T+AGGLGINL++AD V IYD+DWNPQ+D+QA+ RAHR+GQK++V ++R +T N+++E+I+E ++ KL + N+V++     E  + +  G
Sbjct:   76 VDTKKRGRPSKKNGI-DGDHRHRKTEQEEDEEMVADAIKSDDLVIFDKSPFYI------ENGEMRDYQVRGLNWLASLQHNKINGILADEMGLGKTLQTISMIGYMKHYKNKAS--PHLVIVPKSTLQNWANEFKKWCPSINAVVLIGDEAARNQVLRDVILPQK--------FDVCCTTYEMMLKVKTQLKKLNWRYIIIDEAHRIKNEKSKLSETVRELNSENRLLITGTPLQNNLHELWALLNFLLPDIFTSSDDFDSWFSNDAMSGNTDLVQRLHKVLQPFLLRRIKSDVEKSLLPKKEVKVYVGLSKMQREWYTKVLMKDIDIINGAGKVEKARLMNILMHLRKCVNHPYLF---------DGAEPGPPFTTDQHLVDNSGKMVVLDKLLMKFKEQGSRVLIFSQFSRMLDLLEDFCWWRHYEYCRLDGSTPHEDRSNAIEAYNAPDSKKFIFMLTTRAGGLGINLATADVVIIYDSDWNPQSDLQAMDRAHRIGQKKQVRVFRLITENTVDERIIEKAEAKLRLDNIVIQQGRMSEAQKTLGKG 599          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Fly
Match: Mi-2 (gene:FBgn0262519 transcript:FBtr0074919)

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 468/1216 (38.49%), Postives = 654/1216 (53.78%), Query Frame = 1
Query:  262 CETCGLVF-IKRTDKKIDEKDVNK--CLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWR--------SEAIGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDS----------HRRKLS-----ELEVKLHEKYFQWGIDPEWLQPHKVL----GMDDVGCF-VKWRGLGYEFVSTEPLTRVTHINGLQEAIDRHRKLIKEITD----------------------------KSYVARNKSKLT----KLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQ------NKKKNFPT----FHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLLSSEIAEETEDGS--YDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETINR--TILEIVTYKIWDIRTISIEDLENL 3648
            C+TC   + +   + ++DE    K  C  C        +E  D+  + C  CK+        +  C  C   YH  CL     +  L   P    R    C RC+   L  K   I+TW+W         S + G  N +     RE+ I + NMSYW CEWV EVQL++  P + R+++RK  D   PP  E   D           H+ K+      + EV L E++++ G+ PEWL   +V+      D    + VKWR L Y+  + E       I GL++AID ++ L    T                             K Y    +   T    K E+ P +L          LHPYQ+EG+NWLR S+   I+TILADEMGLGKTIQ ++FLYSLYK+   RGPFL+ VPLST+ NWEREFE WAPDF  + Y GDKD+R VIR+ ++ ++      +K     T    F+VLLT+YELI MD   L  I+W +L+VDEAHRLK+N++K F+ L  Y I Y++L++GTPLQNNLEELF+LLNF+  + F D+  F  +F D+SKEEQV +L EML    LRRLK+DV  + P+K E I+RVEL+ +QKKFYK ILTKNYEAL+ K  G   S  NI+M L+KCCNHPYL  S   E T      Y++ +L  A+GK  +L KMLK+L+   H+VLIFS MTK+LD+LE  LE    +YERIDG ++ T RQ AIDRFN P +   VFLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ  KVMIYRFVTRNS+EE++ + +KRK+M+T+LVV+        +FTK E   I+ FGT+DLF E+++  ++ I YDD A+ +LLDR     +  E S+ +   S FK+A Y  A  + E E+  EI  +  ENS   +PA YW  LL    +    +E V    GKG R +K+VNY    ++  D   ++S N   +    +++Y     E+       D+N  E      LE+              RD + L      P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+    + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E IN   ++ E++      +R+   +D+  L
Sbjct:  392 CDTCPRAYHLVCLEPELDEPPEGKWSCPHCEADGGAAEEEDDDEHQEFCRVCKDGG-----ELLCCDSCPSAYHTFCL-----NPPLDTIPDGDWR----CPRCSCPPLTGKAEKIITWRWAQRSNDDGPSTSKGSKNSNSRV--REYFIKWHNMSYWHCEWVPEVQLDVHHPLMIRSFQRK-YDMEEPPKFEESLDEADTRYKRIQRHKDKVGMKANDDAEV-LEERFYKNGVKPEWLIVQRVINHRTARDGSTMYLVKWRELPYDKSTWE--EEGDDIQGLRQAIDYYQDLRAVCTSETTQSRSKKSKKGRKSKLKVEDDEDRPVKHYTPPPEKPTTDLKKKYEDQPAFL----EGTGMQLHPYQIEGINWLRYSWGQGIDTILADEMGLGKTIQTVTFLYSLYKEGHCRGPFLVAVPLSTLVNWEREFELWAPDFYCITYIGDKDSRAVIRENELSFEEGAIRGSKVSRLRTTQYKFNVLLTSYELISMDAACLGSIDWAVLVVDEAHRLKSNQSKFFRILNSYTIAYKLLLTGTPLQNNLEELFHLLNFLSRDKFNDLQAFQGEFADVSKEEQVKRLHEMLGPHMLRRLKTDVLKNMPSKSEFIVRVELSAMQKKFYKFILTKNYEALNSKSGGGSCSLINIMMDLKKCCNHPYLFPSAAEEATTAAGGLYEINSLTKAAGKLVLLSKMLKQLKAQNHRVLIFSQMTKMLDILEDFLEGEQYKYERIDGGITGTLRQEAIDRFNAPGAQQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRNSVEERVTQVAKRKMMLTHLVVRPGMGGKGANFTKQELDDILRFGTEDLFKEDDK--EEAIHYDDKAVAELLDRTNRGIEEKE-SWANEYLSSFKVASY--ATKEEEEEEETEIIKQDAENS---DPA-YWVKLLRHHYE--QHQEDVGRSLGKGKRVRKQVNYTDGGVVAADTTRDDS-NWQDNGSEYNSEYSAGSDEDGGDDDFDDQNGAERKAKRRLER--------------RDDRPL------PPLLARVGGNIE-------------VLGFNARQRKSFLNAIMRYGMPPQDAFNSQ-WLVRDLRGKSERNFKAYVSLFMRHLCEPGADNAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHINGYYSMPELILKPCEPVRSALKQDVAAL 1535          

HSP 2 Score: 64.6994 bits (156), Expect = 8.003e-10
Identity = 40/113 (35.40%), Postives = 67/113 (59.29%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH-WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+H+ W++      +A +       W++ HDY+LL+ I +HGY ++ D I  D ++ I+  P +   +D+ K N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1729 FNIADGGFTELHTLWLNE----EKAAVPGREYEIWHRRHDYWLLAGIVTHGYGRWQD-IQNDIRFAIINEPFK---MDVGKGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1833          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Fly
Match: Mi-2 (gene:FBgn0262519 transcript:FBtr0302046)

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 468/1216 (38.49%), Postives = 654/1216 (53.78%), Query Frame = 1
Query:  262 CETCGLVF-IKRTDKKIDEKDVNK--CLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWR--------SEAIGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDS----------HRRKLS-----ELEVKLHEKYFQWGIDPEWLQPHKVL----GMDDVGCF-VKWRGLGYEFVSTEPLTRVTHINGLQEAIDRHRKLIKEITD----------------------------KSYVARNKSKLT----KLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQ------NKKKNFPT----FHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLLSSEIAEETEDGS--YDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETINR--TILEIVTYKIWDIRTISIEDLENL 3648
            C+TC   + +   + ++DE    K  C  C        +E  D+  + C  CK+        +  C  C   YH  CL     +  L   P    R    C RC+   L  K   I+TW+W         S + G  N +     RE+ I + NMSYW CEWV EVQL++  P + R+++RK  D   PP  E   D           H+ K+      + EV L E++++ G+ PEWL   +V+      D    + VKWR L Y+  + E       I GL++AID ++ L    T                             K Y    +   T    K E+ P +L          LHPYQ+EG+NWLR S+   I+TILADEMGLGKTIQ ++FLYSLYK+   RGPFL+ VPLST+ NWEREFE WAPDF  + Y GDKD+R VIR+ ++ ++      +K     T    F+VLLT+YELI MD   L  I+W +L+VDEAHRLK+N++K F+ L  Y I Y++L++GTPLQNNLEELF+LLNF+  + F D+  F  +F D+SKEEQV +L EML    LRRLK+DV  + P+K E I+RVEL+ +QKKFYK ILTKNYEAL+ K  G   S  NI+M L+KCCNHPYL  S   E T      Y++ +L  A+GK  +L KMLK+L+   H+VLIFS MTK+LD+LE  LE    +YERIDG ++ T RQ AIDRFN P +   VFLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ  KVMIYRFVTRNS+EE++ + +KRK+M+T+LVV+        +FTK E   I+ FGT+DLF E+++  ++ I YDD A+ +LLDR     +  E S+ +   S FK+A Y  A  + E E+  EI  +  ENS   +PA YW  LL    +    +E V    GKG R +K+VNY    ++  D   ++S N   +    +++Y     E+       D+N  E      LE+              RD + L      P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+    + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E IN   ++ E++      +R+   +D+  L
Sbjct:  392 CDTCPRAYHLVCLEPELDEPPEGKWSCPHCEADGGAAEEEDDDEHQEFCRVCKDGG-----ELLCCDSCPSAYHTFCL-----NPPLDTIPDGDWR----CPRCSCPPLTGKAEKIITWRWAQRSNDDGPSTSKGSKNSNSRV--REYFIKWHNMSYWHCEWVPEVQLDVHHPLMIRSFQRK-YDMEEPPKFEESLDEADTRYKRIQRHKDKVGMKANDDAEV-LEERFYKNGVKPEWLIVQRVINHRTARDGSTMYLVKWRELPYDKSTWE--EEGDDIQGLRQAIDYYQDLRAVCTSETTQSRSKKSKKGRKSKLKVEDDEDRPVKHYTPPPEKPTTDLKKKYEDQPAFL----EGTGMQLHPYQIEGINWLRYSWGQGIDTILADEMGLGKTIQTVTFLYSLYKEGHCRGPFLVAVPLSTLVNWEREFELWAPDFYCITYIGDKDSRAVIRENELSFEEGAIRGSKVSRLRTTQYKFNVLLTSYELISMDAACLGSIDWAVLVVDEAHRLKSNQSKFFRILNSYTIAYKLLLTGTPLQNNLEELFHLLNFLSRDKFNDLQAFQGEFADVSKEEQVKRLHEMLGPHMLRRLKTDVLKNMPSKSEFIVRVELSAMQKKFYKFILTKNYEALNSKSGGGSCSLINIMMDLKKCCNHPYLFPSAAEEATTAAGGLYEINSLTKAAGKLVLLSKMLKQLKAQNHRVLIFSQMTKMLDILEDFLEGEQYKYERIDGGITGTLRQEAIDRFNAPGAQQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRNSVEERVTQVAKRKMMLTHLVVRPGMGGKGANFTKQELDDILRFGTEDLFKEDDK--EEAIHYDDKAVAELLDRTNRGIEEKE-SWANEYLSSFKVASY--ATKEEEEEEETEIIKQDAENS---DPA-YWVKLLRHHYE--QHQEDVGRSLGKGKRVRKQVNYTDGGVVAADTTRDDS-NWQDNGSEYNSEYSAGSDEDGGDDDFDDQNGAERKAKRRLER--------------RDDRPL------PPLLARVGGNIE-------------VLGFNARQRKSFLNAIMRYGMPPQDAFNSQ-WLVRDLRGKSERNFKAYVSLFMRHLCEPGADNAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHINGYYSMPELILKPCEPVRSALKQDVAAL 1535          

HSP 2 Score: 64.6994 bits (156), Expect = 8.003e-10
Identity = 40/113 (35.40%), Postives = 67/113 (59.29%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH-WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+H+ W++      +A +       W++ HDY+LL+ I +HGY ++ D I  D ++ I+  P +   +D+ K N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1729 FNIADGGFTELHTLWLNE----EKAAVPGREYEIWHRRHDYWLLAGIVTHGYGRWQD-IQNDIRFAIINEPFK---MDVGKGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1833          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Fly
Match: Mi-2 (gene:FBgn0262519 transcript:FBtr0332152)

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 468/1216 (38.49%), Postives = 654/1216 (53.78%), Query Frame = 1
Query:  262 CETCGLVF-IKRTDKKIDEKDVNK--CLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWR--------SEAIGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDS----------HRRKLS-----ELEVKLHEKYFQWGIDPEWLQPHKVL----GMDDVGCF-VKWRGLGYEFVSTEPLTRVTHINGLQEAIDRHRKLIKEITD----------------------------KSYVARNKSKLT----KLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQ------NKKKNFPT----FHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLLSSEIAEETEDGS--YDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETINR--TILEIVTYKIWDIRTISIEDLENL 3648
            C+TC   + +   + ++DE    K  C  C        +E  D+  + C  CK+        +  C  C   YH  CL     +  L   P    R    C RC+   L  K   I+TW+W         S + G  N +     RE+ I + NMSYW CEWV EVQL++  P + R+++RK  D   PP  E   D           H+ K+      + EV L E++++ G+ PEWL   +V+      D    + VKWR L Y+  + E       I GL++AID ++ L    T                             K Y    +   T    K E+ P +L          LHPYQ+EG+NWLR S+   I+TILADEMGLGKTIQ ++FLYSLYK+   RGPFL+ VPLST+ NWEREFE WAPDF  + Y GDKD+R VIR+ ++ ++      +K     T    F+VLLT+YELI MD   L  I+W +L+VDEAHRLK+N++K F+ L  Y I Y++L++GTPLQNNLEELF+LLNF+  + F D+  F  +F D+SKEEQV +L EML    LRRLK+DV  + P+K E I+RVEL+ +QKKFYK ILTKNYEAL+ K  G   S  NI+M L+KCCNHPYL  S   E T      Y++ +L  A+GK  +L KMLK+L+   H+VLIFS MTK+LD+LE  LE    +YERIDG ++ T RQ AIDRFN P +   VFLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ  KVMIYRFVTRNS+EE++ + +KRK+M+T+LVV+        +FTK E   I+ FGT+DLF E+++  ++ I YDD A+ +LLDR     +  E S+ +   S FK+A Y  A  + E E+  EI  +  ENS   +PA YW  LL    +    +E V    GKG R +K+VNY    ++  D   ++S N   +    +++Y     E+       D+N  E      LE+              RD + L      P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+    + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E IN   ++ E++      +R+   +D+  L
Sbjct:  383 CDTCPRAYHLVCLEPELDEPPEGKWSCPHCEADGGAAEEEDDDEHQEFCRVCKDG-----GELLCCDSCPSAYHTFCL-----NPPLDTIPDGDWR----CPRCSCPPLTGKAEKIITWRWAQRSNDDGPSTSKGSKNSNSRV--REYFIKWHNMSYWHCEWVPEVQLDVHHPLMIRSFQRK-YDMEEPPKFEESLDEADTRYKRIQRHKDKVGMKANDDAEV-LEERFYKNGVKPEWLIVQRVINHRTARDGSTMYLVKWRELPYDKSTWE--EEGDDIQGLRQAIDYYQDLRAVCTSETTQSRSKKSKKGRKSKLKVEDDEDRPVKHYTPPPEKPTTDLKKKYEDQPAFL----EGTGMQLHPYQIEGINWLRYSWGQGIDTILADEMGLGKTIQTVTFLYSLYKEGHCRGPFLVAVPLSTLVNWEREFELWAPDFYCITYIGDKDSRAVIRENELSFEEGAIRGSKVSRLRTTQYKFNVLLTSYELISMDAACLGSIDWAVLVVDEAHRLKSNQSKFFRILNSYTIAYKLLLTGTPLQNNLEELFHLLNFLSRDKFNDLQAFQGEFADVSKEEQVKRLHEMLGPHMLRRLKTDVLKNMPSKSEFIVRVELSAMQKKFYKFILTKNYEALNSKSGGGSCSLINIMMDLKKCCNHPYLFPSAAEEATTAAGGLYEINSLTKAAGKLVLLSKMLKQLKAQNHRVLIFSQMTKMLDILEDFLEGEQYKYERIDGGITGTLRQEAIDRFNAPGAQQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRNSVEERVTQVAKRKMMLTHLVVRPGMGGKGANFTKQELDDILRFGTEDLFKEDDK--EEAIHYDDKAVAELLDRTNRGIEEKE-SWANEYLSSFKVASY--ATKEEEEEEETEIIKQDAENS---DPA-YWVKLLRHHYE--QHQEDVGRSLGKGKRVRKQVNYTDGGVVAADTTRDDS-NWQDNGSEYNSEYSAGSDEDGGDDDFDDQNGAERKAKRRLER--------------RDDRPL------PPLLARVGGNIE-------------VLGFNARQRKSFLNAIMRYGMPPQDAFNSQ-WLVRDLRGKSERNFKAYVSLFMRHLCEPGADNAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHINGYYSMPELILKPCEPVRSALKQDVAAL 1526          

HSP 2 Score: 64.6994 bits (156), Expect = 8.342e-10
Identity = 40/113 (35.40%), Postives = 67/113 (59.29%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH-WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+H+ W++      +A +       W++ HDY+LL+ I +HGY ++ D I  D ++ I+  P +   +D+ K N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1720 FNIADGGFTELHTLWLNE----EKAAVPGREYEIWHRRHDYWLLAGIVTHGYGRWQD-IQNDIRFAIINEPFK---MDVGKGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1824          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Fly
Match: Mi-2 (gene:FBgn0262519 transcript:FBtr0100394)

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 468/1216 (38.49%), Postives = 654/1216 (53.78%), Query Frame = 1
Query:  262 CETCGLVF-IKRTDKKIDEKDVNK--CLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWR--------SEAIGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDS----------HRRKLS-----ELEVKLHEKYFQWGIDPEWLQPHKVL----GMDDVGCF-VKWRGLGYEFVSTEPLTRVTHINGLQEAIDRHRKLIKEITD----------------------------KSYVARNKSKLT----KLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQ------NKKKNFPT----FHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLLSSEIAEETEDGS--YDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETINR--TILEIVTYKIWDIRTISIEDLENL 3648
            C+TC   + +   + ++DE    K  C  C        +E  D+  + C  CK+        +  C  C   YH  CL     +  L   P    R    C RC+   L  K   I+TW+W         S + G  N +     RE+ I + NMSYW CEWV EVQL++  P + R+++RK  D   PP  E   D           H+ K+      + EV L E++++ G+ PEWL   +V+      D    + VKWR L Y+  + E       I GL++AID ++ L    T                             K Y    +   T    K E+ P +L          LHPYQ+EG+NWLR S+   I+TILADEMGLGKTIQ ++FLYSLYK+   RGPFL+ VPLST+ NWEREFE WAPDF  + Y GDKD+R VIR+ ++ ++      +K     T    F+VLLT+YELI MD   L  I+W +L+VDEAHRLK+N++K F+ L  Y I Y++L++GTPLQNNLEELF+LLNF+  + F D+  F  +F D+SKEEQV +L EML    LRRLK+DV  + P+K E I+RVEL+ +QKKFYK ILTKNYEAL+ K  G   S  NI+M L+KCCNHPYL  S   E T      Y++ +L  A+GK  +L KMLK+L+   H+VLIFS MTK+LD+LE  LE    +YERIDG ++ T RQ AIDRFN P +   VFLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ  KVMIYRFVTRNS+EE++ + +KRK+M+T+LVV+        +FTK E   I+ FGT+DLF E+++  ++ I YDD A+ +LLDR     +  E S+ +   S FK+A Y  A  + E E+  EI  +  ENS   +PA YW  LL    +    +E V    GKG R +K+VNY    ++  D   ++S N   +    +++Y     E+       D+N  E      LE+              RD + L      P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+    + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E IN   ++ E++      +R+   +D+  L
Sbjct:  393 CDTCPRAYHLVCLEPELDEPPEGKWSCPHCEADGGAAEEEDDDEHQEFCRVCKDGG-----ELLCCDSCPSAYHTFCL-----NPPLDTIPDGDWR----CPRCSCPPLTGKAEKIITWRWAQRSNDDGPSTSKGSKNSNSRV--REYFIKWHNMSYWHCEWVPEVQLDVHHPLMIRSFQRK-YDMEEPPKFEESLDEADTRYKRIQRHKDKVGMKANDDAEV-LEERFYKNGVKPEWLIVQRVINHRTARDGSTMYLVKWRELPYDKSTWE--EEGDDIQGLRQAIDYYQDLRAVCTSETTQSRSKKSKKGRKSKLKVEDDEDRPVKHYTPPPEKPTTDLKKKYEDQPAFL----EGTGMQLHPYQIEGINWLRYSWGQGIDTILADEMGLGKTIQTVTFLYSLYKEGHCRGPFLVAVPLSTLVNWEREFELWAPDFYCITYIGDKDSRAVIRENELSFEEGAIRGSKVSRLRTTQYKFNVLLTSYELISMDAACLGSIDWAVLVVDEAHRLKSNQSKFFRILNSYTIAYKLLLTGTPLQNNLEELFHLLNFLSRDKFNDLQAFQGEFADVSKEEQVKRLHEMLGPHMLRRLKTDVLKNMPSKSEFIVRVELSAMQKKFYKFILTKNYEALNSKSGGGSCSLINIMMDLKKCCNHPYLFPSAAEEATTAAGGLYEINSLTKAAGKLVLLSKMLKQLKAQNHRVLIFSQMTKMLDILEDFLEGEQYKYERIDGGITGTLRQEAIDRFNAPGAQQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRNSVEERVTQVAKRKMMLTHLVVRPGMGGKGANFTKQELDDILRFGTEDLFKEDDK--EEAIHYDDKAVAELLDRTNRGIEEKE-SWANEYLSSFKVASY--ATKEEEEEEETEIIKQDAENS---DPA-YWVKLLRHHYE--QHQEDVGRSLGKGKRVRKQVNYTDGGVVAADTTRDDS-NWQDNGSEYNSEYSAGSDEDGGDDDFDDQNGAERKAKRRLER--------------RDDRPL------PPLLARVGGNIE-------------VLGFNARQRKSFLNAIMRYGMPPQDAFNSQ-WLVRDLRGKSERNFKAYVSLFMRHLCEPGADNAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHINGYYSMPELILKPCEPVRSALKQDVAAL 1536          

HSP 2 Score: 64.6994 bits (156), Expect = 8.348e-10
Identity = 40/113 (35.40%), Postives = 67/113 (59.29%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH-WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+H+ W++      +A +       W++ HDY+LL+ I +HGY ++ D I  D ++ I+  P +   +D+ K N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1730 FNIADGGFTELHTLWLNE----EKAAVPGREYEIWHRRHDYWLLAGIVTHGYGRWQD-IQNDIRFAIINEPFK---MDVGKGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1834          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Fly
Match: Chd3 (gene:FBgn0023395 transcript:FBtr0074998)

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 387/884 (43.78%), Postives = 528/884 (59.73%), Query Frame = 1
Query:  400 EKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKW---RSEAIGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGMDD-----VGCFVKWRGLGYEFVSTEPLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLT-----KLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQ-------NKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEET--EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTD----ENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQ 2943
            E CK  S   D  +  C  C   YH  CL     S  LK  P    +    C RC  + L  K   I++W+W   RS  +  +  +K    RE+ I +  MSYW CEW+ E Q+ +   ++  +++R+S D   P   E         L + +  LHE+++++GI PEWL   +V+   +         VKWR L Y   S E       I GL +AI  ++KL      +    R++   T     K E+ P +L      A   LHP+Q+EGV+WLR S+   I TILADEMGLGKTIQ + FLYSL+K+   RGPFLI+VPLST+ NWERE E WAP+   V Y G K AR VIR  ++ ++        + +    F+V+LT+YE I +D  FL  I+W  L+VDEAHRL++N++K F+ L KY I Y++L++GTPLQNNLEELF+LLNF+    F D+  F ++F D+SKEEQV +L E+L+   LRRLK+DV    P K E I+RVEL+ +QKKFYK ILTKN++AL+ K  G    + NI+M LRKCCNHPYL  S   E T    G Y++ +L  ASGK D+L KMLK+L+   H+VL+FS MTK+L++LE+ LE    QY+RIDGS+    RQ AIDRFNDP S   VFLLST+AGGLGINL++ADTV I+D+DWNP ND+QA SRAHR+GQK+KVMIYRFVT NS+EE+IM+ +K K+M+T+LVV+        +F+K E   I+ FGT+DLF    +   + I YDD A+  LLDR     +  E S+ +   S FK+A Y    D  E +D       TD    EN + ++         +   ++  + ES+    GKG R +K+++Y  Q
Sbjct:   36 EYCKVCSDGGD--LLCCDSCPSVYHRTCL-----SPPLKSIP----KGDWICPRC--IPLPGKAEKILSWRWALDRSVELRTSKGEKR---REYFIKWHGMSYWHCEWIPEGQMLLHHASMVASFQRRS-DMEEPSLEE---------LDDQDGNLHERFYRYGIKPEWLLVQRVINHSEEPNGGTMYLVKWRELSYNDSSWE--RESDSIPGLNQAIALYKKLRSSNKGRQ---RDRPAPTIDLNKKYEDQPVFL----KEAGLKLHPFQIEGVSWLRYSWGQGIPTILADEMGLGKTIQTVVFLYSLFKEGHCRGPFLISVPLSTLTNWERELELWAPELYCVTYVGGKTARAVIRKHEISFEEVTTKTMRENQTQYKFNVMLTSYEFISVDAAFLGCIDWAALVVDEAHRLRSNQSKFFRILSKYRIGYKLLLTGTPLQNNLEELFHLLNFLSSGKFNDLQTFQAEFTDVSKEEQVKRLHEILEPHMLRRLKADVLKSMPPKSEFIVRVELSSMQKKFYKHILTKNFKALNQKGGGRVCSLLNIMMDLRKCCNHPYLFPSAAEEATISPSGLYEMSSLTKASGKLDLLSKMLKQLKADNHRVLLFSQMTKMLNVLEHFLEGEGYQYDRIDGSIKGDLRQKAIDRFNDPVSEHFVFLLSTRAGGLGINLATADTVIIFDSDWNPHNDVQAFSRAHRMGQKKKVMIYRFVTHNSVEERIMQVAKHKMMLTHLVVRPGMGGMTTNFSKDELEDILRFGTEDLF---KDGKSEAIHYDDKAVADLLDRTNRGIEEKE-SWANEYLSSFKVASYATKEDHEEHDDYNNDAENTDPFYWENLMGKSQPKLPKKQKKQSQQSQVDVESI---MGKGKRIRKEIDYSNQ 877          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Zebrafish
Match: chd4a (chromodomain helicase DNA binding protein 4a [Source:ZFIN;Acc:ZDB-GENE-041111-187])

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 448/1183 (37.87%), Postives = 647/1183 (54.69%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA----------IGVTNPDKYFMP----REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSH------RRKLSELEVKLHEKYFQWGIDPEWLQPHKVLG-----MDDVGCFVKWRGLGYEFVSTE-PLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLT------------------KLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLLSSEIAEETE--DGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLFDENNENNDQK-------IIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+ +  R D    E+D     +      E  D +++     C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    +  KV  I+TW+W              +    PD   +     REF + + NMSYW C WV+E+QLEI    ++R Y+RK+ D + PPP++   +        R+K      ++ EKY+++GI  EW+  H++L       ++    +KWR L Y+  + E     +   +  +     HR+L+  + D+    +                        K E  PDYL     T   TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R VIR+ +  ++N            KK+    FHVLLT+YELI +D   L  I+W  L+VDEAHRLKNN++K F+ L  Y + +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF   P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G ++S  N+VM L+KCCNHPYL  +   E  +  +G Y+   L  +SGK  +L+KML+KL+E GH+VLIFS MTK+LDLLE  LE+   +YERIDG ++   RQ AIDRFN P +   VFLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVT+ S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF +  E  +++       I YDD AID+LLDRN+  +D+ E   ++   S FK+A+Y       E E   EI  +  E SV     DYW  LL    +   ++E +    GKG R +K+VNY        +  S    +   D+    +DY ++  E            DE F     E+   N R P++  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  394 SCPHCEKMGIQWEAREDASEGEED-----NEAGGEAEEDDHHME----FCRVCKDGG-----ELLCCDSCPSSYHIHCL-----NPPL----PEIPNGEWICPRCTCPSMKGKVQKILTWRWTEPPPPTPVPRPSDLPTDAPDPTPLAGRPEREFFVKWQNMSYWHCSWVTELQLEIHCQVMFRNYQRKN-DMDEPPPIDFGGEGEEEKSDKRKKKDPTYARMEEKYYRFGIKMEWMVIHRILNHSVDKKNNCHYLIKWRDLTYDQATWELEDMDLPDYDTYKLQYWNHRELM--MGDEGKPGKKIKIKGKMRKLDRPPENPVVDPTIKFERQPDYL----DTTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFENNAIRGGKKPSKMKKEASVKFHVLLTSYELITIDTAVLGSIDWACLVVDEAHRLKNNQSKFFRILNNYPLQHKLLLTGTPLQNNLEELFHLLNFLTPERFSNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKFILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPAAAMEAAKMPNGMYEGGGLTKSSGKLLLLQKMLRKLKEGGHRVLIFSQMTKMLDLLEDFLENEGYKYERIDGGITGGMRQEAIDRFNAPGAPQFVFLLSTRAGGLGINLATADTVVIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEGEGENKEGQEDSSVIHYDDKAIDRLLDRNQDATDDTELQSMNEYLSSFKVAQY------VEEEVQREIIKQ--EESVD---PDYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY--------NDGSQEDRDWQDDQSDGQSDYSVASEE-----------GDEDF----DERSEANSRRPNRKGLRNDKDKPL-----PPLLARVSGNIE-------------VLGFNARQRKAFLNAVMRYGMPPQDAFTTQ-WLVRDLRGKSEREFKAYVSLFMRHLCEPGADGAESF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1489          

HSP 2 Score: 58.5362 bits (140), Expect = 7.706e-8
Identity = 41/117 (35.04%), Postives = 65/117 (55.56%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSI-----ASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I       HGY ++ D I  D ++ IL  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1712 FNIADGGFTELHSLWQN--EERAATVTKKTNEIWHRRHDYWLLAGIIQYLLMQHGYARWQD-IQNDVRFAILNEPFKG---EINRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1822          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Zebrafish
Match: chd5 (chromodomain helicase DNA binding protein 5 [Source:ZFIN;Acc:ZDB-GENE-120314-2])

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 446/1144 (38.99%), Postives = 631/1144 (55.16%), Query Frame = 1
Query:  391 KICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIG---------------VTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPV------EILSDSHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGMD-----DVGCFVKWRGLGYEFVSTEPLT-RVTHINGLQEAIDRHRKLIKEITDKSYVARNKSK-------------------LTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNK-----------KKNFPT-FHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEET--EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF----------DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ W W    +                   P K    R+  + ++ +SYW C WVSE+QLE+    +YR Y+RK+ D + PPP       E L++  RR        + E+++++GI PEWL  H++L        DV   +KWR L Y+  S E     V   + L++A   HR  +     +  + R   +                     K E+ P Y+         TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q I FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPDF +V Y GDK++R +IR+ +  +++            KK+ P  FHVLLT+YELI +D+  L  I W  L+VDEAHRLKNN++K F+ L  Y I Y++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DISKE+Q+ KL ++L    LRRLK+DVF + P K E I+RVEL+P+QKK+YK ILT+N+EAL+ K  G  V + NI+M L+KCCNHPYL      E     +GSYD   L+ +SGK  +L+KML KL++ GH+VLIFS MTK+LDLLE  LE    +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +KRK+M+T+LVV+        S +K E   I+ FGT++LF           +N E  +  +I YDD AI KLLDR++  +++ E   ++   S FK+A+Y    +  E E   EI  K +EN    +P DYW  LL    +   ++E +    GKG R +K+VNY                N A  +D +  D D+S+ ++       + +        D E++ E GR  S+  +  DRD K L      P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E   ++  FM +L E      +      GV ++ +    +++RI +  L+  KV ++E +N
Sbjct:    2 EFCRVCKDGG-----ELLCCDTCPSSYHIHCL-----NPPL----PEIPNGEWLCPRCMCPPLKGKVQKILHWSWGDPPLPPEVPLGPDGEKVDNLAKTPLKGRPERQLFVKWAGLSYWHCSWVSELQLELYHTVMYRNYQRKN-DMDEPPPYDYGSGEEELNNEKRRSKDPQYAAMEERFYRYGIKPEWLIIHRILNHSFDKDGDVQYLIKWRDLPYDQCSWEADDFDVPDYDSLKQAYWDHRNQVLGENHQPLLFRKGKRPKEEMKRREPPPDTPVVDPTIKFEQQPWYI----DDTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRAIIRENEFTFEDSAVKSGRKVFRMKKDTPIKFHVLLTSYELITIDQAILGSITWACLVVDEAHRLKNNQSKFFRILNGYKIYYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGNLLVKSSGKLTLLQKMLIKLKDGGHRVLIFSQMTKMLDLLEDFLEFEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDDVEAARTMGDNKEGEEVSVIHYDDNAISKLLDRSQDATEDTEIQNMNEYLSSFKVAQYVVREEDGEEEVQREII-KQEENV---DP-DYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY----------------NDASQEDQEWQD-DLSDNQS-------EYSVGSEDEDEDFEERPEGGRRHSRRQLKSDRD-KPL------PPLLARVSGNIE-------------VLGFNARQRKAFLNAIMRWGMPPQDAFNSH-WLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVN 1072          

HSP 2 Score: 69.707 bits (169), Expect = 3.293e-11
Identity = 42/114 (36.84%), Postives = 69/114 (60.53%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH--WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+H+ W    +   RA + +  ++  W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ K N  +++  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1281 FNIADGGFTELHTLW----QNEERAAVSSGKIYDIWHRRHDYWLLAGIVTHGYARWQD-IQNDPRYAILNEPFKT---EMHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAA 1386          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Zebrafish
Match: chd5 (chromodomain helicase DNA binding protein 5 [Source:ZFIN;Acc:ZDB-GENE-120314-2])

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 446/1144 (38.99%), Postives = 631/1144 (55.16%), Query Frame = 1
Query:  391 KICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIG---------------VTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPV------EILSDSHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGMD-----DVGCFVKWRGLGYEFVSTEPLT-RVTHINGLQEAIDRHRKLIKEITDKSYVARNKSK-------------------LTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNK-----------KKNFP-TFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEET--EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF----------DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ W W    +                   P K    R+  + ++ +SYW C WVSE+QLE+    +YR Y+RK+ D + PPP       E L++  RR        + E+++++GI PEWL  H++L        DV   +KWR L Y+  S E     V   + L++A   HR  +     +  + R   +                     K E+ P Y+         TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q I FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPDF +V Y GDK++R +IR+ +  +++            KK+ P  FHVLLT+YELI +D+  L  I W  L+VDEAHRLKNN++K F+ L  Y I Y++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DISKE+Q+ KL ++L    LRRLK+DVF + P K E I+RVEL+P+QKK+YK ILT+N+EAL+ K  G  V + NI+M L+KCCNHPYL      E     +GSYD   L+ +SGK  +L+KML KL++ GH+VLIFS MTK+LDLLE  LE    +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +KRK+M+T+LVV+        S +K E   I+ FGT++LF           +N E  +  +I YDD AI KLLDR++  +++ E   ++   S FK+A+Y    +  E E   EI  K +EN    +P DYW  LL    +   ++E +    GKG R +K+VNY                N A  +D +  D D+S+ ++       + +        D E++ E GR  S+  +  DRD K L      P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E   ++  FM +L E      +      GV ++ +    +++RI +  L+  KV ++E +N
Sbjct:  424 EFCRVCKDGG-----ELLCCDTCPSSYHIHCL-----NPPL----PEIPNGEWLCPRCMCPPLKGKVQKILHWSWGDPPLPPEVPLGPDGEKVDNLAKTPLKGRPERQLFVKWAGLSYWHCSWVSELQLELYHTVMYRNYQRKN-DMDEPPPYDYGSGEEELNNEKRRSKDPQYAAMEERFYRYGIKPEWLIIHRILNHSFDKDGDVQYLIKWRDLPYDQCSWEADDFDVPDYDSLKQAYWDHRNQVLGENHQPLLFRKGKRPKEEMKRREPPPDTPVVDPTIKFEQQPWYI----DDTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRAIIRENEFTFEDSAVKSGRKVFRMKKDTPIKFHVLLTSYELITIDQAILGSITWACLVVDEAHRLKNNQSKFFRILNGYKIYYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGNLLVKSSGKLTLLQKMLIKLKDGGHRVLIFSQMTKMLDLLEDFLEFEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDDVEAARTMGDNKEGEEVSVIHYDDNAISKLLDRSQDATEDTEIQNMNEYLSSFKVAQYVVREEDGEEEVQREII-KQEENV---DP-DYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY----------------NDASQEDQEWQD-DLSDNQS-------EYSVGSEDEDEDFEERPEGGRRHSRRQLKSDRD-KPL------PPLLARVSGNIE-------------VLGFNARQRKAFLNAIMRWGMPPQDAFNSH-WLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVN 1494          

HSP 2 Score: 69.707 bits (169), Expect = 3.221e-11
Identity = 42/114 (36.84%), Postives = 69/114 (60.53%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH--WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+H+ W    +   RA + +  ++  W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ K N  +++  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1703 FNIADGGFTELHTLW----QNEERAAVSSGKIYDIWHRRHDYWLLAGIVTHGYARWQD-IQNDPRYAILNEPFKT---EMHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAA 1808          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Zebrafish
Match: chd4a (chromodomain helicase DNA binding protein 4a [Source:ZFIN;Acc:ZDB-GENE-041111-187])

HSP 1 Score: 673.315 bits (1736), Expect = 0.000e+0
Identity = 444/1135 (39.12%), Postives = 632/1135 (55.68%), Query Frame = 1
Query:  391 KICEKCKESSLSLDNRMTGCLICMKYYHVNCL--LLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA-----------IGVTNPDKYFM----PREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDS------HRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLG-----MDDVGCFVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLI---------------KEITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLLSSEIAEETE--DGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF------DENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            + C  CK+        +  C  C   YH++CL   L D           +   +  C RC    L  KV  ++TW+W  EA           +    PD   M     REF + + N SYW C WV E+QLE++   ++R Y+RK+ D   PP +E+ ++        R+       ++ +KY ++G+  EWL  H++L       ++V   +KWR L Y+  + E     V      ++    HR+L+                  T++           K +  PDYL     +   TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R VIR+ +  +++            KK+    FHVLLT+YELI +D+  L  I+W  L+VDEAHRLKNN++K F+ L  Y + +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF   P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G ++S  N+VM L+KCCNHPYL  +   E  +  +G YD  AL  ASGK  +L KMLKKL+E GH+VLIFS MTK+LDLLE  LE+   +YERIDG V+   RQ AIDRFN P +   VFLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVT+ S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT+ LF       +N E +   I YDD AID+LLDRN+  +++ E   ++   S FK+A+Y    +  E ED      K +E+    +P DYW  LL    +   ++E +    GKG R +K VNY   D  + D  S    +   D+  + +DY ++  E            DE F   D   +A N R PS+  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  457 EFCRVCKDGG-----ELLCCDTCPSSYHLHCLNPPLPD-----------IPNGEWICPRCLSPPLKGKVQKVLTWRW-GEAPPPMPVPRPADLPAEAPDPPPMIGRKEREFFVKWCNKSYWHCSWVQELQLELNCQVMFRNYQRKT-DMEEPPNLEMGAEGDEDKSCKRKNKDPFYARMEDKYGRFGVKIEWLFIHRILNHSVDKKNNVHYLIKWRDLPYDQSTWESEDMDVPDFETYKQHYWNHRELMLGEEGRPGKKMKKVKVRKTERPPANPVVDPTIKFDRQPDYL----DSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFTFEDNAIRGGKKASKMKKEAAVKFHVLLTSYELITIDQAILGSIDWACLVVDEAHRLKNNQSKFFRVLNNYPLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKYILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPTAATEAPKMPNGMYDGSALTKASGKLMLLFKMLKKLKEGGHRVLIFSQMTKMLDLLEDFLENEGYKYERIDGGVTGGMRQEAIDRFNAPGAPQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKAGSMSKQELDDILKFGTEQLFKDELGEGDNKEEDSSVIHYDDKAIDRLLDRNQDATEDTELQSMNEYLSSFKVAQYVVKDEDEEEEDVDREIIKQEESV---DP-DYWEKLLRHHYE--QQQEDLARHLGKGKRPRKPVNY--NDCSQEDRGSRR--DWQDDQSDNQSDYSVASEE-----------GDEDF---DERSEAANSRRPSRKGLRNDKDKPL-----PPLLARVGGNIE-------------VLGFNARQRKAFLNAVMRYGMPPQDAFTTQ-WLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1524          

HSP 2 Score: 67.3958 bits (163), Expect = 1.792e-10
Identity = 41/112 (36.61%), Postives = 66/112 (58.93%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I  HGY ++ D +  DP++ IL  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1740 FNIADGGFTELHSLWQN--EERAATVTKKTYEIWHRRHDYWLLAGIIFHGYARWQD-VQNDPRFAILNEPFKG---EMSRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1845          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Zebrafish
Match: chd5 (chromodomain helicase DNA binding protein 5 [Source:ZFIN;Acc:ZDB-GENE-120314-2])

HSP 1 Score: 673.315 bits (1736), Expect = 0.000e+0
Identity = 446/1172 (38.05%), Postives = 631/1172 (53.84%), Query Frame = 1
Query:  391 KICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIG---------------VTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPV------EILSDSHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGMD-----DVGCFVKWRGLGYEFVSTEPLT-RVTHINGLQEAIDRHRKLIKEITDKSYVARNKSK-------------------LTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNK-----------KKNFPT-FHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEET--EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF--------------------------------------DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ W W    +                   P K    R+  + ++ +SYW C WVSE+QLE+    +YR Y+RK+ D + PPP       E L++  RR        + E+++++GI PEWL  H++L        DV   +KWR L Y+  S E     V   + L++A   HR  +     +  + R   +                     K E+ P Y+         TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q I FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPDF +V Y GDK++R +IR+ +  +++            KK+ P  FHVLLT+YELI +D+  L  I W  L+VDEAHRLKNN++K F+ L  Y I Y++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DISKE+Q+ KL ++L    LRRLK+DVF + P K E I+RVEL+P+QKK+YK ILT+N+EAL+ K  G  V + NI+M L+KCCNHPYL      E     +GSYD   L+ +SGK  +L+KML KL++ GH+VLIFS MTK+LDLLE  LE    +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +KRK+M+T+LVV+        S +K E   I+ FGT++LF                                       +N E  +  +I YDD AI KLLDR++  +++ E   ++   S FK+A+Y    +  E E   EI  K +EN    +P DYW  LL    +   ++E +    GKG R +K+VNY                N A  +D +  D D+S+ ++       + +        D E++ E GR  S+  +  DRD K L      P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E   ++  FM +L E      +      GV ++ +    +++RI +  L+  KV ++E +N
Sbjct:    2 EFCRVCKDGG-----ELLCCDTCPSSYHIHCL-----NPPL----PEIPNGEWLCPRCMCPPLKGKVQKILHWSWGDPPLPPEVPLGPDGEKVDNLAKTPLKGRPERQLFVKWAGLSYWHCSWVSELQLELYHTVMYRNYQRKN-DMDEPPPYDYGSGEEELNNEKRRSKDPQYAAMEERFYRYGIKPEWLIIHRILNHSFDKDGDVQYLIKWRDLPYDQCSWEADDFDVPDYDSLKQAYWDHRNQVLGENHQPLLFRKGKRPKEEMKRREPPPDTPVVDPTIKFEQQPWYI----DDTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRAIIRENEFTFEDSAVKSGRKVFRMKKDTPIKFHVLLTSYELITIDQAILGSITWACLVVDEAHRLKNNQSKFFRILNGYKIYYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGNLLVKSSGKLTLLQKMLIKLKDGGHRVLIFSQMTKMLDLLEDFLEFEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDDVEAARTMGELKVLEMKSIVLPLCVPIAEVLNLSSTGDNKEGEEVSVIHYDDNAISKLLDRSQDATEDTEIQNMNEYLSSFKVAQYVVREEDGEEEVQREII-KQEENV---DP-DYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY----------------NDASQEDQEWQD-DLSDNQS-------EYSVGSEDEDEDFEERPEGGRRHSRRQLKSDRD-KPL------PPLLARVSGNIE-------------VLGFNARQRKAFLNAIMRWGMPPQDAFNSH-WLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVN 1100          

HSP 2 Score: 69.707 bits (169), Expect = 3.420e-11
Identity = 42/114 (36.84%), Postives = 69/114 (60.53%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH--WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+H+ W    +   RA + +  ++  W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ K N  +++  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1309 FNIADGGFTELHTLW----QNEERAAVSSGKIYDIWHRRHDYWLLAGIVTHGYARWQD-IQNDPRYAILNEPFKT---EMHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAA 1414          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Xenopus
Match: son (SON DNA binding protein [Source:Xenbase;Acc:XB-GENE-6037418])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 495/1326 (37.33%), Postives = 710/1326 (53.54%), Query Frame = 1
Query:  379 DDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKW-----------RSEAIGVTNPDKYF---MPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD----SHRRKLSELE-VKLHEKYFQWGIDPEWLQPHKVL--GMDDVGC---FVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLEESPDYLGPPST-----------TAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYL--LSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF-----DENNENNDQKII-YDDAAIDKLLDRNR-FTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN--------------------------------------RTILEIVTYKIWDIRTISIEDLENLFTDLGHFEIDFNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIAS-------HGYDKYIDQIFIDPQYQILFIPLR----IANLDLVKDNADIRKCFRNRQRLLENALLIEAQIMKVG 4008
            D   + C  CK+        +  C  C   YH++CL     +  L   P      +  C RC    L  K+  I+TWKW            ++A     P K       REF + +  MSY  C WV+E+QLE+    ++R Y+RK+ D + PP  +   D    S +RK  + + +++ EK++++GI PEW+  H+VL   +D  G     +KWR L Y+  S E   + +   +  ++A   HR+L+     +      K KL K+E  PD      T               TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R VIR+ +  +++            KK+    FHVLLT+YELI +D   L  I+W  L+VDEAHRLKNN++K F+ L  Y++ +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF + P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +++  A +  +G YD  ALI  +GK  +L+KML+KL++ GH+VLIFS MTK+LDLLE  LEH   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF     +EN E +D  +I YDD AI +LLDRN+  T D  E   ++   S FK+A+Y   VD  E E   EI  +  E SV     DYW  LL    +   ++E +    GKG R +K+VNY                   +D   +D D+   + +N    S      DE     D ++++E  R P++  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N                                       T     +   W +   + E  +            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LLS I +       HGY ++ D I  D +Y IL  P +      N   +K+     K    R +LLE AL+IE Q+ +  
Sbjct:  397 DHHMEFCRVCKDGG-----ELLCCDACPSSYHIHCL-----NPPLPEIPNG----EWLCPRCTCPALKGKIQKILTWKWGQPPPPTPVPRPADADPEAPPPKPLEGRPEREFFVKWQAMSYLHCSWVTELQLELHCQVMFRNYQRKN-DMDEPPAGDYGGDDEEKSRKRKNKDPKYLEMEEKFYRYGIKPEWMMIHRVLNHSVDKKGFVHYLIKWRDLPYDQASWESEESDIQDYDIYRQAYWNHRELMCGDEGRPGKKTKKVKLRKVERPPDTPAVDPTVKYDRQPEYLDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAVLGSIDWACLVVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKFILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIKGAGKLLLLQKMLRKLKDDGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVVIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATEENKEGDDISVIHYDDKAIARLLDRNQDETEDLVELQGMNEYLSSFKVAQY---VD--EEEVVREIIKQ--EESVD---PDYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY-------------------NDGSQEDRDWQDDQSDNQSDYSVASEEGDE-----DFDERSEAARRPNRKGLRNDKDKPL-----PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRYGMPPQDAFTTQ-WLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWSMPELAEAEENKKASQIDSPSPKTPTSSTPGDTQPNTPAPPASNGNWQLLLSAEEKTKKASAAAAKQRFMFNIADGGFTELHSLWQN--EERAATVTKKTYEIWHRRHDYWLLSGIITYPFGLVFHGYARWQD-IQNDVRYAILNEPFKGEVNRGNFLEIKN-----KFLARRFKLLEQALVIEEQLRRAA 1642          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Xenopus
Match: hnf1b (HNF1 homeobox B [Source:Xenbase;Acc:XB-GENE-485652])

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 503/1335 (37.68%), Postives = 719/1335 (53.86%), Query Frame = 1
Query:  391 KICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGVTNP---DKYFMP---------REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSH------RRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGMD-----DVGCFVKWRGLGYEFVSTE-PLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNK-SKLTKLEESPDYLGP---PST----------TAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEET--EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLFDENNENNDQK------IIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETINR-----------------------------------TILEIVTYKIW------------DIRT-------ISIEDLENLFTDL-GHFEIDFNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH--WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ W WR        P   D    P         REF + ++ +SYW C W  E+QLE+    ++R Y+RK+ D + PPP +  S         RR    L  K+ EK++++GI PEW+  H+++        DV   +KW+ L Y+  + E  +  +     +++A   HR+L+     +    +NK +K  KLE+ P  L P   P+           +   TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q I FLYSLYK+  S+GP+L++ PLST+ NWEREFE WAP+F +V Y GDKD+R VIR+ +  +++            KK+    FHVLLT+YELI +D   L  I W  L+VDEAHRLKNN++K F+ L  Y I+Y++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DISKE+Q+ KL ++L    LRRLK+DVF + P K E I+RVEL+ +QKK+YK ILT+N+EAL+ K  G  V + NI+M L+KCCNHPYL      E     +GSYD  +L+ +SGK  +L+KMLKKL++ GH+VLIFS MTK+LDLLE  LE+   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +KRK+M+T+LVV+        S TK E   I+ FGT++LF ++ E +++       I YDDAAI KLLDRN+  +++ E   ++   S FK+A+Y    +    E   EI  K +EN    +P DYW  LL    +   ++E +    GKG R +K+VNY                N A  +D   ++Y +                       D E+K E GR  S+  +  DRD K L      P L  ++   +              + GF  ++R     A+M +G+ P+     + W    L  KT  E   ++  FM +L E      +      GV ++ +    +++RI +  L+  K   Y+ +N                                    T L I   +IW            +  T       I  ED E    D  G F+  FNI DGGF+E+H+ W    +   RA + +  ++  W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ K N  +++  F  R+ +LLE AL+IE Q+ +  
Sbjct:  310 EFCRVCKDGG-----ELLCCDTCPSSYHLHCL-----NPPL----PEIPNGEWLCPRCTCPPLKGKVQRILHWVWREPPPPSGFPVDIDPLMPPPKPVEGIPEREFFVKWAGLSYWHCSWAKELQLELYHTVMFRNYQRKN-DMDDPPPYDYGSGDEEGKSEKRRNKDPLYAKMEEKFYRYGIKPEWMMIHRIMNHSFDKKGDVHYLIKWKDLPYDQCTWEIDIIDIPDYENMKQAYWDHRELMLGEDARPLRFKNKKTKDEKLEKPP--LAPIVDPTVKFDKQPWYIDSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPEFYVVTYTGDKDSRAVIRENEFSFEDNAIKSGKKVFRMKKEAQIKFHVLLTSYELITIDHAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLDGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGNSLVKSSGKLMLLQKMLKKLKDGGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKDDVEGDNKDVEDSSVIHYDDAAISKLLDRNQDATEDTEIQNMNEYLSSFKVAQYVVREEDGVEEVEREII-KQEENV---DP-DYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY----------------NDASQEDQGASEYSVG----------------SEDEDEDFEEKPEGGRRQSRRQLKSDRD-KPL------PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRWGMPPQDAFNSN-WLVRDLRGKTEKEFRAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLVRKKGEIYKHLNARSVHANAEREEKESPVSKQLGQEKASMQQECILWVTFLFINNNRIWFTGEDDKPDEKEECETHQNGENDIKQEDDEGKKEDKNGKFKFMFNIADGGFTELHTLW----QNEERAAISSGKIYDIWHRRHDYWLLAGIVTHGYARWQD-IQNDPRYLILNEPFKS---EIHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAA 1557          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Xenopus
Match: hnf1b (HNF1 homeobox B [Source:Xenbase;Acc:XB-GENE-485652])

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 503/1335 (37.68%), Postives = 719/1335 (53.86%), Query Frame = 1
Query:  391 KICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGVTNP---DKYFMP---------REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSH------RRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGMD-----DVGCFVKWRGLGYEFVSTE-PLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNK-SKLTKLEESPDYLGP---PST----------TAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEET--EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLFDENNENNDQK------IIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETINR-----------------------------------TILEIVTYKIW------------DIRT-------ISIEDLENLFTDL-GHFEIDFNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH--WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ W WR        P   D    P         REF + ++ +SYW C W  E+QLE+    ++R Y+RK+ D + PPP +  S         RR    L  K+ EK++++GI PEW+  H+++        DV   +KW+ L Y+  + E  +  +     +++A   HR+L+     +    +NK +K  KLE+ P  L P   P+           +   TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q I FLYSLYK+  S+GP+L++ PLST+ NWEREFE WAP+F +V Y GDKD+R VIR+ +  +++            KK+    FHVLLT+YELI +D   L  I W  L+VDEAHRLKNN++K F+ L  Y I+Y++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DISKE+Q+ KL ++L    LRRLK+DVF + P K E I+RVEL+ +QKK+YK ILT+N+EAL+ K  G  V + NI+M L+KCCNHPYL      E     +GSYD  +L+ +SGK  +L+KMLKKL++ GH+VLIFS MTK+LDLLE  LE+   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +KRK+M+T+LVV+        S TK E   I+ FGT++LF ++ E +++       I YDDAAI KLLDRN+  +++ E   ++   S FK+A+Y    +    E   EI  K +EN    +P DYW  LL    +   ++E +    GKG R +K+VNY                N A  +D   ++Y +                       D E+K E GR  S+  +  DRD K L      P L  ++   +              + GF  ++R     A+M +G+ P+     + W    L  KT  E   ++  FM +L E      +      GV ++ +    +++RI +  L+  K   Y+ +N                                    T L I   +IW            +  T       I  ED E    D  G F+  FNI DGGF+E+H+ W    +   RA + +  ++  W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ K N  +++  F  R+ +LLE AL+IE Q+ +  
Sbjct:  314 EFCRVCKDGG-----ELLCCDTCPSSYHLHCL-----NPPL----PEIPNGEWLCPRCTCPPLKGKVQRILHWVWREPPPPSGFPVDIDPLMPPPKPVEGIPEREFFVKWAGLSYWHCSWAKELQLELYHTVMFRNYQRKN-DMDDPPPYDYGSGDEEGKSEKRRNKDPLYAKMEEKFYRYGIKPEWMMIHRIMNHSFDKKGDVHYLIKWKDLPYDQCTWEIDIIDIPDYENMKQAYWDHRELMLGEDARPLRFKNKKTKDEKLEKPP--LAPIVDPTVKFDKQPWYIDSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPEFYVVTYTGDKDSRAVIRENEFSFEDNAIKSGKKVFRMKKEAQIKFHVLLTSYELITIDHAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLDGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGNSLVKSSGKLMLLQKMLKKLKDGGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKDDVEGDNKDVEDSSVIHYDDAAISKLLDRNQDATEDTEIQNMNEYLSSFKVAQYVVREEDGVEEVEREII-KQEENV---DP-DYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY----------------NDASQEDQGASEYSVG----------------SEDEDEDFEEKPEGGRRQSRRQLKSDRD-KPL------PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRWGMPPQDAFNSN-WLVRDLRGKTEKEFRAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLVRKKGEIYKHLNARSVHANAEREEKESPVSKQLGQEKASMQQECILWVTFLFINNNRIWFTGEDDKPDEKEECETHQNGENDIKQEDDEGKKEDKNGKFKFMFNIADGGFTELHTLW----QNEERAAISSGKIYDIWHRRHDYWLLAGIVTHGYARWQD-IQNDPRYLILNEPFKS---EIHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAA 1561          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Xenopus
Match: son (SON DNA binding protein [Source:Xenbase;Acc:XB-GENE-6037418])

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 492/1326 (37.10%), Postives = 709/1326 (53.47%), Query Frame = 1
Query:  379 DDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKW-----------RSEAIGVTNPDKYF---MPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD----SHRRKLSELE-VKLHEKYFQWGIDPEWLQPHKVL--GMDDVGC---FVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLEESPDYLGPPST-----------TAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYL--LSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF-----DENNENNDQKII-YDDAAIDKLLDRNR-FTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLI------------------------NYKVSQYE--------------TINRTILEIVTYKIWDI-------RTISIEDLENLFTDLGHFEIDFNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLR----IANLDLVKDNADIRKCFRNRQRLLENALLIEAQIMKVG 4008
            D   + C  CK+        +  C  C   YH++CL     +  L   P      +  C RC    L  K+  I+TWKW            ++A     P K       REF + +  MSY  C WV+E+QLE+    ++R Y+RK+ D + PP  +   D    S +RK  + + +++ EK++++GI PEW+  H+VL   +D  G     +KWR L Y+  S E   + +   +  ++A   HR+L+     +      K KL K+E  PD      T               TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R VIR+ +  +++            KK+    FHVLLT+YELI +D   L  I+W  L+VDEAHRLKNN++K F+ L  Y++ +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF + P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +++  A +  +G YD  ALI  +GK  +L+KML+KL++ GH+VLIFS MTK+LDLLE  LEH   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF     +EN E +D  +I YDD AI +LLDRN+  T D  E   ++   S FK+A+Y    ++   E+    +    E SV     DYW  LL    +   ++E +    GKG R +K+VNY                   +D   +D D+   + +N    S      DE F     ++++E  R P++  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI                        N K SQ +              T   T     +   W +       +T + E  +            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LLS I +HGY ++ D I  D +Y IL  P +      N   +K+     K    R +LLE AL+IE Q+ +  
Sbjct:  413 DHHMEFCRVCKDGG-----ELLCCDACPSSYHIHCL-----NPPLPEIPNG----EWLCPRCTCPALKGKIQKILTWKWGQPPPPTPVPRPADADPEAPPPKPLEGRPEREFFVKWQAMSYLHCSWVTELQLELHCQVMFRNYQRKN-DMDEPPAGDYGGDDEEKSRKRKNKDPKYLEMEEKFYRYGIKPEWMMIHRVLNHSVDKKGFVHYLIKWRDLPYDQASWESEESDIQDYDIYRQAYWNHRELMCGDEGRPGKKTKKVKLRKVERPPDTPAVDPTVKYDRQPEYLDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAVLGSIDWACLVVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKFILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIKGAGKLLLLQKMLRKLKDDGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVVIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATEENKEGDDISVIHYDDKAIARLLDRNQDETEDLVELQGMNEYLSSFKVAQYVVREEEMGDEEEVVREIIKQEESVD---PDYWEKLLRHHYEQ--QQEDLARNLGKGKRIRKQVNY-------------------NDGSQEDRDWQDDQSDNQSDYSVASEEGDEDF-----DERSEAARRPNRKGLRNDKDKPL-----PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRYGMPPQDAFTTQ-WLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWSMPELAEAEENKKASQIDSPSPKTPTSSTPGDTQPNTPAPPASNGNWQLLLSGDSEQTTAEEKTKKASAAAAKQRFMFNIADGGFTELHSLWQN--EERAATVTKKTYEIWHRRHDYWLLSGIITHGYARWQD-IQNDVRYAILNEPFKGEVNRGNFLEIKN-----KFLARRFKLLEQALVIEEQLRRAA 1665          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Xenopus
Match: hnf1b (HNF1 homeobox B [Source:Xenbase;Acc:XB-GENE-485652])

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 501/1335 (37.53%), Postives = 723/1335 (54.16%), Query Frame = 1
Query:  391 KICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGVTNP---DKYFMP---------REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSH------RRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGMD-----DVGCFVKWRGLGYEFVSTE-PLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNK-SKLTKLEESPDYLGP---PST----------TAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEET--EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLFDENNENNDQK------IIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETINR-----------------------------------TILEIVTYKIW------------DIRT-------ISIEDLENLFTDL-GHFEIDFNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH--WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ W WR        P   D    P         REF + ++ +SYW C W  E+QLE+    ++R Y+RK+ D + PPP +  S         RR    L  K+ EK++++GI PEW+  H+++        DV   +KW+ L Y+  + E  +  +     +++A   HR+L+     +    +NK +K  KLE+ P  L P   P+           +   TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q I FLYSLYK+  S+GP+L++ PLST+ NWEREFE WAP+F +V Y GDKD+R VIR+ +  +++            KK+    FHVLLT+YELI +D   L  I W  L+VDEAHRLKNN++K F+ L  Y I+Y++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DISKE+Q+ KL ++L    LRRLK+DVF + P K E I+RVEL+ +QKK+YK ILT+N+EAL+ K  G  V + NI+M L+KCCNHPYL      E     +GSYD  +L+ +SGK  +L+KMLKKL++ GH+VLIFS MTK+LDLLE  LE+   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +KRK+M+T+LVV+        S TK E   I+ FGT++LF ++ E +++       I YDDAAI KLLDRN+  +++ E   ++   S FK+A+Y    +  E  +   IK + + +       DYW  LL    +   ++E +    GKG R +K+VNY                N A  +D +  D D+S+ ++       + +        D E+K E GR  S+  +  DRD K L      P L  ++   +              + GF  ++R     A+M +G+ P+     + W    L  KT  E   ++  FM +L E      +      GV ++ +    +++RI +  L+  K   Y+ +N                                    T L I   +IW            +  T       I  ED E    D  G F+  FNI DGGF+E+H+ W    +   RA + +  ++  W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ K N  +++  F  R+ +LLE AL+IE Q+ +  
Sbjct:  340 EFCRVCKDGG-----ELLCCDTCPSSYHLHCL-----NPPL----PEIPNGEWLCPRCTCPPLKGKVQRILHWVWREPPPPSGFPVDIDPLMPPPKPVEGIPEREFFVKWAGLSYWHCSWAKELQLELYHTVMFRNYQRKN-DMDDPPPYDYGSGDEEGKSEKRRNKDPLYAKMEEKFYRYGIKPEWMMIHRIMNHSFDKKGDVHYLIKWKDLPYDQCTWEIDIIDIPDYENMKQAYWDHRELMLGEDARPLRFKNKKTKDEKLEKPP--LAPIVDPTVKFDKQPWYIDSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPEFYVVTYTGDKDSRAVIRENEFSFEDNAIKSGKKVFRMKKEAQIKFHVLLTSYELITIDHAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLDGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGNSLVKSSGKLMLLQKMLKKLKDGGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKDDVEGDNKDVEDSSVIHYDDAAISKLLDRNQDATEDTEIQNMNEYLSSFKVAQYVVREEDGEEVEREIIKQEENVD------PDYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY----------------NDASQEDQEWQD-DLSDNQS-------EYSVGSEDEDEDFEEKPEGGRRQSRRQLKSDRD-KPL------PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRWGMPPQDAFNSN-WLVRDLRGKTEKEFRAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLVRKKGEIYKHLNARSVHANAEREEKESPVSKQLGQEKASMQQECILWVTFLFINNNRIWFTGEDDKPDEKEECETHQNGENDIKQEDDEGKKEDKNGKFKFMFNIADGGFTELHTLW----QNEERAAISSGKIYDIWHRRHDYWLLAGIVTHGYARWQD-IQNDPRYLILNEPFKS---EIHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAA 1594          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Mouse
Match: Chd5 (chromodomain helicase DNA binding protein 5 [Source:MGI Symbol;Acc:MGI:3036258])

HSP 1 Score: 692.575 bits (1786), Expect = 0.000e+0
Identity = 444/1137 (39.05%), Postives = 642/1137 (56.46%), Query Frame = 1
Query:  391 KICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSE----AIGVTNPD-KYFMP----------REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSH------RRKLSELEVKLHEKYFQWGIDPEWLQPHKVLG-----MDDVGCFVKWRGLGYEFVSTE-PLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLEESPDYLGPPST-----------------TAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEET--EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLFDENNENNDQK------IIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ W+W        +G+  P+ +  MP          REF + ++ +SYW C WV E+QLE+    +YR Y+RK+ D + PPP +  S         R+    L  K+ E+++++GI PEW+  H++L        D+   +KW+ L Y+  + E     + + + L++A   HR+L+  + + + + +   K  K  +      PP T                     TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q I FLYSLYK+  S+GP+L++ PLST+ NWEREFE WAPDF +V Y GDK++R VIR+ +  +++            KK+    FHVLLT+YELI +D+  L  I W  L+VDEAHRLKNN++K F+ L  Y I+Y++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DISKE+Q+ KL ++L    LRRLK+DVF + P K E I+RVEL+ +QKK+YK ILT+N+EAL+ K  G  V + NI+M L+KCCNHPYL      E     +GSYD  +L+ +SGK  +L+KMLKKL++ GH+VLIFS MTK+LDLLE  LE+   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +KRK+M+T+LVV+        S TK E   I+ FGT++LF ++ E +++       I YDDAAI KLLDRN+  +D+ E   ++   S FK+A+Y    +    E   E+  K +EN    +P DYW  LL    +   ++E +    GKG R +K+VNY                N A  +D +  D      E  D+ S     S++     +   + ++GR  S+  +  DRD K L      P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E   ++  FM +L E      +      GV ++ +    +++RI +  L+  KV ++E +N
Sbjct:  419 EFCRVCKDGG-----ELLCCDACPSSYHLHCL-----NPPL----PEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEPPAPFVVGLPGPEVEPGMPPPRPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKN-DMDEPPPFDYGSGDEDGKSEKRKNKDPLYAKMEERFYRYGIKPEWMMVHRILNHSFDKKGDIHYLIKWKDLPYDQCTWEIDEIDIPYYDNLKQAYWGHRELM--LGEDARLPKRLVKKGKKLKDDKQEKPPDTPIVDPTVKFDKQPWYIDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRSVIRENEFSFEDNAIRGGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKDDVEGDNKDVEDSSVIHYDDAAISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVREEDGVEEVEREVI-KQEENV---DP-DYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY----------------NDASQEDQEWQD------ELSDNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQLKSDRD-KPL------PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRWGMPPQDAFNSH-WLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVN 1486          

HSP 2 Score: 72.0182 bits (175), Expect = 7.645e-12
Identity = 44/120 (36.67%), Postives = 72/120 (60.00%), Query Frame = 1
Query: 3661 GHFEIDFNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH--WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            G F+  FNI DGGF+E+H+ W    +   RA + +  ++  W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ K N  +++  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1660 GKFKFMFNIADGGFTELHTLW----QNEERAAVSSGKIYEIWHRRHDYWLLAGIVTHGYARWQD-IQNDPRYMILNEPFKS---EIHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAA 1771          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Mouse
Match: Chd4 (chromodomain helicase DNA binding protein 4 [Source:MGI Symbol;Acc:MGI:1344380])

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 448/1180 (37.97%), Postives = 651/1180 (55.17%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA--------------IGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD---SHRRKLSELE-VKLHEKYFQWGIDPEWLQPHKVL--GMDDVG---CFVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLIK---------------EITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYL--LSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF--------DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+ +    + K D  +  + L  V    E  D   D   + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ WKW                       P +    R+F + +  MSYW C WVSE+QLE+    ++R Y+RK+ D + PP  +   D   S +RK  + +  ++ E+++++GI PEW+  H++L   +D  G     +KWR L Y+  S E     +   +  +++   HR+L++                  ++           K E  P+YL         TLHPYQ+EG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R +IR+ +  +++            KK+    FHVLLT+YELI +D   L  I+W  LIVDEAHRLKNN++K F+ L  Y++ +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF + P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +++  A +  +G YD  ALI ASGK  +L+KMLK L+E GH+VLIFS MTK+LDLLE  LEH   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF         +N E  D  +I YDD AI++LLDRN+  +++ E   ++   S FK+A+Y    ++   E+  E +    E SV     DYW  LL    +   ++E +    GKG R +K+VNY                   +D   +D D+   + +N    S      DE F     ++++E  R PS+  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  410 SCPHCEKEGIQW----EAKEDNSEGEEILEEVGGDPEEED---DHHMEFCRVCKDGG-----ELLCCDTCPSSYHIHCL-----NPPL----PEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKN-DMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYL----DATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVD---PDYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY-------------------NDGSQEDRDWQDDQSDNQSDYSVASEEGDEDF-----DERSEAPRRPSRKGLRNDKDKPL-----PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRYGMPPQDAFTTQ-WLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1513          

HSP 2 Score: 69.3218 bits (168), Expect = 4.415e-11
Identity = 43/112 (38.39%), Postives = 67/112 (59.82%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1708 FNIADGGFTELHSLWQN--EERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQD-IQNDPRYAILNEPFKG---EMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1813          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Mouse
Match: Chd4 (chromodomain helicase DNA binding protein 4 [Source:MGI Symbol;Acc:MGI:1344380])

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 448/1180 (37.97%), Postives = 651/1180 (55.17%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA--------------IGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD---SHRRKLSELE-VKLHEKYFQWGIDPEWLQPHKVL--GMDDVG---CFVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLIK---------------EITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYL--LSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF--------DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+ +    + K D  +  + L  V    E  D   D   + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ WKW                       P +    R+F + +  MSYW C WVSE+QLE+    ++R Y+RK+ D + PP  +   D   S +RK  + +  ++ E+++++GI PEW+  H++L   +D  G     +KWR L Y+  S E     +   +  +++   HR+L++                  ++           K E  P+YL         TLHPYQ+EG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R +IR+ +  +++            KK+    FHVLLT+YELI +D   L  I+W  LIVDEAHRLKNN++K F+ L  Y++ +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF + P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +++  A +  +G YD  ALI ASGK  +L+KMLK L+E GH+VLIFS MTK+LDLLE  LEH   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF         +N E  D  +I YDD AI++LLDRN+  +++ E   ++   S FK+A+Y    ++   E+  E +    E SV     DYW  LL    +   ++E +    GKG R +K+VNY                   +D   +D D+   + +N    S      DE     D ++++E  R PS+  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  390 SCPHCEKEGIQW----EAKEDNSEGEEILEEVGGDPEEED---DHHMEFCRVCKDGG-----ELLCCDTCPSSYHIHCL-----NPPL----PEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKN-DMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYL----DATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVD---PDYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY-------------------NDGSQEDRDWQDDQSDNQSDYSVASEEGDE-----DFDERSEAPRRPSRKGLRNDKDKPL-----PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRYGMPPQDAFTTQ-WLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1493          

HSP 2 Score: 69.3218 bits (168), Expect = 4.444e-11
Identity = 43/112 (38.39%), Postives = 67/112 (59.82%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1688 FNIADGGFTELHSLWQN--EERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQD-IQNDPRYAILNEPFKG---EMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1793          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Mouse
Match: Chd4 (chromodomain helicase DNA binding protein 4 [Source:MGI Symbol;Acc:MGI:1344380])

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 448/1180 (37.97%), Postives = 651/1180 (55.17%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA--------------IGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD---SHRRKLSELE-VKLHEKYFQWGIDPEWLQPHKVL--GMDDVG---CFVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLIK---------------EITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYL--LSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF--------DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+ +    + K D  +  + L  V    E  D   D   + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ WKW                       P +    R+F + +  MSYW C WVSE+QLE+    ++R Y+RK+ D + PP  +   D   S +RK  + +  ++ E+++++GI PEW+  H++L   +D  G     +KWR L Y+  S E     +   +  +++   HR+L++                  ++           K E  P+YL         TLHPYQ+EG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R +IR+ +  +++            KK+    FHVLLT+YELI +D   L  I+W  LIVDEAHRLKNN++K F+ L  Y++ +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF + P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +++  A +  +G YD  ALI ASGK  +L+KMLK L+E GH+VLIFS MTK+LDLLE  LEH   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF         +N E  D  +I YDD AI++LLDRN+  +++ E   ++   S FK+A+Y    ++   E+  E +    E SV     DYW  LL    +   ++E +    GKG R +K+VNY                   +D   +D D+   + +N    S      DE     D ++++E  R PS+  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  403 SCPHCEKEGIQW----EAKEDNSEGEEILEEVGGDPEEED---DHHMEFCRVCKDGG-----ELLCCDTCPSSYHIHCL-----NPPL----PEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKN-DMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYL----DATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVD---PDYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY-------------------NDGSQEDRDWQDDQSDNQSDYSVASEEGDE-----DFDERSEAPRRPSRKGLRNDKDKPL-----PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRYGMPPQDAFTTQ-WLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1506          

HSP 2 Score: 69.3218 bits (168), Expect = 4.563e-11
Identity = 43/112 (38.39%), Postives = 67/112 (59.82%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1701 FNIADGGFTELHSLWQN--EERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQD-IQNDPRYAILNEPFKG---EMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1806          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Mouse
Match: Chd5 (chromodomain helicase DNA binding protein 5 [Source:MGI Symbol;Acc:MGI:3036258])

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 445/1174 (37.90%), Postives = 641/1174 (54.60%), Query Frame = 1
Query:  391 KICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA----IGVTNPD-KYFMP----------REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSH------RRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGMD-----DVGCFVKWRGLGYEFVSTE-PLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLEESPDYLGPPST-----------------TAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEET--EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF------------------------------------------DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ W+W        +G+  P+ +  MP          REF + ++ +SYW C WV E+QLE+    +YR Y+RK+ D + PPP +  S         R+    L  K+ E+++++GI PEW+  H++L        D+   +KW+ L Y+  + E     + + + L++A   HR+L+  + + + + +   K  K  +      PP T                     TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q I FLYSLYK+  S+GP+L++ PLST+ NWEREFE WAPDF +V Y GDK++R VIR+ +  +++            KK+    FHVLLT+YELI +D+  L  I W  L+VDEAHRLKNN++K F+ L  Y I+Y++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DISKE+Q+ KL ++L    LRRLK+DVF + P K E I+RVEL+ +QKK+YK ILT+N+EAL+ K  G  V + NI+M L+KCCNHPYL      E     +GSYD  +L+ +SGK  +L+KMLKKL++ GH+VLIFS MTK+LDLLE  LE+   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +KRK+M+T+LVV+        S TK E   I+ FGT++LF                                           +N +  D  +I YDDAAI KLLDRN+  +D+ E   ++   S FK+A+Y    +    E   E+  K +EN    +P DYW  LL    +   ++E +    GKG R +K+VNY                N A  +D +  D      E  D+ S     S++     +   + ++GR  S+  +  DRD K L      P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E   ++  FM +L E      +      GV ++ +    +++RI +  L+  KV ++E +N
Sbjct:  419 EFCRVCKDGG-----ELLCCDACPSSYHLHCL-----NPPL----PEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEPPAPFVVGLPGPEVEPGMPPPRPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKN-DMDEPPPFDYGSGDEDGKSEKRKNKDPLYAKMEERFYRYGIKPEWMMVHRILNHSFDKKGDIHYLIKWKDLPYDQCTWEIDEIDIPYYDNLKQAYWGHRELM--LGEDARLPKRLVKKGKKLKDDKQEKPPDTPIVDPTVKFDKQPWYIDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRSVIRENEFSFEDNAIRGGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKDDVEGMMSQGQRPTTPIPDIQSTKGGSLTAGAKKKHGSTPPGDNKDVEDSSVIHYDDAAISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVREEDGVEEVEREVI-KQEENV---DP-DYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY----------------NDASQEDQEWQD------ELSDNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQLKSDRD-KPL------PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRWGMPPQDAFNSH-WLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVN 1523          

HSP 2 Score: 72.0182 bits (175), Expect = 6.818e-12
Identity = 44/120 (36.67%), Postives = 72/120 (60.00%), Query Frame = 1
Query: 3661 GHFEIDFNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH--WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            G F+  FNI DGGF+E+H+ W    +   RA + +  ++  W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ K N  +++  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1697 GKFKFMFNIADGGFTELHTLW----QNEERAAVSSGKIYEIWHRRHDYWLLAGIVTHGYARWQD-IQNDPRYMILNEPFKS---EIHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAA 1808          
BLAST of Chromodomain helicase DNA binding protein 5 vs. UniProt/SwissProt
Match: sp|Q22516|CHD3_CAEEL (Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans OX=6239 GN=chd-3 PE=2 SV=2)

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 479/1422 (33.68%), Postives = 750/1422 (52.74%), Query Frame = 1
Query:  397 CEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEP--TQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRS----------EAIGVTNPDKYFMP---------REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVL-----GMDDVGCFVKWRGLGYEFVSTEPLTRVTHINGLQEAI-----DRHRKLIKEIT-------------------DKSYVARNKSK-----LTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDM-YYQNKKKNFP-----------TFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLLSSEI--AEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVV---------KSFTKIEFHQIISFGTKDLFDE--------------NNENNDQKIIYDDAAIDKLLDRNR---FTSDNPETSFLDSCFSGFKMAEYQ---FAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETINR--TILEIVTYKIWDIRTISIEDLENLFT------DLGHFEID------------------------------FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKY---IDQIFIDPQYQILFIPLRIANLDLVKDNADIRKCFRNRQ-RLLENALLIEAQIMKVGAACDGYSVDSFSVERLKYYHDLFFNQGNTIHINPSLVNTKPKLTAI-----AQLEMIINDVETNLESFKPISIQHL 4221
            C  CKE+S      +  C  C   YH  C+           +P  T++   +  C RC +     ++  I++W+W+           E    +  D +  P         REF + +  ++YW CEW+SE  +++    L R Y RK +D  +PP  E  S   R        KL E+++Q+G+ PEW+Q H+++             VKW+ L YE  + E     T I   ++AI      R R L  E+                    +    +R K +     L K E  PD++    +     LHPYQLEG+NWLR  +SN  + ILADEMGLGKT+Q+++FLY+L K+  ++GPFLI  PLST+ NWERE E W PDF +V Y GD+++R+VIR+ +  +     +  P            FHVLLT+YE I MD+  LS I+W  L+VDEAHRLKNN++  FK+L++YNI YR+L++GTPLQNNLEELF+LLNF+ P+ F  +  F ++F++ISKE+Q+ KL  +L    LRRLK+DV    P+K+E I+RVEL+ +QKK+YK ILT+N++AL+ K  G +MS  NI+M+L+KCCNHPYL       A + ++G Y+  ALI  +GK  +L+KML+KL++ GH+VLIFS MT +LD+LE   +    +YERIDGS++   RQ+AIDR+N P +   VFLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHRLGQK KVMIYRFVT+ S+EE+I   +K+K+++T+LVV         KS +K E   ++ +GT++LF E              + + N+Q+I++DDAA+D LLDRN+         +  + +   S FK+A Y          + +++  IK  T+E    ++P +YW  LL+   +   ++E+  ++ GKG R +++VNY +++ +  D  + N+     D   D ++Y    GE           +DE +      ++  + +LP                +   +  QI+                 + GF P++R   Y A+M +G+ P+ L +   W    L +K+    + +   FM +L E    +      + GV ++ ++   ++SRI +  ++  KV ++E  N   ++ E     +      S+ +L  +        D+    +D                              FNI DGG++E+HS W++  EK +R   +     W++ HD++LL+++A +GY +Y      I  DP++ I+  P +    D   + AD++  F  R+ +LLE +L+IE Q+ +        S D    +  +++ +L       ++I     N      AI     AQL+ +++D++T++    P +I  +
Sbjct:  331 CRICKETS-----NILLCDTCPSSYHAYCI-----------DPPLTEIPEGEWSCPRCIIPEPAQRIEKILSWRWKEISYPEPLECKEGEEASKDDVFLKPPRKMEPRREREFFVKWKYLAYWQCEWLSETLMDVYFTALVRMYWRK-VDSENPPIFE-ESTLSRHHSDHDPYKLRERFYQYGVKPEWMQIHRIINHLSYAKSQQDYLVKWKELSYEHATWE--RDDTDIANYEDAIIKYWHHRERMLNDEVPRNVQKMIAKQREAKGLGPKEDEVTSRRKKREKIDILKKYEVQPDFI----SETGGNLHPYQLEGINWLRHCWSNGTDAILADEMGLGKTVQSLTFLYTLMKEGHTKGPFLIAAPLSTIINWEREAELWCPDFYVVTYVGDRESRMVIREHEFSFVDGAVRGGPKVSKIKTLENLKFHVLLTSYECINMDKAILSSIDWAALVVDEAHRLKNNQSTFFKNLREYNIQYRVLLTGTPLQNNLEELFHLLNFLAPDRFNQLESFTAEFSEISKEDQIEKLHNLLGPHMLRRLKADVLTGMPSKQELIVRVELSAMQKKYYKNILTRNFDALNVKNGGTQMSLINIIMELKKCCNHPYLFMKACLEAPKLKNGMYEGSALIKNAGKFVLLQKMLRKLKDGGHRVLIFSQMTMMLDILEDFCDVEGYKYERIDGSITGQQRQDAIDRYNAPGAKQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKGSVEERITSVAKKKMLLTHLVVRAGLGAKDGKSMSKTELDDVLRWGTEELFKEEEAPVEGADGEGTSSKKPNEQEIVWDDAAVDFLLDRNKEEEGQDGEKKEHWTNEYLSSFKVATYNTKEADDADDDEDETEVIKEGTEE----QDP-NYWEKLLKHHYE--QDQETELQKLGKGKRVRRQVNYASEN-MGQDWSAQNNQQQEED---DGSEYGSDNGEL--------LQTDEDYEERRRRREERSEKLPP---------------LLAKVNGQIE-----------------VLGFNPRQRKAFYNAVMRWGMPPQDLTQSS-WQVRDLRNKSEKVFKAYSSLFMRHLCE--PVVDNSDSFMDGVPREGLNRQAVLSRIGLMSILRKKVQEFEKFNGEWSMPETREKMLATAAQASVSNLPGMIKIKEEPIDIDETPMDVDQSNITKTEELASEVKVEEEPKAPRLPYKFNICDGGYTELHSLWIN-EEKVARNGKEYEI--WHRRHDFWLLAAVAVYGYGRYQINFQDIMNDPKFSIVNEPFKQTGADPATNFADVKNKFLARRFKLLEQSLVIEEQLRRAAHINKQQSPDQVG-QLAQHFSELEHTADAHVNIARESNNGNRNANAILHKCLAQLDDLLSDLKTDVARL-PATISQV 1669          
BLAST of Chromodomain helicase DNA binding protein 5 vs. UniProt/SwissProt
Match: sp|Q6PDQ2|CHD4_MOUSE (Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus OX=10090 GN=Chd4 PE=1 SV=1)

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 448/1180 (37.97%), Postives = 651/1180 (55.17%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA--------------IGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD---SHRRKLSELE-VKLHEKYFQWGIDPEWLQPHKVL--GMDDVG---CFVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLIK---------------EITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYL--LSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF--------DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+ +    + K D  +  + L  V    E  D   D   + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ WKW                       P +    R+F + +  MSYW C WVSE+QLE+    ++R Y+RK+ D + PP  +   D   S +RK  + +  ++ E+++++GI PEW+  H++L   +D  G     +KWR L Y+  S E     +   +  +++   HR+L++                  ++           K E  P+YL         TLHPYQ+EG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R +IR+ +  +++            KK+    FHVLLT+YELI +D   L  I+W  LIVDEAHRLKNN++K F+ L  Y++ +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF + P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +++  A +  +G YD  ALI ASGK  +L+KMLK L+E GH+VLIFS MTK+LDLLE  LEH   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF         +N E  D  +I YDD AI++LLDRN+  +++ E   ++   S FK+A+Y    ++   E+  E +    E SV     DYW  LL    +   ++E +    GKG R +K+VNY                   +D   +D D+   + +N    S      DE     D ++++E  R PS+  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  403 SCPHCEKEGIQW----EAKEDNSEGEEILEEVGGDPEEED---DHHMEFCRVCKDGG-----ELLCCDTCPSSYHIHCL-----NPPL----PEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKN-DMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYL----DATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVD---PDYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY-------------------NDGSQEDRDWQDDQSDNQSDYSVASEEGDE-----DFDERSEAPRRPSRKGLRNDKDKPL-----PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRYGMPPQDAFTTQ-WLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1506          

HSP 2 Score: 69.3218 bits (168), Expect = 3.192e-10
Identity = 43/112 (38.39%), Postives = 67/112 (59.82%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1701 FNIADGGFTELHSLWQN--EERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQD-IQNDPRYAILNEPFKG---EMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1806          
BLAST of Chromodomain helicase DNA binding protein 5 vs. UniProt/SwissProt
Match: sp|Q14839|CHD4_HUMAN (Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2)

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 448/1180 (37.97%), Postives = 651/1180 (55.17%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA--------------IGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD---SHRRKLSELE-VKLHEKYFQWGIDPEWLQPHKVL--GMDDVG---CFVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLIK---------------EITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYL--LSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF--------DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+ +    + K D  +  + L  V    E  D   D   + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ WKW                       P +    R+F + +  MSYW C WVSE+QLE+    ++R Y+RK+ D + PP  +   D   S +RK  + +  ++ E+++++GI PEW+  H++L   +D  G     +KWR L Y+  S E     +   +  +++   HR+L++                  ++           K E  P+YL         TLHPYQ+EG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R +IR+ +  +++            KK+    FHVLLT+YELI +D   L  I+W  LIVDEAHRLKNN++K F+ L  Y++ +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF + P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +++  A +  +G YD  ALI ASGK  +L+KMLK L+E GH+VLIFS MTK+LDLLE  LEH   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF         +N E  D  +I YDD AI++LLDRN+  +++ E   ++   S FK+A+Y    ++   E+  E +    E SV     DYW  LL    +   ++E +    GKG R +K+VNY                   +D   +D D+   + +N    S      DE     D ++++E  R PS+  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  410 SCPHCEKEGIQW----EAKEDNSEGEEILEEVGGDLEEED---DHHMEFCRVCKDGG-----ELLCCDTCPSSYHIHCL-----NPPL----PEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKN-DMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYL----DATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVD---PDYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY-------------------NDGSQEDRDWQDDQSDNQSDYSVASEEGDE-----DFDERSEAPRRPSRKGLRNDKDKPL-----PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRYGMPPQDAFTTQ-WLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1513          

HSP 2 Score: 69.3218 bits (168), Expect = 3.008e-10
Identity = 43/112 (38.39%), Postives = 67/112 (59.82%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1698 FNIADGGFTELHSLWQN--EERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQD-IQNDPRYAILNEPFKG---EMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1803          
BLAST of Chromodomain helicase DNA binding protein 5 vs. UniProt/SwissProt
Match: sp|Q8TDI0|CHD5_HUMAN (Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens OX=9606 GN=CHD5 PE=1 SV=1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 448/1176 (38.10%), Postives = 641/1176 (54.51%), Query Frame = 1
Query:  391 KICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA----IGVTNPD-KYFMP----------REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSH------RRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGMD-----DVGCFVKWRGLGYEFVSTE-PLTRVTHINGLQEAIDRHRKLI----------------KEITDKSYVARNKS---KLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEET--EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF------------------------------------------DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ W+W        +G+  PD +  +P          REF + ++ +SYW C WV E+QLE+    +YR Y+RK+ D + PPP +  S         R+    L  K+ E+++++GI PEW+  H++L        DV   +KW+ L Y+  + E     + + + L++A   HR+L+                K   DK     +        K ++ P Y+     +   TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q I FLYSLYK+  S+GP+L++ PLST+ NWEREFE WAPDF +V Y GDK++R VIR+ +  +++            KK+    FHVLLT+YELI +D+  L  I W  L+VDEAHRLKNN++K F+ L  Y I+Y++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DISKE+Q+ KL ++L    LRRLK+DVF + P K E I+RVEL+ +QKK+YK ILT+N+EAL+ K  G  V + NI+M L+KCCNHPYL      E     +GSYD  +L+ +SGK  +L+KMLKKL++ GH+VLIFS MTK+LDLLE  LE+   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +KRK+M+T+LVV+        S TK E   I+ FGT++LF                                           +N +  D  +I YDDAAI KLLDRN+  +D+ E   ++   S FK+A+Y    +    E   EI  K +EN    +P DYW  LL    +   ++E +    GKG R +K+VNY                N A  +D +  D      E  D+ S     S++     +   + ++GR  S+  +  DRD K L      P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E   ++  FM +L E      +      GV ++ +    +++RI +  L+  KV ++E +N
Sbjct:  417 EFCRVCKDGG-----ELLCCDACPSSYHLHCL-----NPPL----PEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEPPAPFMVGLPGPDVEPSLPPPKPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKN-DMDEPPPFDYGSGDEDGKSEKRKNKDPLYAKMEERFYRYGIKPEWMMIHRILNHSFDKKGDVHYLIKWKDLPYDQCTWEIDDIDIPYYDNLKQAYWGHRELMLGEDTRLPKRLLKKGKKLRDDKQEKPPDTPIVDPTVKFDKQPWYI----DSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRSVIRENEFSFEDNAIRSGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKDDVEGMMSQGQRPVTPIPDVQSSKGGNLAASAKKKHGSTPPGDNKDVEDSSVIHYDDAAISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVREEDGVEEVEREII-KQEENV---DP-DYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY----------------NDASQEDQEWQD------ELSDNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQLKSDRD-KPL------PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRWGMPPQDAFNSH-WLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVN 1521          

HSP 2 Score: 68.1662 bits (165), Expect = 7.694e-10
Identity = 42/114 (36.84%), Postives = 69/114 (60.53%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH--WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+H+ W    +   RA + +  ++  W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ K N  +++  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1705 FNIADGGFTELHTLW----QNEERAAVSSGKIYDIWHRRHDYWLLAGIVTHGYARWQD-IQNDPRYMILNEPFKS---EVHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAA 1810          
BLAST of Chromodomain helicase DNA binding protein 5 vs. UniProt/SwissProt
Match: sp|A2A8L1|CHD5_MOUSE (Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus OX=10090 GN=Chd5 PE=1 SV=1)

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 445/1174 (37.90%), Postives = 641/1174 (54.60%), Query Frame = 1
Query:  391 KICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA----IGVTNPD-KYFMP----------REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSH------RRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGMD-----DVGCFVKWRGLGYEFVSTE-PLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLEESPDYLGPPST-----------------TAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEET--EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF------------------------------------------DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ W+W        +G+  P+ +  MP          REF + ++ +SYW C WV E+QLE+    +YR Y+RK+ D + PPP +  S         R+    L  K+ E+++++GI PEW+  H++L        D+   +KW+ L Y+  + E     + + + L++A   HR+L+  + + + + +   K  K  +      PP T                     TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q I FLYSLYK+  S+GP+L++ PLST+ NWEREFE WAPDF +V Y GDK++R VIR+ +  +++            KK+    FHVLLT+YELI +D+  L  I W  L+VDEAHRLKNN++K F+ L  Y I+Y++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DISKE+Q+ KL ++L    LRRLK+DVF + P K E I+RVEL+ +QKK+YK ILT+N+EAL+ K  G  V + NI+M L+KCCNHPYL      E     +GSYD  +L+ +SGK  +L+KMLKKL++ GH+VLIFS MTK+LDLLE  LE+   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +KRK+M+T+LVV+        S TK E   I+ FGT++LF                                           +N +  D  +I YDDAAI KLLDRN+  +D+ E   ++   S FK+A+Y    +    E   E+  K +EN    +P DYW  LL    +   ++E +    GKG R +K+VNY                N A  +D +  D      E  D+ S     S++     +   + ++GR  S+  +  DRD K L      P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E   ++  FM +L E      +      GV ++ +    +++RI +  L+  KV ++E +N
Sbjct:  419 EFCRVCKDGG-----ELLCCDACPSSYHLHCL-----NPPL----PEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEPPAPFVVGLPGPEVEPGMPPPRPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKN-DMDEPPPFDYGSGDEDGKSEKRKNKDPLYAKMEERFYRYGIKPEWMMVHRILNHSFDKKGDIHYLIKWKDLPYDQCTWEIDEIDIPYYDNLKQAYWGHRELM--LGEDARLPKRLVKKGKKLKDDKQEKPPDTPIVDPTVKFDKQPWYIDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRSVIRENEFSFEDNAIRGGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKDDVEGMMSQGQRPTTPIPDIQSTKGGSLTAGAKKKHGSTPPGDNKDVEDSSVIHYDDAAISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVREEDGVEEVEREVI-KQEENV---DP-DYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY----------------NDASQEDQEWQD------ELSDNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQLKSDRD-KPL------PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRWGMPPQDAFNSH-WLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVN 1523          

HSP 2 Score: 72.0182 bits (175), Expect = 5.056e-11
Identity = 44/120 (36.67%), Postives = 72/120 (60.00%), Query Frame = 1
Query: 3661 GHFEIDFNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH--WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            G F+  FNI DGGF+E+H+ W    +   RA + +  ++  W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ K N  +++  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1697 GKFKFMFNIADGGFTELHTLW----QNEERAAVSSGKIYEIWHRRHDYWLLAGIVTHGYARWQD-IQNDPRYMILNEPFKS---EIHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAA 1808          
BLAST of Chromodomain helicase DNA binding protein 5 vs. TrEMBL
Match: A0A452GTK8 (Chromodomain helicase DNA binding protein 5 OS=Gopherus agassizii OX=38772 GN=CHD5 PE=4 SV=1)

HSP 1 Score: 741.495 bits (1913), Expect = 0.000e+0
Identity = 500/1292 (38.70%), Postives = 726/1292 (56.19%), Query Frame = 1
Query:  379 DDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAI----GVTNPD-KYFMP----------REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD-----SHRRKLSELE-VKLHEKYFQWGIDPEWLQPHKVLGMD-----DVGCFVKWRGLGYEFVSTE-PLTRVTHINGLQEAIDRHRKLI--KEITDKSYVARNKSKLT--KLEESPDY-LGPPST----------TAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEET--EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLFDENNENNDQK------IIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLT----NDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETINRTILEIVTYKIWDIRTISIEDLENLFTDLGHFEIDFNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH--WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            DD  + C  CK+        +  C  C   YH++CL     +  L   P      +  C RC    L  KV  I+ W WR        G+  PD +  +P          REF + ++ +SYW C WV E+QLE+    +YR Y+RK+ D + PP  +  S      S +RK  +L+ VK+ EKY+++GI PEW+  H++L        DV   +KW+ L Y+  + E     + +   L++    HR+L+   +I     + +   KL   KLE+ P+  +  P+               TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q I FLYSLYK+  S+GP+L++ PLST+ NWEREFE WAPDF +V Y GDK++R VIR+ +  +++            KK+    FHVLLT+YELI +D+  L  I W  L+VDEAHRLKNN++K F+ L  Y I+Y++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DISKE+Q+ KL ++L    LRRLK+DVF + P K E I+RVEL+ +QKK+YK ILT+N+EAL+ K  G  V + NI+M L+KCCNHPYL      E     +GSYD  +L+ +SGK  +L+KMLKKL++ GH+VLIFS MTK+LDLLE  LE+   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +KRK+M+T+LVV+        S TK E   I+ FGT++LF ++ E +++       I YDDAAI KLLDRN+  +D+ E   ++   S FK+A+Y    +  E  +   IK + + +       DYW  LL    +   ++E +    GKG R +K+VNY   D  + D  + +    A       T   +   E  D  S  D  S+ S  +     D E++ E GR  S+  +  DRD K L      P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E   ++  FM +L E      +      GV ++ +    +++RI +  L+  KV + ++      E       +      ++ +N+     +F   FNI DGGF+E+H+ W    +   RA + +  ++  W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ K N  +++  F  R+ +LLE AL+IE Q+ +  
Sbjct:  291 DDHMEFCRACKDGG-----ELLCCDTCPSSYHLHCL-----NPPLPEIPNG----EWLCPRCTCPPLKGKVQRILHWVWREPPAPFLSGLHPPDLELSVPPPKPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKN-DMDEPPAFDYGSGDEDSKSEKRKNKDLQYVKMEEKYYRYGIKPEWMMIHRILNHSFDKKGDVHYLIKWKDLPYDQCTWEIDEIDIPYYENLKQMYWNHRELMLGDDIQPPKRLNKKGRKLKEEKLEKPPETPIVDPTVKFDKQPWYIDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRAVIRENEFSFEDNAIRSGKKVFRMKKEAQIKFHVLLTSYELITIDQAVLGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGNSLVKSSGKLMLLQKMLKKLRDGGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKDDVEGDNKDVEDSSVIHYDDAAISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVREEDGEEVEREIIKQEENVD------PDYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY--NDASQEDQGTTS----AFRSTAPLTSVPLCSAEWQDELS--DNQSEYSIGSEDEDEDFEERPEGGRRQSRRQLKSDRD-KPL------PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRWGMPPQDAFNSH-WLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLVRKKVEKEQS------ETQQNGEKEEEEDGKKEDKNM-----NFRFMFNIADGGFTELHTLW----QNEERAAVSSGKIYDIWHRRHDYWLLAGIVTHGYARWQD-IQNDPRYVILNEPFKS---EIHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAA 1509          
BLAST of Chromodomain helicase DNA binding protein 5 vs. TrEMBL
Match: A0A1D1V5T4 (Uncharacterized protein OS=Ramazzottius varieornatus OX=947166 GN=RvY_07595-1 PE=4 SV=1)

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 482/1310 (36.79%), Postives = 721/1310 (55.04%), Query Frame = 1
Query:  448 CLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGVTN----PDK--YFMP---REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGM-----DDVGCFVKWRGLGYEFVSTEPLTRVTHINGLQEAIDRHRKLIKEI-------------------TDKSYVARNKSKLTKLEE---SPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNK-----------KKNFPT-FHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMSNIVMQLRKCCNHPYLLSSEIAEETE--DGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKS-----FTKIEFHQIISFGTKDLFDEN---------------NENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFA----VDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFR-QKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKK----AENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETINRT-----ILEIVTYKIWDI--------------RTISIED------LENLFTDLGHFEID----------------FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH-WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            C  C   +HV CL     +  LK  P      +  C RC    L  ++S I+ W+W ++  G+ +    P+K     P   REFL+ Y ++SYW CEW+ E++L++++P L R Y RK+ + + PP +E +S++ + +  E E +L E+++++GI PEW+Q H+V+         +   +KWR L Y+  S E       I   ++  + +  L  +                    T K +   +K      ++    PDY+    T     LHPYQLEG+NWLR S+++  +TILADEMGLGKTIQ I FLYSLYK+   RGPF++T PLST+ NWEREFE WAPDF +V Y GD+D+R VIR+ +  ++             +  F   F+VLLT+ E+I +D+  L  I+W+IL+VDEAHRLKNN++K F+ L +Y+++Y++L++GTPLQNNLEELF+LLNF+ P+ F D+  F + F D+SKE+QV KL E++    LRRLK+DV    PTK E I+RV++  +QKK+YK ILT+NYEAL  K  G  + N++M+L+KCCNHPYL+S+  AE  +  +G+Y+  ALI + GK ++L+ MLK+L+  GH+VLIFS MT++LD+LE  LE    +YERIDG ++ + RQ+AIDRFN+P +   VFLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ  KVMIYR+VTR S+EE++ + +K+K+M+T+LVV+S     F+K E   I+ FGT++LF ++                E+    I YD+ A+ KLLDR++      E   L+   S FK+A Y        ++A+ E S    NK DEN    +P  YW  LL    +    +E +    GKG R + ++VNY              SA+G   + P   +++      P +    D NS  S  + D +++      NG  P +F   R  ++     + P LT             +    F ++ GF  ++R      ++ +G+ P    +   W    L  K+      +   FM +L E    L        GV ++ +    I+SR+ IN LI  KV ++E +N       IL  +  +   +              +  S+E+      ++    D    E+                 FNI DGGF+E+H+ W  Y E+  RA  +NP    WN+ HDY+LLS IA HGY ++   +  DP++ ++  P +       K N A+++  F  R+ +LLE AL++E QI +  
Sbjct:  500 CDGCPSAFHVECL-----NPPLKDIPDG----EWLCPRCTCPPLRARISKILHWRW-TDPSGLADLPIDPEKGPKRRPPKVREFLVKYEHLSYWHCEWLPEIRLDVNQPQLIRNYFRKN-NMDEPPALEEISEAKKVRHHE-EAELEERFYRYGIRPEWIQIHRVINHRQQRGGSMQYLIKWRELNYDQCSWEDEEMEVQIPDFKKYTEAYWDLRTQAEASVADRGKKKKKDKDDGKTPKRWQFPDKPTCDPRKQHNTQPDYI----TATGGELHPYQLEGLNWLRYSWAHGTDTILADEMGLGKTIQTIVFLYSLYKEGQCRGPFIVTAPLSTLINWEREFEMWAPDFYVVTYIGDRDSRAVIRENEFSFERGAIRGGAKASRVRDGFEVKFNVLLTSMEMISVDQPTLGSIDWKILVVDEAHRLKNNQSKFFRVLNQYHLDYKLLLTGTPLQNNLEELFHLLNFLSPDRFNDMVSFTNDFADLSKEDQVAKLHEIMGNHLLRRLKADVLQGMPTKSEFIVRVDMNAMQKKYYKFILTRNYEALHTKGGGSSLINVMMELKKCCNHPYLISAAQAEAPKLPNGAYEGNALIKSCGKLELLQAMLKQLKREGHRVLIFSQMTRVLDILEDFLEFEGYKYERIDGQITGSQRQDAIDRFNEPGAQQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQANKVMIYRYVTRASVEERVTQVAKKKMMLTHLVVRSGAGGNFSKKELDDILKFGTEELFKDDTVEGSTTDGANKEGTGESAGGAIHYDEEAVAKLLDRSQEGIQEKEVG-LNEYLSSFKVATYNIVNPTEEEEADEETSQPDTNKDDENQAAADPV-YWERLLRHHFE--QHQEDLSRSLGKGKRLRTRRVNY--------------SADGTATQGPSTENWEDFNAAGPSNAPGSDDNSSYSSPSEDNDEEDDEFGANGEGPKEFAHGRKGRKKDEGPLPPLLTK------------IPGGGFDVL-GFNTRQRKSFLNGVLRYGI-PSEDDQSWQWNIRDLRSKSERHFRAYASMFMRHLCE--PGLDNAETFSDGVPREGLSRHHILSRVGINSLIRKKVKEFEMVNGKHSQPEILAAMQKQAQQVAADAEKREREKAEKKEASVEEGRSPDKMDESEDDKPDVEVKEDKPVIDVPKTKTRFMFNICDGGFTELHTLW--YNEE--RAIKQNPEHEIWNRKHDYWLLSGIAYHGYGQFA-SLQNDPRFNLVNEPFKTNASHSAKVNFAELKNKFMQRRFKLLEQALIVEEQIRRAA 1754          
BLAST of Chromodomain helicase DNA binding protein 5 vs. TrEMBL
Match: D5LXF2 (Chromodomain helicase DNA-binding protein 4 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 719.539 bits (1856), Expect = 0.000e+0
Identity = 452/1186 (38.11%), Postives = 665/1186 (56.07%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEP-TQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGV-------------TNP----DKYFMP-REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVE---ILSDSHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGM-----DDVGCFVKWRGLGYEFVSTEPLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLT--------------------KLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLL--SSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK---------SFTKIEFHQIISFGTKDLFDENNEN-NDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTE--NPAD--YWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNY-ITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+V   R+       D+++    ++   + ++E  D+  + C +CK+        +  C  C   YH  CL          + P +++      C RC    L  KV  I+TW+W     G               NP     +   P REF + + ++SYW+CEW++E+QL++  P L R Y +K+ D + PP  E         R K+++    L E++++W + PEW+Q H+++       + +   +KWR L Y+  + E L     +  ++  ++ +  + K  T   Y  + K+                       ++ + PDY+          LH YQLEG+NWLR S+ N ++TILADEMGLGKTIQ I+FLYSLYK+  S+GPFL+  PLST+ NWEREFEFWAPDF +V Y GDKD+R V+R+ +  Y+             ++     FHVLLT+YELI +D+  L  I+WE+L+VDEAHRLKNN++K F+ L  Y INY++L++GTPLQNNLEELF+LL+FM P  F D+ GFL +F DISKEEQV +L E+L +  LRRLK+DV  D P+K E I+RVEL+P+Q KFYK ILT+N++ALS K  G ++S  NIVM L+KCCNHPYL    S+ A +  +G+Y+  ALI ASGK ++L KML KL+  GH+VLIFS MT+LLD+LE  +++M  ++ERIDG+V+   RQ++IDRFN P+S+S VFLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ  KVMIYRFVTRN++EE++ + +K+K+M+T+LVV+         S +K E  +I+ FGT+DLF E +EN +D KI+YDD AID+L+DR++   +  E    D   S FK+A Y         +D  +   +T    + +  +PAD  YW  LL    +   ++E + +  GKG R +K+VNY  TQ   + D + N++          D+D++       +     D +  E   T   +++ +  ++P                            LV  N  L    F +      ++R     A+M +GL P        W    L  K+   M  ++  F+ +L E     T  +     V ++ +    +++RI I  ++  KV ++E IN
Sbjct:  405 SCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGG-----DLICCAKCPVSYHPECL----------YPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKN-DMDEPPAPEDGSTYKGRAREKVADPH-NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSIPKEIILKKIPPEHPTTDLKKRMSKQPDYI----EETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDY-LSSFKVAHYSKREVSVNEDDEDDDDEETRGEIIKQDLDPADPTYWEKLLRHHYE--QDQEDLSKSLGKGKRIRKQVNYSATQ---QEDDNWNDAVG--------DSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPL--------------------------LVKVNGQLEVLGFNV------RQRKAFINAVMRYGLPPMDFINSH-WMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYS--DQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKIN 1520          
BLAST of Chromodomain helicase DNA binding protein 5 vs. TrEMBL
Match: A0A5G3H735 (HNF1 homeobox B OS=Xenopus tropicalis OX=8364 GN=hnf1b PE=4 SV=1)

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 503/1335 (37.68%), Postives = 719/1335 (53.86%), Query Frame = 1
Query:  391 KICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGVTNP---DKYFMP---------REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSH------RRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGMD-----DVGCFVKWRGLGYEFVSTE-PLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNK-SKLTKLEESPDYLGP---PST----------TAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEET--EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLFDENNENNDQK------IIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETINR-----------------------------------TILEIVTYKIW------------DIRT-------ISIEDLENLFTDL-GHFEIDFNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH--WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ W WR        P   D    P         REF + ++ +SYW C W  E+QLE+    ++R Y+RK+ D + PPP +  S         RR    L  K+ EK++++GI PEW+  H+++        DV   +KW+ L Y+  + E  +  +     +++A   HR+L+     +    +NK +K  KLE+ P  L P   P+           +   TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q I FLYSLYK+  S+GP+L++ PLST+ NWEREFE WAP+F +V Y GDKD+R VIR+ +  +++            KK+    FHVLLT+YELI +D   L  I W  L+VDEAHRLKNN++K F+ L  Y I+Y++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DISKE+Q+ KL ++L    LRRLK+DVF + P K E I+RVEL+ +QKK+YK ILT+N+EAL+ K  G  V + NI+M L+KCCNHPYL      E     +GSYD  +L+ +SGK  +L+KMLKKL++ GH+VLIFS MTK+LDLLE  LE+   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +KRK+M+T+LVV+        S TK E   I+ FGT++LF ++ E +++       I YDDAAI KLLDRN+  +++ E   ++   S FK+A+Y    +    E   EI  K +EN    +P DYW  LL    +   ++E +    GKG R +K+VNY                N A  +D   ++Y +                       D E+K E GR  S+  +  DRD K L      P L  ++   +              + GF  ++R     A+M +G+ P+     + W    L  KT  E   ++  FM +L E      +      GV ++ +    +++RI +  L+  K   Y+ +N                                    T L I   +IW            +  T       I  ED E    D  G F+  FNI DGGF+E+H+ W    +   RA + +  ++  W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ K N  +++  F  R+ +LLE AL+IE Q+ +  
Sbjct:  310 EFCRVCKDGG-----ELLCCDTCPSSYHLHCL-----NPPL----PEIPNGEWLCPRCTCPPLKGKVQRILHWVWREPPPPSGFPVDIDPLMPPPKPVEGIPEREFFVKWAGLSYWHCSWAKELQLELYHTVMFRNYQRKN-DMDDPPPYDYGSGDEEGKSEKRRNKDPLYAKMEEKFYRYGIKPEWMMIHRIMNHSFDKKGDVHYLIKWKDLPYDQCTWEIDIIDIPDYENMKQAYWDHRELMLGEDARPLRFKNKKTKDEKLEKPP--LAPIVDPTVKFDKQPWYIDSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPEFYVVTYTGDKDSRAVIRENEFSFEDNAIKSGKKVFRMKKEAQIKFHVLLTSYELITIDHAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLDGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGNSLVKSSGKLMLLQKMLKKLKDGGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKDDVEGDNKDVEDSSVIHYDDAAISKLLDRNQDATEDTEIQNMNEYLSSFKVAQYVVREEDGVEEVEREII-KQEENV---DP-DYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY----------------NDASQEDQGASEYSVG----------------SEDEDEDFEEKPEGGRRQSRRQLKSDRD-KPL------PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRWGMPPQDAFNSN-WLVRDLRGKTEKEFRAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLVRKKGEIYKHLNARSVHANAEREEKESPVSKQLGQEKASMQQECILWVTFLFINNNRIWFTGEDDKPDEKEECETHQNGENDIKQEDDEGKKEDKNGKFKFMFNIADGGFTELHTLW----QNEERAAISSGKIYDIWHRRHDYWLLAGIVTHGYARWQD-IQNDPRYLILNEPFKS---EIHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAA 1557          
BLAST of Chromodomain helicase DNA binding protein 5 vs. TrEMBL
Match: A0A5G3IST5 (HNF1 homeobox B OS=Xenopus tropicalis OX=8364 GN=hnf1b PE=4 SV=1)

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 503/1335 (37.68%), Postives = 719/1335 (53.86%), Query Frame = 1
Query:  391 KICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGVTNP---DKYFMP---------REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSH------RRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGMD-----DVGCFVKWRGLGYEFVSTE-PLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNK-SKLTKLEESPDYLGP---PST----------TAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEET--EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLFDENNENNDQK------IIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETINR-----------------------------------TILEIVTYKIW------------DIRT-------ISIEDLENLFTDL-GHFEIDFNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH--WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  KV  I+ W WR        P   D    P         REF + ++ +SYW C W  E+QLE+    ++R Y+RK+ D + PPP +  S         RR    L  K+ EK++++GI PEW+  H+++        DV   +KW+ L Y+  + E  +  +     +++A   HR+L+     +    +NK +K  KLE+ P  L P   P+           +   TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q I FLYSLYK+  S+GP+L++ PLST+ NWEREFE WAP+F +V Y GDKD+R VIR+ +  +++            KK+    FHVLLT+YELI +D   L  I W  L+VDEAHRLKNN++K F+ L  Y I+Y++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DISKE+Q+ KL ++L    LRRLK+DVF + P K E I+RVEL+ +QKK+YK ILT+N+EAL+ K  G  V + NI+M L+KCCNHPYL      E     +GSYD  +L+ +SGK  +L+KMLKKL++ GH+VLIFS MTK+LDLLE  LE+   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +KRK+M+T+LVV+        S TK E   I+ FGT++LF ++ E +++       I YDDAAI KLLDRN+  +++ E   ++   S FK+A+Y    +    E   EI  K +EN    +P DYW  LL    +   ++E +    GKG R +K+VNY                N A  +D   ++Y +                       D E+K E GR  S+  +  DRD K L      P L  ++   +              + GF  ++R     A+M +G+ P+     + W    L  KT  E   ++  FM +L E      +      GV ++ +    +++RI +  L+  K   Y+ +N                                    T L I   +IW            +  T       I  ED E    D  G F+  FNI DGGF+E+H+ W    +   RA + +  ++  W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ K N  +++  F  R+ +LLE AL+IE Q+ +  
Sbjct:  314 EFCRVCKDGG-----ELLCCDTCPSSYHLHCL-----NPPL----PEIPNGEWLCPRCTCPPLKGKVQRILHWVWREPPPPSGFPVDIDPLMPPPKPVEGIPEREFFVKWAGLSYWHCSWAKELQLELYHTVMFRNYQRKN-DMDDPPPYDYGSGDEEGKSEKRRNKDPLYAKMEEKFYRYGIKPEWMMIHRIMNHSFDKKGDVHYLIKWKDLPYDQCTWEIDIIDIPDYENMKQAYWDHRELMLGEDARPLRFKNKKTKDEKLEKPP--LAPIVDPTVKFDKQPWYIDSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPEFYVVTYTGDKDSRAVIRENEFSFEDNAIKSGKKVFRMKKEAQIKFHVLLTSYELITIDHAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLDGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGNSLVKSSGKLMLLQKMLKKLKDGGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKDDVEGDNKDVEDSSVIHYDDAAISKLLDRNQDATEDTEIQNMNEYLSSFKVAQYVVREEDGVEEVEREII-KQEENV---DP-DYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY----------------NDASQEDQGASEYSVG----------------SEDEDEDFEEKPEGGRRQSRRQLKSDRD-KPL------PPLLARVGGNIE-------------VLGFNARQRKAFLNAIMRWGMPPQDAFNSN-WLVRDLRGKTEKEFRAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLVRKKGEIYKHLNARSVHANAEREEKESPVSKQLGQEKASMQQECILWVTFLFINNNRIWFTGEDDKPDEKEECETHQNGENDIKQEDDEGKKEDKNGKFKFMFNIADGGFTELHTLW----QNEERAAISSGKIYDIWHRRHDYWLLAGIVTHGYARWQD-IQNDPRYLILNEPFKS---EIHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAA 1561          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Cavefish
Match: chd4a (chromodomain helicase DNA binding protein 4a [Source:ZFIN;Acc:ZDB-GENE-041111-187])

HSP 1 Score: 696.041 bits (1795), Expect = 0.000e+0
Identity = 437/1136 (38.47%), Postives = 637/1136 (56.07%), Query Frame = 1
Query:  379 DDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA----------IGVTNPDKYFMP----REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDS------HRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLG-----MDDVGCFVKWRGLGYEFVSTE-PLTRVTHINGLQEAIDRHRKLI---KEITDKSYVARNKSK-------------LTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYL--LSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF-----DENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            D   + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    L  K   I+TW+W              +    PD   +     REF + + NMSYW C WVSE+QLE+    ++R Y+RK+ D + PPP++   +        R+    +  ++ EK++++GI  EW+  H++L       ++    +KWR L Y+  + E     +      +     HR+L+   +   +K    + KSK               K +  P+YL         TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R VIR+ +  +++            KK+    FHVLLT+YELI +D   L  I+W  L+VDEAHRLKNN++K F+ L  Y + +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF   P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +++  A +  +G YD  AL  +SGK  +L KML+KL+E GH+VLIFS MTK+LDLLE  LE+   +YERIDG ++   RQ AIDRFN P ++  VFLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVT+ S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF      EN E +   I YDD AID+LLDRN+  +D+ E   ++   S FK+A+Y   V K E ++  E++ +  +   + +P DYW  LL    +   ++E +    GKG R +K+VNY        +  S    +   D+    +DY ++  E            DE F     E+   N R P++  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  373 DHHMEFCRVCKDGG-----ELLCCDSCPSSYHIHCL-----NPPL----PEIPNGEWICPRCTCPSLKGKPQKILTWRWGDPPPPTPVPRPPDLAADAPDPAPLAGRPEREFFVKWQNMSYWHCSWVSELQLELHCQVMFRNYQRKN-DMDEPPPIDFGGEGDEDKSEKRKNKDPIYAQMEEKFYRFGIKMEWMMIHRILNHSVDKKNNCHYLIKWRDLAYDQATWELEDMEIPEFEAYKLQYWNHRELMMGDEGKPNKRLKVKGKSKRLDRPPENPVVDPTIKFDRQPEYL----DATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLVVDEAHRLKNNQSKFFRVLNNYPLQHKLLLTGTPLQNNLEELFHLLNFLTPERFSNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKFILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALTKSSGKLLLLHKMLRKLKEGGHRVLIFSQMTKMLDLLEDFLENEGYKYERIDGGITGAMRQEAIDRFNAPGALQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEGEGENKEEDSSVIHYDDKAIDRLLDRNQDATDDTELQSMNEYLSSFKVAQY---VVKDEEDEEEEVQREIIKQEESVDP-DYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY--------NDGSQEDRDWQDDQSDGQSDYSVASEE-----------GDEDF----DERAEANSRRPNRKGLRNDKDKPL-----PPLLARVGGNIE-------------VLGFNARQRKAFLNAVMRYGMPPQDAFTTQ-WLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1439          

HSP 2 Score: 63.929 bits (154), Expect = 1.462e-9
Identity = 41/112 (36.61%), Postives = 65/112 (58.04%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I  HGY ++ D I  D ++ IL  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1589 FNIADGGFTELHSLWQN--EERAATVTKKTNEIWHRRHDYWLLAGIIQHGYARWQD-IQNDVKFAILNEPFKG---EMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1694          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Cavefish
Match: ENSAMXT00000010902.2 (pep primary_assembly:Astyanax_mexicanus-2.0:10:25098839:25126456:1 gene:ENSAMXG00000010614.2 transcript:ENSAMXT00000010902.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 434/1136 (38.20%), Postives = 626/1136 (55.11%), Query Frame = 1
Query:  391 KICEKCKESSLSLDNRMTGCLICMKYYHVNCL--LLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGVTNPDKYFM---------------PREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDS------HRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLG-----MDDVGCFVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLT-----------------KLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEETE--DGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF-----DENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            + C  CK+        +  C  C   YH++CL   L D           +   +  C RC  + L  KV  ++TW+W  EA       +                   REF + + NMSYW C WV E+QLE++   ++R ++RK+ D   PP ++  ++        R+       ++ +++ ++G+  EWL  H++L       ++V   +KWR L Y+    E     +      ++    HR+L+  I D+    +   K+                  K +  PDYL     +   TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R VIR+ +  ++             KK+    FHVLLT+YELI +D+  L  I+W  L+VDEAHRLKNN++K F+ L  Y + +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF   P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +   E  +  +G Y+  AL  +SGK  +L KML+KL+E GH+VLIFS MTK+LDLLE  LE+   +YERIDG V+   RQ AIDRFN P +   VFLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ RKVMIYRFVT+ S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF      EN E +   I YDD AI +LLDRN+  +++ E   ++   S FK+A+Y    +  E +   EI  +  E SV     DYW  LL    +   ++E +    GKG R +K VNY        +  S    +   D+  + +DY ++  E            DE F     E+   N R PS+  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  352 EFCRVCKDGG-----ELLCCDTCPSSYHLHCLNPPLPD-----------IPNGEWICPRCRSLPLKGKVQKVLTWRW-GEAPPPMPVPRPPDLPADAPDPPPMIGRKEREFFVKWCNMSYWHCSWVQELQLELNCQVMFRNFQRKT-DMEEPPILDFGAEGDEDKSIKRKSKDPFYARMDDEFGRYGVKLEWLLIHRILNHSVDKKNNVHYLIKWRDLPYDQSCWESEDMEIPDYETYKQQYWNHRELM--IGDEGRPGKKLKKVKVRKIEKPPTNPVVDPTIKFDRQPDYL----DSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFTFEGNAIRGGKKASKMKKEAAVKFHVLLTSYELITIDQAILGSIDWACLVVDEAHRLKNNQSKFFRVLNNYPLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKYILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPTAATEAPKMPNGMYEGGALTKSSGKLMLLCKMLRKLKEGGHRVLIFSQMTKMLDLLEDFLENEGYKYERIDGGVTGVMRQEAIDRFNAPGAPQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNRKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKAGSMSKQELDDILKFGTEELFKDEIRGENKEEDSSVIHYDDQAISRLLDRNQDATEDTELQSMNEYLSSFKVAQYVVKDEDEEEDVDREIIKQ--EESVD---PDYWEKLLRHHYE--QQQEDLARHLGKGKRPRKPVNY--------NDCSQEERDWQDDQSDNQSDYSVASEE-----------GDEDF----DERSEANNRRPSRKGLRNDKDKPL-----PPLLARVGGNIE-------------VLGFNARQRKAFLNAVMRYGMPPQDAFTTQ-WLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1412          

HSP 2 Score: 69.707 bits (169), Expect = 2.838e-11
Identity = 42/112 (37.50%), Postives = 66/112 (58.93%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I  HGY ++ D +  DP+Y IL  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1562 FNIADGGFTELHSLWQN--EERAATVTKKTYEIWHRRHDYWLLAGIIQHGYARWQD-VQNDPRYAILNQPFKG---EMSRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1667          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Cavefish
Match: chd5 (chromodomain helicase DNA binding protein 5 [Source:ZFIN;Acc:ZDB-GENE-120314-2])

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 410/931 (44.04%), Postives = 555/931 (59.61%), Query Frame = 1
Query:  391 KICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA---------------IGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILS-----DSHRRKLSELE-VKLHEKYFQWGIDPEWLQPHKVLGMD-----DVGCFVKWRGLGYEFVSTEPLT-RVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLEESPDYLGPPST-----------------TAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNK-----------KKNFPT-FHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEET--EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLFDENNENNDQK--IIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSN 2973
            + C  CK+        +  C  C   YH++CL     +  L   P      +  C RC    L  KV  I+ W W                   I    P K    R   + ++ +SYW C WV+E+QLE+    +YR Y+RK+ D + PPP +  S     ++ +RK  + E   + E+++++GI PEW+  H++L        DV   +KWR L Y+  + E     V      ++A   HR+ +     +  V R K K  K EE      PP T                     TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q I FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPDF +V Y GDKD+R VIR+ +  +++            KK+ P  FHVLLT+YELI +D+  L  I W  L+VDEAHRLKNN++K F+ L  Y I Y++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DISKE+Q+ KL ++L    LRRLK+DVF + P K E I+RVEL+P+QKK+YK ILT+N+EAL+ K  G  V + NI+M L+KCCNHPYL      E     +GSYD   L+ +SGK  +L+KMLKKL++ GH+VLIFS MTK+LDLLE  LE    +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVTR S+EE+I + +KRK+M+T+LVV+        S +K E   I+ FGT++LF ++ E  ++   I YDD AI KLLDR++  +++ E   ++   S FK+A+Y    +  E E   EI  K +EN    +P DYW  LL    +   ++E +    GKG R +K+VNY          H+N
Sbjct:  234 EFCRVCKDGG-----ELLCCDTCPSSYHIHCL-----NPPLPEIPNG----EWLCPRCMCPPLKGKVQRILHWMWGDPPLPPEAPPTQDGEKTDILAKPPLKGRPERLLFVKWAGLSYWHCSWVNELQLELYHTVMYRNYQRKN-DMDEPPPYDYGSGEEELNNEKRKSKDPEYAAMEERFYRYGIKPEWMIIHRILNHSFDKDGDVHYLIKWRDLPYDQCTWEVDDFDVPEYEPFKQAYWDHREQMLGEDLRPLVVR-KGKRPK-EEVKRKEAPPETPVVDPTIKFDQQPWYINATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKDSRAVIRENEFTFEDSAVKSGRKVFRMKKDTPVKFHVLLTSYELITIDQAILGSIGWACLVVDEAHRLKNNQSKFFRILNGYKIYYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLDGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGNLLVKSSGKLTLLQKMLKKLKDEGHRVLIFSQMTKMLDLLEDFLEFEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDDVEAIEEGNVIHYDDNAISKLLDRSQDATEDTEIQNMNEYLSSFKVAQYVVQEEDREEEVQREII-KQEENV---DP-DYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNYNDTSQEDQGKHTN 1140          

HSP 2 Score: 67.0106 bits (162), Expect = 2.004e-10
Identity = 41/114 (35.96%), Postives = 68/114 (59.65%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH--WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+H+ W    +   R  + +  ++  W++ HDY+LL+ I +HGY ++ D I  DP+Y IL  P +    ++ K N  +++  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1428 FNIADGGFTELHTLW----QNEERIAVSSGKMYEIWHRRHDYWLLAGIVTHGYARWQD-IQNDPRYAILNEPFKT---EMNKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAA 1533          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Cavefish
Match: chd2 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:103032281])

HSP 1 Score: 418.698 bits (1075), Expect = 5.476e-121
Identity = 262/649 (40.37%), Postives = 382/649 (58.86%), Query Frame = 1
Query:  940 FVKWRGLGYEFVSTEPLTRVTHINGLQEAID--RHRKLIKEITDKS-YVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLLSSEIAEETEDGSYDVP-----ALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------------------SFTKIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKT 2796
              KW GL Y   + E    ++     Q  +D    R   K +  K   V + + +   L++ P Y+G         L  YQL+GVNWL  S+    + ILADEMGLGKTIQ ISFL  L+      GPFL+ VPLST+ +W+REF  WAPD  +V Y GD  +R  IRD +  +Q  K+    F+ LLTTYE++  D+  L +INW  L VDEAHRLKN+++ L+K+L  +  N+R+L++GTPLQN+L+EL++LL+F+ P+ F     F  +     ++     L ++L+   LRR+K DV    P K EQI+RV+++  QK+FYK ILT+NY+ALS    G      NIVM+L+KCCNH +L+     ++ EDG  + P      L+  SGK  +L K+L +L+E G++VL+FS M ++LD+L   L      ++R+DGS+    R+ A+D FN   S    FLLST+AGGLGINL+SADTV I+D+DWNPQND+QA +RAHR+GQK++V IYR VT+ ++EE+I+E +K+K+++ +LV++                     F K E   I+ FG ++LF E      +    D   ID++L        +  +S  D   S FK+A   F +D    E++ E++ KT
Sbjct:  383 LCKWMGLPYAECTWEDGALIS--KKFQSCVDSFNSRNSSKTVPSKECKVLKQRPRFVALKKQPSYIG----GENLELRDYQLDGVNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLLVVPLSTLTSWQREFCTWAPDMNVVVYLGDVLSRKTIRDYEWIHQQSKR--IKFNALLTTYEILLKDKSVLGNINWAFLGVDEAHRLKNDDSLLYKTLIDFRSNHRLLITGTPLQNSLKELWSLLHFLMPDKFESWEDFEDEHGK-GRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVDMSAQQKQFYKWILTRNYKALSKGTRGSSSGFLNIVMELKKCCNHGFLI-----KQPEDGDGETPLERLQILVRGSGKLVLLDKLLTRLKERGNRVLVFSQMVRMLDILADYLTIKHYPFQRLDGSIKGEIRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTVLDNGSGNSNSNPFNKEELTAILKFGAEELFKEPEGEESEPQEMD---IDEILRLAETRESDQGSSATDELLSQFKVA--NFTMD----ENTPELEGKT 1008          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Cavefish
Match: chd2 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:103032281])

HSP 1 Score: 418.313 bits (1074), Expect = 8.447e-121
Identity = 262/649 (40.37%), Postives = 382/649 (58.86%), Query Frame = 1
Query:  940 FVKWRGLGYEFVSTEPLTRVTHINGLQEAID--RHRKLIKEITDKS-YVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLLSSEIAEETEDGSYDVP-----ALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------------------SFTKIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKT 2796
              KW GL Y   + E    ++     Q  +D    R   K +  K   V + + +   L++ P Y+G         L  YQL+GVNWL  S+    + ILADEMGLGKTIQ ISFL  L+      GPFL+ VPLST+ +W+REF  WAPD  +V Y GD  +R  IRD +  +Q  K+    F+ LLTTYE++  D+  L +INW  L VDEAHRLKN+++ L+K+L  +  N+R+L++GTPLQN+L+EL++LL+F+ P+ F     F  +     ++     L ++L+   LRR+K DV    P K EQI+RV+++  QK+FYK ILT+NY+ALS    G      NIVM+L+KCCNH +L+     ++ EDG  + P      L+  SGK  +L K+L +L+E G++VL+FS M ++LD+L   L      ++R+DGS+    R+ A+D FN   S    FLLST+AGGLGINL+SADTV I+D+DWNPQND+QA +RAHR+GQK++V IYR VT+ ++EE+I+E +K+K+++ +LV++                     F K E   I+ FG ++LF E      +    D   ID++L        +  +S  D   S FK+A   F +D    E++ E++ KT
Sbjct:  423 LCKWMGLPYAECTWEDGALIS--KKFQSCVDSFNSRNSSKTVPSKECKVLKQRPRFVALKKQPSYIG----GENLELRDYQLDGVNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLLVVPLSTLTSWQREFCTWAPDMNVVVYLGDVLSRKTIRDYEWIHQQSKR--IKFNALLTTYEILLKDKSVLGNINWAFLGVDEAHRLKNDDSLLYKTLIDFRSNHRLLITGTPLQNSLKELWSLLHFLMPDKFESWEDFEDEHGK-GRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVDMSAQQKQFYKWILTRNYKALSKGTRGSSSGFLNIVMELKKCCNHGFLI-----KQPEDGDGETPLERLQILVRGSGKLVLLDKLLTRLKERGNRVLVFSQMVRMLDILADYLTIKHYPFQRLDGSIKGEIRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTVLDNGSGNSNSNPFNKEELTAILKFGAEELFKEPEGEESEPQEMD---IDEILRLAETRESDQGSSATDELLSQFKVA--NFTMD----ENTPELEGKT 1048          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004254.1 (pep scaffold:Pmarinus_7.0:GL484668:1435:12215:1 gene:ENSPMAG00000003871.1 transcript:ENSPMAT00000004254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 391.349 bits (1004), Expect = 5.325e-122
Identity = 221/482 (45.85%), Postives = 316/482 (65.56%), Query Frame = 1
Query: 1219 NTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALS----GKFSGVKMSNIVMQLRKCCNHPYLLSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKS--------------------FTKIEFHQIISFGTKDLF 2592
            + ILADEMGLGKTIQ ISFL  ++      GPFL+ VPLST+ +W+REF  WAP+  +V Y GD  +R VIR+ +  +Q  KK    F+ L+TTYE++  D+  L  +NW  L VDEAHRLKN+++ L+KSL ++  N R+L++GTPLQN+L+EL++LL+F+ P+ F     F    +    +   + L + L+   LRR+K DV    P K EQI+RVE+TP QK +YK ILT+N++ALS    G  SG    NI+M+L+KCCNH YL+     +E  D    + +L+ +SGK  +L K+L +L+E+GH+VLIFS M ++LD+L   L      ++R+DGS+ +  R+ A+D FN   S    FLLST+AGGLGINL+SADTV I+D+DWNPQND+QA +RAHR+GQK++V IYR VTR ++EE I+E +K+K+++ +LV++                     F K E   I+ FG ++LF
Sbjct:    5 SVILADEMGLGKTIQTISFLSYMFHSHQVYGPFLLVVPLSTVTSWQREFATWAPEMNVVVYLGDMSSRNVIREYEWIHQQTKK--LKFNALVTTYEILLKDKTVLGAVNWAFLGVDEAHRLKNDDSLLYKSLIEFKTNVRLLITGTPLQNSLKELWSLLHFIMPDKFSAWEDF-DAVHGSGSDNGYVSLHKELEPFLLRRVKKDVERSLPAKVEQILRVEMTPQQKHYYKWILTRNFKALSKGTRGSTSG--FLNIMMELKKCCNHCYLIKLP-EDENVDKHDALQSLVRSSGKLILLDKLLCRLRETGHRVLIFSQMVRMLDILADYLAMKHFPFQRLDGSIKNEQRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTRGTVEEDIIERAKKKMVLDHLVIQRMDTTGKTVLQKGSAPSSSTPFNKEELASILKFGAEELF 480          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006729.1 (pep scaffold:Pmarinus_7.0:GL476370:400098:484196:-1 gene:ENSPMAG00000006035.1 transcript:ENSPMAT00000006729.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 370.163 bits (949), Expect = 6.926e-111
Identity = 258/671 (38.45%), Postives = 369/671 (54.99%), Query Frame = 1
Query:  667 EFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGMD-----DVG-----CFVKWRGLGYEFVSTEPLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLEESPDYLGPPSTTAKA----------TLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKK----NFPTFHVLLTTYE-----LIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNIN-YRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALS---GKFSGVKMSNIVMQLRKCCNHPYLLSSE----IAEETEDGSYDVP-----ALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKSFTKIE 2553
            E+ + Y N SY  CEW S  QLE  +  +++  KR  +               +R    +  +L E+ F    +P++++  ++L +      D G       VKW  L YE  + E          L+E ID+ R       D+    R +  + K  E P    PP    K            L  YQLEGVNWL  ++ N  N ILADEMGLGKTIQ+I+FL  +    V  GPFL+  PLST+ NWEREF  W  D   V ++G   +R +I+  +MY ++ +      F  ++  +TT       L  + +G  S I     + + + R+      L   L+ Y +  +++L++GTPLQN +EELF+LLNF+EP  F   S FL +F  +  EEQV KLQ +LK   LRRLK DV  +   K+E II VELT +QKK+Y+ IL +N+  L+   G+ +   + N +M+LRKCCNHPYL++      +++  E    DVP     A++ A+GK  ++ K+L +L+E GHKVLIFS M + LD+LE  L      YERIDG V    RQ AIDRF  P+S   VFLL T+AGGLGINL++ADT  I+D+DWNPQND+QA +R HR+GQ + V +YR +TRNS E ++ + +  KL +   V++S +  E
Sbjct:   87 EYYVKYKNYSYLHCEWASMQQLE-RDKRIHQKIKRFWI---------------KRAQMNIFAQLDEEAF----NPDYVEVDRILDVSHCSDPDTGEPVTYYLVKWCSLPYEDSTWE----------LKEDIDQTR------IDEFEALRARKHVCKRAERP----PPKAWKKLEDSREYKNGNQLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSIAFLQDVALAGV-HGPFLVIAPLSTIANWEREFRTWT-DMNAVVFHGSVASRQMIQQYEMYTRDAQSKNIVGFCFYYEKVTTVHSHLKVLPELHKGLFSCI----YLSEHSTRVITRRVLLMHLLELYGVEEHKVLLTGTPLQNTVEELFSLLNFLEPARFPSESSFLQEFGQLKSEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILERNFSFLAKGAGQANLPNLMNTMMELRKCCNHPYLINGAEEKILSDFREAHGADVPDFYLQAMVQAAGKLVLIDKLLPRLREGGHKVLIFSQMVRCLDILEDYLVQKRYPYERIDGRVRGNMRQVAIDRFCKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDRAVLQSMSGRE 711          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 358.607 bits (919), Expect = 1.458e-108
Identity = 222/566 (39.22%), Postives = 330/566 (58.30%), Query Frame = 1
Query: 1033 RHRKLIKEITDKSYVARNKSK--LTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPTFH--VLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQF--NDISKEEQVI-KLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEAL--SGKFSGVKMSNIVMQLRKCCNHPYLLSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKS------------FTKIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDRN 2667
            RHR+  +E  ++      KS   L + EESP Y+         T+  YQ+ G+NWL S Y N IN ILADEMGLGKT+Q IS L  +   +   GP ++ VP ST+ NW  EFE W P    V   GDKD R+            +   P     V +T+YE+I  ++      NW  L++DEAHR+KN ++KL + ++++    R+L++GTPLQNNL EL++LLNF+ P+ F     F S F  N+   ++Q++ +L  +L+   LRR+K+DV    P K+E  I + L+ +Q+++Y  IL K+ + L  +GK   +++ NI+MQLRKCCNHPYL     AE     + D   ++  SGK  +L K+L KL E G +VLIFS MT+++D+LE        +Y R+DG      RQ +I  FN P+S   VF+LST+AGGLGINL++AD V +YD+DWNPQ D+QA+ RAHR+GQK+ V ++RF+T +++E++I+E ++ KL + ++V++               K E  Q+I +G   +F              D  ID +L+R 
Sbjct:   74 RHRRTEQEEDEELLSESRKSANALLRFEESPSYV------KCGTMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMAEFERWVPSLRAVCLIGDKDHRV---------SASQPIVPPIEWDVCVTSYEMIIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADTFTSWFDTNNCFGDQQLVERLHMVLRPFLLRRIKADVEKSLPPKKECKIYIGLSKMQREWYTKILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDG--AEPGPPYTTDT-HIVINSGKMVVLDKLLPKLHEQGSRVLIFSQMTRMMDILEDYCMWRGYEYCRLDGQTPHEDRQVSIASFNAPDSSKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKVVRVFRFITESTVEDRIVERAEMKLRLDSIVIQQGPGRLVDQVANKLGKDEMLQMIRYGATQVFSSKESQ------ITDEDIDVILERG 615          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 363.614 bits (932), Expect = 6.530e-107
Identity = 220/541 (40.67%), Postives = 326/541 (60.26%), Query Frame = 1
Query: 1099 TKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQF---NDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEAL--SGKFSGVKMSNIVMQLRKCCNHPYLLSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKS-------------FTKIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDRN 2667
            T+ EESP Y+         T+  YQ+ G+NWL S Y N IN ILADEMGLGKT+Q IS L  +   +  +GP ++ VP ST+ NW  EFE W P    V   G+KD R+   D+++Y + +      + V +T+YE++  ++      NW  L++DEAHR+KN ++KL   ++++    R+L++GTPLQNNL EL++LLNF+ P+ F     F S F   N +  +E V +L  +L+   LRR+K+DV      K+E  I + L+ +Q+++Y  IL K+ + L  +GK   +++ NI+MQLRKCCNHPYL     AE     + D   L+  SGK  +L K+L KLQE G +VL+FS MT++LD+LE         Y R+DG      RQ AI  +N PNS   +F+LST+AGGLGINL++AD V +YD+DWNPQ D+QA+ RAHR+GQ ++V ++RF+T N++EE+I+E ++ KL + ++V++                K E  Q+I  G   +F     + D +I   D  ID +L+R 
Sbjct:  123 TRFEESPTYV------KGGTMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHHRNIQGPHMVLVPKSTLHNWMNEFERWVPSLRAVCLIGNKDQRVAT-DENVYTKRE------WDVCVTSYEIVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSDIVREFKSTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSSEDFDSWFDTNNCLGDQELVERLHMVLRPFLLRRIKADVEKSLQPKKEVKIYIGLSKMQREWYTKILMKDIDILNSAGKMDKLRLLNILMQLRKCCNHPYLFDG--AEPGPPYTTDT-HLVNNSGKMVVLDKLLPKLQEQGSRVLLFSQMTRMLDILEDYCMWKGYGYCRLDGQTPHEDRQEAIAAYNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKRVRVFRFLTENTVEERIVERAEMKLRLDSIVIQQVCAGRLIDQQANKLGKDEMLQMIRHGATHVF----ASRDSEIT--DEEIDVVLERG 641          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006707.1 (pep scaffold:Pmarinus_7.0:GL476370:281119:459539:-1 gene:ENSPMAG00000006035.1 transcript:ENSPMAT00000006707.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 333.183 bits (853), Expect = 2.755e-93
Identity = 215/530 (40.57%), Postives = 311/530 (58.68%), Query Frame = 1
Query: 1240 MGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKK-------KNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNIN-YRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALS---GKFSGVKMSNIVMQLRKCCNHPYLLSSE----IAEETEDGSYDVP-----ALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKS-------------FTKIEFHQIISFGT-KDLFDENNENNDQKIIYDDAAIDKLLDRNRFT----SDNPETSFLDSCF 2715
            MGLGKTIQ+I+FL  +    V  GPFL+  PLST+ NWEREF  W  D   V ++G   +R +I+  +MY ++ +       ++   +       ++I    G L H  + + I+ E H+    +  L  S+  YNI  +++L++GTPLQN +EELF+LLNF+EP  F   S FL +F  +  EEQV KLQ +LK   LRRLK DV  +   K+E II VELT +QKK+Y+ IL +N+  L+   G+ +   + N +M+LRKCCNHPYL++      +++  E    DVP     A++ A+GK  ++ K+L +L+E GHKVLIFS M + LD+LE  L      YERIDG V    RQ AIDRF  P+S   VFLL T+AGGLGINL++ADT  I+D+DWNPQND+QA +R HR+GQ + V +YR +TRNS E ++ + +  KL +   V++S              +K E   ++  G    + DE +E +  K   +D  ID++L R   T    S+   ++F  + F
Sbjct:    1 MGLGKTIQSIAFLQDVALAGV-HGPFLVIAPLSTIANWEREFRTWT-DMNAVVFHGSVASRQMIQQYEMYTRDAQGRRGRIIRSAVVWAACQILVKIILWGSGRLIHELFSLSILPELHKDSYFDCNLVHSVTIYNIEEHKVLLTGTPLQNTVEELFSLLNFLEPARFPSESSFLQEFGQLKSEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILERNFSFLAKGAGQANLPNLMNTMMELRKCCNHPYLINGAEEKILSDFREAHGADVPDFYLQAMVQAAGKLVLIDKLLPRLREGGHKVLIFSQMVRCLDILEDYLVQKRYPYERIDGRVRGNMRQVAIDRFCKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDRAVLQSMSGRENTTNGVQQMSKKEIEDLLRKGAYGAIMDEEDEGS--KFCEED--IDQILQRRTHTITIESEGKGSTFAKASF 524          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Yeast
Match: CHD1 (Chromatin remodeler that regulates various aspects of transcription; acts in in conjunction with Isw1b to regulate chromatin structure and maintain chromatin integrity during transcription elongation by RNAP II by preventing trans-histone exchange over coding regions; contains a chromo domain, a helicase domain and a DNA-binding domain; component of both the SAGA and SLIK complexes [Source:SGD;Acc:S000000966])

HSP 1 Score: 390.193 bits (1001), Expect = 5.131e-113
Identity = 247/657 (37.60%), Postives = 377/657 (57.38%), Query Frame = 1
Query:  919 GMDDVGCFVKWRGLGYEFVSTEPLTRVTHINGLQEAIDRHRKLIKEITD-KSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPT--FHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLLSS---EIAEETEDGSYD----VPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK-------SFTKI------EFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDR--NRFTSDNPETSFL--DSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDE 2802
            G   +   VKWR L Y+  + E  T +  +   Q    ++R+  K +    S     + +  KL   P ++          L  +QL G+NW+   +S   N ILADEMGLGKT+Q ++F+  L   +   GP +I VPLSTM  W   FE WAPD   + Y G++ +R  IR+ + Y   + K   T  F+VLLTTYE I  D   L  I W+ + VDEAHRLKN E+ L++SL  + +  RML++GTPLQNN++EL  L+NF+ P  F        +  D  +EE +  L   ++   LRRLK DV    P+K E+I+RVEL+ +Q ++YK ILTKNY AL+    G   S  NI+ +L+K  NHPYL  +    + ++  DG       +  LI +SGK  +L ++L +L++ GH+VLIFS M ++LD+L   L    I ++R+DG+V S  R+ +ID FN P+S   VFLLST+AGGLGINL +ADTV I+D+DWNPQ D+QA++RAHR+GQK  VM+YR V+++++EE+++E +++K+++   ++         +TK       E   I+ FG  ++F     +N +K+  +D  +D +L+   +  T+ +   S L  +     F++ +Y+  +D  +     E+K   DE
Sbjct:  301 GTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPRFEKLSVQPPFI------KGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTAT--DNQKKL--EDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADIDWDDIIPEEELKKLQDE 947          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Yeast
Match: ISW2 (ATP-dependent DNA translocase involved in chromatin remodeling; ATPase component that, with Itc1p, forms a complex required for repression of a-specific genes, INO1, and early meiotic genes during mitotic growth; the Isw2 complex exhibits basal levels of chromatin binding throughout the genome as well as target-specific chromatin interactions; targeted by Ume6p- and Sua7p-dependent DNA looping to many loci genome-wide [Source:SGD;Acc:S000005831])

HSP 1 Score: 377.096 bits (967), Expect = 1.142e-110
Identity = 231/529 (43.67%), Postives = 333/529 (62.95%), Query Frame = 1
Query: 1135 PSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARI-VIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQF--NDISKEEQVI--KLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSG----KFSGVKMSNIVMQLRKCCNHPYLLSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKSFT----------KIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDR 2664
            PS      L  YQ++G+NWL S + N ++ ILADEMGLGKT+Q ISFL  L   K   GPFLI VP ST+ NW REF  W P+  ++  +GDKD R  ++R+  +  +        F VL+T+YE++  ++  L  + W+ +++DEAHR+KN ++ L + ++ +    R+L++GTPLQNNL EL+ LLNF+ P+ FGD   F   F  N+  ++++++  +L  +L    LRR+K+DV      K E  + V +T +Q ++YK +L K+ +A++G    +    ++ NIVMQLRKCCNHPYL   E AE     + D   LI  SGK  IL K+LK+L+E G +VLIFS M++LLD+LE      D +Y RIDGS S   R  AID +N PNS   VFLL+T+AGGLGINL +ADTV ++D+DWNPQ D+QA+ RAHR+GQK++V +YRFVT N+IEEK++E + +KL +  LV++  T          K +   +I FG K++F    E    K+   DA ID +L +
Sbjct:  176 PSFVKSGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQIEGPFLIIVPKSTLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIILEAR--------FDVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDIFGDSELFDEWFEQNNSEQDQEIVIQQLHSVLNPFLLRRVKADVEKSLLPKIETNVYVGMTDMQIQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYLF--EGAEPGPPYTTD-EHLIFNSGKMIILDKLLKRLKEKGSRVLIFSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRLDQLVIQQGTGKKTASLGNSKDDLLDMIQFGAKNMF----EKKASKVTV-DADIDDILKK 688          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Yeast
Match: ISW1 (ATPase subunit of imitation-switch (ISWI) class chromatin remodelers; with Ioc3p forms Isw1a complex involved in repression of transcription initiation; with Ioc2p and Ioc4p forms Isw1b complex involved in regulation of transcription elongation; Isw1b recruited to ORFs by H3K36 methylation and acts with Chd1p to prevent trans-histone exchange over coding regions; Isw1p import into nucleus depends on C-terminal bipartite nuclear targeting signal KRIR X19 KKAK [Source:SGD;Acc:S000000449])

HSP 1 Score: 355.91 bits (912), Expect = 2.872e-103
Identity = 230/524 (43.89%), Postives = 319/524 (60.88%), Query Frame = 1
Query: 1102 KLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFL-YSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQ----VIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSG----KFSGVKMSNIVMQLRKCCNHPYLLSSEIAEETEDGSYDVPA------LIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVV------------KSFTKIEFHQIISFGTKDLF 2592
            +  ESP Y+          L PYQ++GVNWL S + N I  ILADEMGLGKT+Q ISFL Y  Y +K+  GPFL+  P ST+ NW RE   W PD       GDK+ R  +  K +   +       F V++ +YE+I  ++  L  INWE +I+DEAHR+KN E+ L + L+++    R+L++GTPLQNNL EL+ LLNF+ P+ F D   F   F+  S EE     V +L  +L+   LRR+KSDV      K+E  + V ++ +QKK+YK IL K+ +A++G    K S  ++ NI+MQLRKCCNHPYL          DG+   P       L+  + K  +L K+LKKL+E G +VLIFS M++LLD+LE      + +Y RIDGS +   R  AID +N P+S   VFLL+T+AGGLGINL+SAD V +YD+DWNPQ D+QA+ RAHR+GQK++V ++R VT NS+EEKI+E + +KL +  LV+            K+ +K     +I  G  D+F
Sbjct:  184 QFRESPAYVN-------GQLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIP-GPFLVIAPKSTLNNWLREINRWTPDVNAFILQGDKEERAELIQKKLLGCD-------FDVVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDAQDFDDWFSSESTEEDQDKIVKQLHTVLQPFLLRRIKSDVETSLLPKKELNLYVGMSSMQKKWYKKILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCNHPYLF---------DGAEPGPPYTTDEHLVYNAAKLQVLDKLLKKLKEEGSRVLIFSQMSRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGINLTSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLDQLVIQQNRTSLKKKENKADSKDALLSMIQHGAADVF 683          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Yeast
Match: SNF2 (Catalytic subunit of the SWI/SNF chromatin remodeling complex; involved in transcriptional regulation; contains DNA-stimulated ATPase activity; functions interdependently in transcriptional activation with Snf5p and Snf6p [Source:SGD;Acc:S000005816])

HSP 1 Score: 331.257 bits (848), Expect = 7.126e-93
Identity = 196/491 (39.92%), Postives = 301/491 (61.30%), Query Frame = 1
Query: 1135 PSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKK-YNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFN------------DISKEEQVI---KLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEAL------SGKFSGVK-MSNIVMQLRKCCNHPYLLSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKS 2538
            PS     TL  YQ++G+ W+ S ++N++N ILADEMGLGKTIQ IS L  LY+ K  RGP+L+ VPLST+ NW  EF  WAP    + + G  + R          +  K     F V+LTT+E I  +   LS + W  +I+DE HR+KN ++KL  +L   Y+ +YR++++GTPLQNNL EL+ LLNF+ P  F  +  F   FN            ++S+EE ++   +L ++L+   LRRLK DV  + P K E++++ +++ LQ+  Y+ +L   Y  L      + K  G++  +N +MQL+K CNHP++   E+ ++          +   +GK ++L ++L KL+ +GH+VLIF  MT+++D++E  L +++I+Y R+DG   S  R   +  FN P+S  + F+LST+AGGLG+NL +ADTV I+D DWNP  D+QA  RAHR+GQK +V I R +T NS+EE I+E + +KL +   V+++
Sbjct:  759 PSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNERKA--------KQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQML--KYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVFE-EVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKLDIDGKVIQA 1238          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Yeast
Match: STH1 (ATPase component of the RSC chromatin remodeling complex; required for expression of early meiotic genes; promotes base excision repair in chromatin; essential helicase-related protein homologous to Snf2p [Source:SGD;Acc:S000001388])

HSP 1 Score: 323.168 bits (827), Expect = 5.554e-91
Identity = 202/493 (40.97%), Postives = 290/493 (58.82%), Query Frame = 1
Query: 1135 PSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKL-FKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFN----DISKEEQ-----------VIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELT-------PLQKKFYKIILTKNYE-ALSGKFSGVKMSNIVMQLRKCCNHPYLLSS-EIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKS 2538
            PS     TL  YQL G+ W+ S Y+N++N ILADEMGLGKTIQ+IS +  LY+ K   GPFL+ VPLST+ NW  EFE WAP    + Y G  + R       + +Q +  NF    VLLTTYE I  D+  LS  +W  +I+DE HR+KN ++KL F     Y    R++++GTPLQNNL EL+ LLNF+ P  F     F   FN    +   +E+           + +L ++L+   LRRLK +V  D P K E++I+ +L+           K   + +    E A  G   G  ++N +MQLRK CNHP++    E       G+ D+  L   +GK ++L ++L K + SGH+VL+F  MT+++D++E  L   D++Y R+DGS  +  R   ++ FN P+S    FLLST+AGGLG+NL +ADTV I+D DWNP  D+QA  RAHR+GQK +V I R +T +S+EE I+E + +KL +   V+++
Sbjct:  462 PSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQR-----HSLQHQIRVGNF---DVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHNALFVGAGTEGATKGGIKG--LNNKIMQLRKICNHPFVFDEVEGVVNPSRGNSDL--LFRVAGKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKVIQA 942          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Nematostella
Match: EDO39585 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9J4])

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 372/858 (43.36%), Postives = 515/858 (60.02%), Query Frame = 1
Query:  397 CEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLG---CIRCAVVHLCYKVSSIVTWKWRSEAI----------GVTNPDKY---FMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKS-----------------LDFNSPPPVEILSDSHRRKLSELEVKLHEKYFQWGIDPEWLQ-----PHKVLGMDDVGCFVKWRGLGYEFVSTE-PLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIR------DKDMY------YQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFS-GVKMSNIVMQLRKCCNHPYLLSSEI--AEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKS---------FTKIEFHQIISFGTKDLFDENN----ENNDQKII-YDDAAIDKLLDRNRFTSDNP---ETSFLDSCFSGFKMAEYQFAVDK 2757
            C  CK+       ++  C  C   YH+ CL+              ++R   G   C RC    L  KV  I+ W+W +  I          G    DK    +  REF + +   SYW C W++E+Q+EI  P ++RA+ RK+                  D   P P      +  +   + E  L  +++++G++PEWLQ      H+VL       FVKWR + Y   + E P   + H                     SY+   +    + E+ P YL          LH YQ EG+NWLR S++   NTILADEMGLGKTIQ ISFLYSL K+  S+GPFL++ PLST+ NWEREFEFWAPD  +V Y GDK++R  IR      D+D +      Y+ KK +   FHVLLT+YEL+ +D   L  I+W +L+VDEAHRLKNN++K F++L  YNI Y++L++GTPLQNNLEEL+NLL F++P  F + + FL++F++++KE+Q+ KL ++L    LRRLK+DV    P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ K +  V + N++M+L+KCCNHPYL  +    A+ T+ G Y+  +L  ASGK  +L KMLKKL+E GH+VLIFS MT++LDLLE  LE    +YERIDGSV+  +RQ AIDRFN P S +  FLLST+AGGLGINL++ADTVFIYD+DWNP NDIQA SRAHR+GQ  KVMIYRFVTR+S+EE+I + +K+K+M+T+LVV+           +K E   I+ FGT +LF +++    E+ D  +  YDD AI  LLDR++   ++    E    +   + FK+  Y F +DK
Sbjct:   14 CRVCKDGG-----QLLCCDKCPMAYHLKCLI------------PPMMRVPTGEWKCPRCQSEPLKGKVERILHWRWVTLPIPPDYQALTPEGEEQKDKTVDTYTTREFFVKWREKSYWHCSWITELQIEIQHPEMFRAFSRKNDMDEPPPLSDDDDEDSIEDGQHPSPT-----AKSKAKEQDENNLEARFYRYGVNPEWLQINRIMNHRVLKDGSEEFFVKWRDVPYSQSTWESPDDPINH-------------------QISYINCKE----RYEKQPAYL----DETGGKLHEYQREGLNWLRFSWAQGTNTILADEMGLGKTIQTISFLYSLMKEGHSQGPFLVSAPLSTLVNWEREFEFWAPDMYVVTYAGDKESRATIRNFDFSFDEDAFKSGLKAYKLKKDSPVKFHVLLTSYELVSIDSASLQSIDWAMLVVDEAHRLKNNQSKFFRTLSDYNIGYKLLLTGTPLQNNLEELWNLLFFLDPVEFNNKNNFLTEFDNVAKEDQIKKLHDILGPHMLRRLKADVLKGIPSKSELIVRVELSPMQKKYYKWILTRNFEALNTKGAQQVSLLNVMMELKKCCNHPYLFHAAALEAKRTQSGGYEPNSLTEASGKLMLLVKMLKKLREQGHRVLIFSQMTRMLDLLEDFLEGHGYKYERIDGSVNGAARQEAIDRFNAPTSQAFCFLLSTRAGGLGINLATADTVFIYDSDWNPHNDIQAFSRAHRIGQNNKVMIYRFVTRSSVEERITQVAKKKMMLTHLVVRPGLGSNKATIMSKSELDDILKFGTSELFKDDDTKDGESGDSVVFHYDDKAITSLLDRDQQVMEDEVKDEPMLANEYLASFKVLSYFFLLDK 822          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Nematostella
Match: EDO47298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMN4])

HSP 1 Score: 428.713 bits (1101), Expect = 1.248e-126
Identity = 295/732 (40.30%), Postives = 412/732 (56.28%), Query Frame = 1
Query:  667 EFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKR-KSLDFNSPPPVEILSDSHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVL----GMDD------VGCFVKWRGLGYEFVSTEPLTRVTHINGLQEAIDRHRKLIKE--ITDKSYVARN-KSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKK----NFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVK----MSNIVMQLRKCCNHPYLLSSEIAEE---TEDGSYDVP----ALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKS------------FTKIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDRN----RFTSDNPETSFLDSCFSGFK 2727
            EF + + N SY   EW +  +L   +  +    KR K+   N+               SE+E    E  F    +P++++  +VL    GMD           VKWR L YE  + E    V      +  I +  KL +   +  + +  R    +  KLE SP Y        + TL  YQLEGVNWL   + N  N+ILADEMGLGKTIQ+I+FL+ + +  + RGP L+  PLST+ NW+REFE W  D   V Y+G   +R +I++ + YY+++      N   F VL+TTYE+I  D   LS + W  +I+DEAHRLKN   KL + L    + +R+L++GTPLQNN+EELF+LLNF+EP+ F     FL +F D+  E QV KL+++LK   LRRLK DV  +   KEE II VELT +QKKFY+ IL +N+  L+   S       + N +M+LRKCCNHP+L++   AEE    E G   V     A+I ASGK  ++ K+L KL+  GHKVL+FS M + LD+LE  L HM   YERIDG V    RQ AIDRF+ P+S   VFLL T+AGGLGINL++ADTV I+D+DWNPQND+QA +R HR+GQ R V +YR +TRNS E ++ + +  KL +   V++S             +K E   ++  G      E  E+ND    + +  ID++L+R     +  S+   ++F  + F   K
Sbjct:   81 EFHVKFKNYSYLHAEWATAEKLAKGDKRVQMKIKRYKAKQLNTAA-----------FFSEME----EDSF----NPDYVEVDRVLDMSTGMDHNTGEPITHFLVKWRSLPYEESTWEVKADVE-----ESKIQQFYKLREPPPLPQRQFRPRPYPHEWHKLETSPVY------KDENTLREYQLEGVNWLMFCWCNRQNSILADEMGLGKTIQSIAFLFEMQRYGI-RGPNLVIAPLSTISNWQREFESWN-DINAVVYHGSASSRHLIQEYEFYYRDEHGQPIPNIFKFQVLITTYEIIIADNMQLSTVPWRAVIIDEAHRLKNRNCKLLEGLNNLQMEHRILLTGTPLQNNVEELFSLLNFLEPSQFPSQGAFLMEFGDLKTESQVDKLKQLLKPMMLRRLKEDVEKNIAPKEETIIEVELTTVQKKFYRAILERNFAFLAKGTSSTANVPNLMNTMMELRKCCNHPFLITG--AEEKILQEYGREHVDRHTHAMIEASGKLVLIHKLLPKLKLGGHKVLVFSQMVRCLDILEDYLVHMKYPYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTVIIFDSDWNPQNDLQAQARCHRIGQSRSVKVYRLITRNSYEREMFDRASMKLGLDKAVLQSMNTKENAGNNGQMSKREIEDLLKRGAYGAIME--EDNDDASKFCEEDIDQILERRTQVIQVESEGKGSTFAKASFVSAK 776          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Nematostella
Match: EDO40761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S667])

HSP 1 Score: 340.887 bits (873), Expect = 1.839e-98
Identity = 207/510 (40.59%), Postives = 313/510 (61.37%), Query Frame = 1
Query: 1033 RHRKLIKEITDKSYVARNKSKLTKL---EESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIV-IRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFN--DISKEEQVI-KLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEAL--SGKFSGVKMSNIVMQLRKCCNHPYLLSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK 2535
            RHR+  +E  D+  + + K   T +   EESP+Y+          +  YQ+ G+NWL S Y N IN ILADEMGLGKT+Q IS L  +   +   GP ++  P ST+ NW  EFE W P    V   G+++ R   IRD  +  +        + V +T+YE++  ++       W  +++DEAHR+KN ++KL + +++     R+L++GTPLQNNL EL+ LLNF+ P+ F     F + FN  ++ +E+Q++ +L  +L+   LRRLKSDV      K+E  +   LT +Q+ +Y  IL K+ + +  +GK   +++ NI+MQLRKCCNHPYL     AE     + DV  LI  SGK  +L K+L +L++ G +VLIFS MT+LLD+LE         Y R+DG      RQ  I+ FN P S   +F+LST+AGGLGINL++AD V +YD+DWNPQ D+QA+ RAHR+GQK++V ++RF++ +++EE+I+E ++ KL +  +V++
Sbjct:  106 RHRRTEQE-EDEELLNQTKGAQTSILHFEESPNYI------KGGEMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKNFRNVPGPHMVICPKSTLANWMAEFERWCPSIRAVCLIGNQEQRTAFIRDTMLPGE--------WDVCVTSYEMVIREKAVFKKFAWRYIVIDEAHRIKNEKSKLSEIVRELRSANRLLLTGTPLQNNLHELWALLNFLLPDVFSSSDDFDAWFNSNNLVEEKQLVERLHSVLRPFLLRRLKSDVEKRLLPKKETKVYTGLTKMQRSWYTKILMKDIDVVNGAGKTDKMRLLNILMQLRKCCNHPYLFDG--AEPGPPYTTDV-HLIENSGKMRVLDKLLARLKQEGSRVLIFSQMTRLLDILEDYCLWRQYDYCRLDGQTPHEERQAYINSFNMPGSTKFIFMLSTRAGGLGINLATADIVILYDSDWNPQVDLQAMDRAHRIGQKKQVKVFRFISESTVEERIIERAEMKLRLDAVVIQ 597          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Nematostella
Match: EDO31943 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWF7])

HSP 1 Score: 327.405 bits (838), Expect = 4.512e-95
Identity = 206/509 (40.47%), Postives = 302/509 (59.33%), Query Frame = 1
Query: 1156 TLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFG--DISGFLSQFNDIS--KEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKF-SGVKMSNIVMQLRKCCNHPYLLSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLV------------VKSFTKIEFHQIISFGTKDLFDENNENNDQKIIY 2631
            TL PYQLEGV W+R         IL DEMGLGKTIQ IS L  L +     G FL+  PLS M NW+ E + +     ++   G K+ R + ++K   +Q+ K       VLLT+YE+   +  FL   +W  + VDEAHRLKN+++ L+  L ++  ++ +L++GTP+QNNL+EL++LL+F+ P+ F    +  F + F +++  ++     L ++L    LRR+KS+V +D P K E I+   ++ LQKK+YK IL K+Y+  S    S  K+++I+  LRKC NHPYL      E    G +    LI ASGK   + ++L  L + GHKVL+FS MT++LD+++  L +    YER+DGSV    R  AI  FN+    + +FLLSTKAGG G+NL SADTV   D+D+NPQND+QA +RAHR+GQ R V I R V RN++EE I++ +  K+ +TN V            V S+  +    I+ FG + LF    E+ ++ +IY
Sbjct:   15 TLRPYQLEGVGWMRDCALTGHGCILGDEMGLGKTIQTISVLLLLKRTIKHTGLFLVLSPLSVMANWKNEIKRFTKSLKVLSLIGSKEEREITKNK--LFQDIK----NIDVLLTSYEICLRETSFLQRFHWSAVAVDEAHRLKNSQSLLYTELIQFKYDFSILLTGTPVQNNLKELYSLLSFIAPSIFDLEYVEEFETAFKNLATGRDNTNSDLPQLLSPFLLRRVKSEVMVDLPEKSEVILYAGMSELQKKYYKAILMKDYDIFSTDGPSRNKLNSILTNLRKCVNHPYLFDGVEPEPFALGEH----LITASGKLHAIDQLLSYLYKRGHKVLMFSQMTRMLDIVQDYLGYRGYAYERLDGSVRGEERYIAIKNFNEEQD-NFIFLLSTKAGGQGLNLMSADTVIFVDSDYNPQNDLQAAARAHRIGQTRPVKIIRLVGRNTVEEIILKHADDKMRLTNNVIEGGQVYDSSKIVASYRTLLLANILKFGLEKLF----ESEERYVIY 508          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Nematostella
Match: EDO48116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK66])

HSP 1 Score: 335.88 bits (860), Expect = 3.284e-94
Identity = 224/637 (35.16%), Postives = 347/637 (54.47%), Query Frame = 1
Query: 1135 PSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKK-YNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFN----------DISKEEQVI---KLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYK------IILTKNYEALSGKFSGVK-MSNIVMQLRKCCNHPYL---LSSEIAEET--EDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKSFTKIEFHQIISFGTKDLF-----DENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESV------KEEFGKGFRQKKKVNY 2934
            PS      L  YQL G+ W+ S ++NN+N ILADEMGLGKTIQ I+    L + K   GPFL+ VPLST+ NW+ EFE WAP   +V Y G  + R   R      +  K     F+V+LTTYE +  D+  L+ + W+ ++VDE HR+KN+  KL + L   Y   +R+L++GTPLQN L EL+ LLNF+ P  F  +S F   FN          ++++EE ++   +L ++L+   LRRLK +V    P K E +++ +++ LQ+  Y       ++LT   E       G K + N +MQLRK CNHP++   +   IAE      G    P +  ASGK ++L ++L KL+ + H+VL+F  MT L+ +LE         Y R+DG+  S  R   +  FN  +S   VFLLST+AGGLG+NL +ADTV I+D+DWNP  D+QA  RAHR+GQ+++V + R +T NS+EEKI+  ++ KL V   V+++     F+Q  +   +  F     D  N++++      + A    ++ +    D      +      F++ + +  +++  TE      ++     + +N    W      ++K+ NE E +      ++ F +G RQ+KKV+Y
Sbjct:  638 PSMLVGGRLKEYQLAGLEWMVSLHNNNLNGILADEMGLGKTIQTIALFSYLIEKKRLNGPFLVIVPLSTLSNWQLEFEKWAPSAIVVSYKGSPNMR---RSAGAVLRTGK-----FNVVLTTYEYVMRDKAILAKVRWKYMVVDEGHRMKNHHCKLTQVLNTHYAAQHRILLTGTPLQNRLPELWALLNFLLPTIFKSVSTFEQWFNAPFAMTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVVKCDMSILQRILYNHMYKKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPFMFQHIEESIAEHLGFHGGIVTGPDIYRASGKFELLDRILPKLKRNKHRVLMFCQMTSLMTILEDYFNWKGFPYLRLDGTTKSEDRGQLLSLFNAKDSPYFVFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQEKEVRVLRLMTVNSVEEKILAAARYKLNVDEKVIQAGM---FNQNSTSSERKAFLMALLDTENDDDEAPKSNSNGASSAAMEESEVPDDETVNQMIARSEEEFELYQ-RMDIERRRTEVRDPTTHRRRPRLMADNELPRW------ILKDDNEVERLTWEEEEEKMFARGSRQRKKVDY 1256          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Medaka
Match: ENSORLT00000015622.2 (chromodomain helicase DNA binding protein 4 [Source:NCBI gene;Acc:101170871])

HSP 1 Score: 701.819 bits (1810), Expect = 0.000e+0
Identity = 453/1173 (38.62%), Postives = 658/1173 (56.10%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA----------IGVTNPDKYFM----PREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD------SHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLG-----MDDVGCFVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHR------KLIKEITDKSYVARNKSKLT-KLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNK-----------KKNFPT-FHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEETE--DGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF-----DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+ +  R D   D +  +      + ++E  D +I+     C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    +  KV  ++TW+W              +    PD + +     REF + + NMSYW C WV E+QLE++   ++R Y+RK+ D + PPPV+   +      + R+    L V + E++ ++G+  EWL  H+VL       ++V   +KWR L Y+  + E     +   +  ++    HR       LI + +  S V     + T K +  P+YL     +   TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R VIR+ +  ++             KK+ P  FHVLLT+YELI +D+  L  I W  L+VDEAHRLKNN++K F+ L  Y++ +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF   P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +   E  +  +G Y+  AL  ASGK  +L+KM+KKL+E GH+VL+FS MTK+LDLLE  LE+   +YERIDG V+   RQ AIDRFN P +    FLLST+AGGLGINL+SADTV IYD+DWNP NDIQA SRAHR+GQ RKVMIYRFVT+ S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF     D +N+ +D  +I YDD AI +LLDRN+  +D+ E   ++   S FK+A+Y    +  E ++      K +E+    +P DYW  LL    +   ++E +    GKG R +K VNY                   +D   +D D+   + +N    S      DE F     E+   N R P++  +  DRD K L      P L  ++   +              + GF  ++R     A+M +G+ P+     + W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  312 SCPHCEKEGIQWEARDDLS-DAEGEDDDDRRDEGLEEEDDHHIE----FCRVCKDGG-----ELLCCDTCPSSYHIHCL-----NPPL----PEIPNGEWICPRCKCPPMKGKVQRVITWRWGDPPPPTPVPRPPDLPADAPDPHPLMGRREREFFVKWCNMSYWHCSWVKELQLELNCQVMFRNYQRKT-DMDEPPPVDFGGEGDDDKSTKRKNKDPLFVHMEEEFGRFGVKLEWLMIHRVLNHSVDKKNNVHYLIKWRDLPYDQSTWESEDMDIPEYDPYKQTYWNHRYEEGFISLILKYSKPSKVRFPPYQPTIKFDRQPEYL----DSTGGTLHPYQLEGLNWLRFSWAQATDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEGNAIRGGKKASKMKKDSPVKFHVLLTSYELITIDQAVLGSIEWACLVVDEAHRLKNNQSKFFRLLNNYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKFILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPAAATEAPKLPNGMYEGAALTKASGKLMLLQKMMKKLKEGGHRVLVFSQMTKMLDLLEDFLENEGYKYERIDGGVTGNMRQEAIDRFNAPGAQQFAFLLSTRAGGLGINLASADTVIIYDSDWNPHNDIQAFSRAHRIGQNRKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEIGDGDNKEDDSSVIHYDDQAISRLLDRNQDATDDTEIQSMNEYLSSFKVAQYVVKDEDDEEDEVEREVIKQEESV---DP-DYWEKLLRHHYE--QQQEDLARNLGKGKRTRKPVNY-------------------NDGSQEDRDWQEDQSDNQSDYSVASEEGDEDF----DERSEANARRPNRKGLRNDRD-KPL------PPLLARVGGNIE-------------VLGFNARQRKAFLNAVMRYGMPPQDAFT-NQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1408          

HSP 2 Score: 62.3882 bits (150), Expect = 4.358e-9
Identity = 39/112 (34.82%), Postives = 65/112 (58.04%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I  HGY ++ D +  D ++ I+  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1551 FNIADGGFTELHSLWQN--EERAATVTKKTYEIWHRRHDYWLLAGIIQHGYARWQD-VQNDVRFAIINEPFKG---EMSRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1656          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Medaka
Match: chd4a (chromodomain-helicase-DNA-binding protein 4 [Source:NCBI gene;Acc:101174845])

HSP 1 Score: 700.664 bits (1807), Expect = 0.000e+0
Identity = 457/1178 (38.79%), Postives = 655/1178 (55.60%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKW----------RSEAIGVTNPD----KYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSH-----RRKLSELEVKLHEKYFQWGIDPEWLQPHKVLG-----MDDVGCFVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLI--------KEITDKSYVARNK--------SKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLLSSEIAEETE--DGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF-----DENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+ +  R D    E+D  +         E+ ++  D   + C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    +  KV  I+TW+W          R   +    PD    K    REF   + NMSYW C WVSE+QLE+    ++R Y+RK+ D + PPP++           R+      V L EKY ++GI  EWL  H++L       ++V   +KWR L Y+  + E     +      ++    HR+L+        K+I  K  V R +            K E  PDYL     +   TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R VIR+ +  +++            KK +   FHVLLT+YELI +D   L  I+W  L+VDEAHRLKNN++K F+ L  Y++ +++L++GTPLQNNLEELF+LLNF+ P  F ++  FL +F DI+KE+Q+ KL +ML    LRRLK+DVF   P+K E I+RVEL+P+QKK+YK ILTKN+EAL+ K  G ++S  N+VM L+KCCNHPYL  +   E  +  +G YD  AL  +SGK  +L+KM++KL+E GH+VL+FS MTK+LDLLE  LE+   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ +KVMIYRFVT+ S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF      EN E +   I YDD AID+LLDRN+  +D+ E   ++   S FK+A+Y   V K E E+  E++ +  +   + +P DYW  LL    +   ++E +    GKG R +K+VNY       +D    + A+   D+    +DY ++  E            DE F     E+   N R P++  +  D  +       P L  ++   +              + GF  ++R     A+M +G+ P+       W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  406 SCPHCEKEGIQWEAREDVSDAEEDNGE-------TGEMEED--DHHMEFCRVCKDGG-----ELLCCDSCPSSYHIHCL-----NPPL----PEIPNGEWICPRCTCPPMKGKVQKILTWRWGEPPPPTVVPRPPELASDAPDPPPLKGRAEREFFAKWCNMSYWHCSWVSELQLEMHCQVMFRNYQRKN-DMDEPPPIDFGEGEEDKCVKRKSKDPTYVHLEEKYLRFGIKMEWLMIHRILNHSVDRKNNVHYLIKWRELPYDQATWEAEDMDLPEFEPYKQQYWNHRELMMGDDGRPGKKIKVKGRVKRPERPPENPVVDPTIKFERQPDYL----DSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYIGDKDSRAVIRENEFSFEDNAIRGGKRASRMKKDSSIKFHVLLTSYELITIDMAALGSIDWACLVVDEAHRLKNNQSKFFRVLNNYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEVFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKFILTKNFEALNTKGGGNQVSLLNVVMDLKKCCNHPYLFPAAAMEAPKLPNGMYDGSALTKSSGKLMLLQKMMRKLKEGGHRVLVFSQMTKMLDLLEDFLENEGYKYERIDGGITGGMRQEAIDRFNAPGAQQFAFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEGEGENKEEDSSIIHYDDKAIDRLLDRNQDATDDTELQSMNEYLSSFKVAQY---VVKDEEEEEEEVQREIIKQEESVDP-DYWEKLLRHHYE--QQQEDLARNLGKGKRIRKQVNY-------NDGSQEDRADWQDDQSDGQSDYSVASEE-----------GDEDF----DERSEANSRRPNRKGLRNDKDKPL-----PPLLARVGGNIE-------------VLGFNSRQRKAFLNAVMRYGMPPQDAFTTQ-WLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1506          

HSP 2 Score: 64.3142 bits (155), Expect = 1.293e-9
Identity = 41/112 (36.61%), Postives = 65/112 (58.04%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I  HGY ++ D I  D ++ IL  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1735 FNIADGGFTELHSLWQN--EERAATVTKKTNEIWHRRHDYWLLAGIIQHGYARWQD-IQNDVRFAILNEPFKG---EINRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1840          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Medaka
Match: ENSORLT00000046718.1 (chromodomain helicase DNA binding protein 4 [Source:NCBI gene;Acc:101170871])

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 450/1182 (38.07%), Postives = 659/1182 (55.75%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA----------IGVTNPDKYFM----PREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD------SHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLG-----MDDVGCFVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLI----------------KEITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNK-----------KKNFPT-FHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEETE--DGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF-----DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+ +  R D   D +  +      + ++E  D +I+     C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    +  KV  ++TW+W              +    PD + +     REF + + NMSYW C WV E+QLE++   ++R Y+RK+ D + PPPV+   +      + R+    L V + E++ ++G+  EWL  H+VL       ++V   +KWR L Y+  + E     +   +  ++    HR+L+                 +  ++           K +  P+YL     +   TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R VIR+ +  ++             KK+ P  FHVLLT+YELI +D+  L  I W  L+VDEAHRLKNN++K F+ L  Y++ +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF   P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +   E  +  +G Y+  AL  ASGK  +L+KM+KKL+E GH+VL+FS MTK+LDLLE  LE+   +YERIDG V+   RQ AIDRFN P +    FLLST+AGGLGINL+SADTV IYD+DWNP NDIQA SRAHR+GQ RKVMIYRFVT+ S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF     D +N+ +D  +I YDD AI +LLDRN+  +D+ E   ++   S FK+A+Y    +  E ++      K +E+    +P DYW  LL    +   ++E +    GKG R +K VNY   D  + D       +   D+  + +DY ++  E            DE F     E+   N R P++  +  DRD K L      P L  ++   +              + GF  ++R     A+M +G+ P+     + W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  424 SCPHCEKEGIQWEARDDLS-DAEGEDDDDRRDEGLEEEDDHHIE----FCRVCKDGG-----ELLCCDTCPSSYHIHCL-----NPPL----PEIPNGEWICPRCKCPPMKGKVQRVITWRWGDPPPPTPVPRPPDLPADAPDPHPLMGRREREFFVKWCNMSYWHCSWVKELQLELNCQVMFRNYQRKT-DMDEPPPVDFGGEGDDDKSTKRKNKDPLFVHMEEEFGRFGVKLEWLMIHRVLNHSVDKKNNVHYLIKWRDLPYDQSTWESEDMDIPEYDPYKQTYWNHRELMMGEEGRPVKKLKKQVKVKKAERPPANPIVDPTIKFDRQPEYL----DSTGGTLHPYQLEGLNWLRFSWAQATDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEGNAIRGGKKASKMKKDSPVKFHVLLTSYELITIDQAVLGSIEWACLVVDEAHRLKNNQSKFFRLLNNYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKFILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPAAATEAPKLPNGMYEGAALTKASGKLMLLQKMMKKLKEGGHRVLVFSQMTKMLDLLEDFLENEGYKYERIDGGVTGNMRQEAIDRFNAPGAQQFAFLLSTRAGGLGINLASADTVIIYDSDWNPHNDIQAFSRAHRIGQNRKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEIGDGDNKEDDSSVIHYDDQAISRLLDRNQDATDDTEIQSMNEYLSSFKVAQYVVKDEDDEEDEVEREVIKQEESV---DP-DYWEKLLRHHYE--QQQEDLARNLGKGKRTRKPVNY--NDGSQEDRGIRQ--DWQEDQSDNQSDYSVASEE-----------GDEDF----DERSEANARRPNRKGLRNDRD-KPL------PPLLARVGGNIE-------------VLGFNARQRKAFLNAVMRYGMPPQDAFT-NQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1533          

HSP 2 Score: 62.7734 bits (151), Expect = 4.073e-9
Identity = 39/112 (34.82%), Postives = 65/112 (58.04%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I  HGY ++ D +  D ++ I+  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1748 FNIADGGFTELHSLWQN--EERAATVTKKTYEIWHRRHDYWLLAGIIQHGYARWQD-VQNDVRFAIINEPFKG---EMSRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1853          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Medaka
Match: ENSORLT00000043581.1 (chromodomain helicase DNA binding protein 4 [Source:NCBI gene;Acc:101170871])

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 450/1182 (38.07%), Postives = 659/1182 (55.75%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEA----------IGVTNPDKYFM----PREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD------SHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLG-----MDDVGCFVKWRGLGYEFVSTEPL-TRVTHINGLQEAIDRHRKLI----------------KEITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNK-----------KKNFPT-FHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYLLSSEIAEETE--DGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLF-----DENNENNDQKII-YDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+ +  R D   D +  +      + ++E  D +I+     C  CK+        +  C  C   YH++CL     +  L     ++   +  C RC    +  KV  ++TW+W              +    PD + +     REF + + NMSYW C WV E+QLE++   ++R Y+RK+ D + PPPV+   +      + R+    L V + E++ ++G+  EWL  H+VL       ++V   +KWR L Y+  + E     +   +  ++    HR+L+                 +  ++           K +  P+YL     +   TLHPYQLEG+NWLR S++   +TILADEMGLGKT+Q   FLYSLYK+  S+GPFL++ PLST+ NWEREFE WAPD  +V Y GDKD+R VIR+ +  ++             KK+ P  FHVLLT+YELI +D+  L  I W  L+VDEAHRLKNN++K F+ L  Y++ +++L++GTPLQNNLEELF+LLNF+ P  F ++ GFL +F DI+KE+Q+ KL +ML    LRRLK+DVF   P+K E I+RVEL+P+QKK+YK ILT+N+EAL+ +  G  V + N+VM L+KCCNHPYL  +   E  +  +G Y+  AL  ASGK  +L+KM+KKL+E GH+VL+FS MTK+LDLLE  LE+   +YERIDG V+   RQ AIDRFN P +    FLLST+AGGLGINL+SADTV IYD+DWNP NDIQA SRAHR+GQ RKVMIYRFVT+ S+EE+I + +K+K+M+T+LVV+        S +K E   I+ FGT++LF     D +N+ +D  +I YDD AI +LLDRN+  +D+ E   ++   S FK+A+Y    +  E ++      K +E+    +P DYW  LL    +   ++E +    GKG R +K VNY   D  + D       +   D+  + +DY ++  E            DE F     E+   N R P++  +  DRD K L      P L  ++   +              + GF  ++R     A+M +G+ P+     + W    L  K+  E + ++  FM +L E      +      GV ++ +    +++RI +  LI  KV ++E +N
Sbjct:  424 SCPHCEKEGIQWEARDDLS-DAEGEDDDDRRDEGLEEEDDHHIE----FCRVCKDGG-----ELLCCDTCPSSYHIHCL-----NPPL----PEIPNGEWICPRCKCPPMKGKVQRVITWRWGDPPPPTPVPRPPDLPADAPDPHPLMGRREREFFVKWCNMSYWHCSWVKELQLELNCQVMFRNYQRKT-DMDEPPPVDFGGEGDDDKSTKRKNKDPLFVHMEEEFGRFGVKLEWLMIHRVLNHSVDKKNNVHYLIKWRDLPYDQSTWESEDMDIPEYDPYKQTYWNHRELMMGEEGRPVKKLKKQVKVKKAERPPANPIVDPTIKFDRQPEYL----DSTGGTLHPYQLEGLNWLRFSWAQATDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEGNAIRGGKKASKMKKDSPVKFHVLLTSYELITIDQAVLGSIEWACLVVDEAHRLKNNQSKFFRLLNNYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKFILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPAAATEAPKLPNGMYEGAALTKASGKLMLLQKMMKKLKEGGHRVLVFSQMTKMLDLLEDFLENEGYKYERIDGGVTGNMRQEAIDRFNAPGAQQFAFLLSTRAGGLGINLASADTVIIYDSDWNPHNDIQAFSRAHRIGQNRKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEIGDGDNKEDDSSVIHYDDQAISRLLDRNQDATDDTEIQSMNEYLSSFKVAQYVVKDEDDEEDEVEREVIKQEESV---DP-DYWEKLLRHHYE--QQQEDLARNLGKGKRTRKPVNY--NDGSQEDRGIRQ--DWQEDQSDNQSDYSVASEE-----------GDEDF----DERSEANARRPNRKGLRNDRD-KPL------PPLLARVGGNIE-------------VLGFNARQRKAFLNAVMRYGMPPQDAFT-NQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETF--ADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVN 1533          

HSP 2 Score: 62.7734 bits (151), Expect = 4.073e-9
Identity = 39/112 (34.82%), Postives = 65/112 (58.04%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDN-ADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+HS W +  E+ +    K     W++ HDY+LL+ I  HGY ++ D +  D ++ I+  P +    ++ + N  +I+  F  R+ +LLE AL+IE Q+ +  
Sbjct: 1748 FNIADGGFTELHSLWQN--EERAATVTKKTYEIWHRRHDYWLLAGIIQHGYARWQD-VQNDVRFAIINEPFKG---EMSRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAA 1853          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Medaka
Match: chd3 (chromodomain-helicase-DNA-binding protein 3 [Source:NCBI gene;Acc:101167742])

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 438/1133 (38.66%), Postives = 629/1133 (55.52%), Query Frame = 1
Query:  349 AVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGVTNPD--------------KYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSD---------SHRRKLSELEVK-LHEKYFQWGIDPEWLQPHKVL--GMDDVGCF---VKWRGLGYEFVSTEPLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDK-----DMYYQNKKKNFP-----TFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSG--VKMSNIVMQLRKCCNHPYL--LSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK--------SFTKIEFHQIISFGTKDLFDENNENNDQK-----IIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNI--DRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
             V    D+  DD  + C  CK+        +  C  C   YH++CL     +  L   P      +  C RC  +    +V  I+ W+W      +  P               K    REF +     SYW C W++E+QLEI    +YR Y+RK+ D + PP ++  S          S +R+  + +   L +KY+++GI PEW+  H+++   +D  G +   VKWR L Y+  + E                       ++T   +     +   K EE PD++    T    TLH YQLEG+NWLR S++   +TILADEMGLGKTIQ I FLYSL+K+  ++GPFL++ PLST+ NWEREFE WAPDF +V Y GDKD+R +IR+      D   +  KK F       FHVLLT+YEL+ +D+  L  I W  L+VDEAHRLKNN++K F+ L  Y I+Y++L++GTPLQNNLEELF+LLNF+ PN F ++ GFL +F DISKE+Q+ KL ++L    LRRLK+DVF + P K E I+RVEL+P+QKK+YK+ILTKN+EAL+ K  G  V + NI+M L+KCCNHPYL  ++S  A++T  G+Y+  AL  ASGK  +L+KML+KL+E GH+VL+FS MTK+LDLLE  L+H   +YERIDG ++   RQ AIDRFN P +    FLLST+AGGLGINL++ADTV I+D+DWNP NDIQA SRAHR+GQ  KVMIYRFVTR S+EE+I + +KRK+M+T+LVV+        S TK E   I+ FGT++LF +  E +  +     I YD  AI++LLDR++  +D+ +   ++   S FK+A+Y   V + +  +  E +    E +V     DYW  LL    +   ++E +  + GKG R +K VNY        + H++ S N         ++Y +                  S   ++       GR  S+  +  D+D K L      P L  ++   L              + GF  ++R     A+M +G+ P        W    L+ K+  E + ++  FM +L E      +      GV ++ +    +++RI +  L+  KV ++E IN
Sbjct:  414 GVPAGGDDEDDDHMEFCRVCKDG-----GELLCCDTCTSSYHIHCL-----NPPLPEIPNG----EWLCPRCLPIK--GRVQKILHWRWGEPPSPIPVPPPPDAPPDVPPPPPMKGRPEREFFVKLVGQSYWHCTWITELQLEIFHSVMYRNYQRKT-DMDEPPSLDYGSGGEEENSVGKSEKRRAKDPQFAILEDKYYKYGIKPEWMMIHRIINHSLDKKGVYHYLVKWRDLTYDQCTWE---------------------RDDMTIPDFAIYKPT--IKYEEQPDFV----TATGGTLHMYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIVFLYSLFKEGHTKGPFLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKDSRAIIRENEFSFDDTAVKGGKKAFKLRAPIKFHVLLTSYELVTIDQTALKSIEWACLVVDEAHRLKNNQSKFFRRLNDYKIDYKLLLTGTPLQNNLEELFHLLNFLTPNRFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKLILTKNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVASMEAQKTPSGAYEGSALTKASGKLMLLQKMLRKLKEQGHRVLVFSQMTKMLDLLEDFLDHEGYKYERIDGGITGALRQEAIDRFNAPGACQFCFLLSTRAGGLGINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKAGSMTKQELDDILKFGTEELFKDEGEGDKVEDEGNVIHYDSTAIERLLDRSQDATDDTDVQNMNEYLSSFKVAQYM--VREEDKIEEIEREIIKQEENVD---PDYWEKLLRHHYE--QQQEDLASKLGKGKRNRKPVNYNDAAQEDQEWHADISDN--------QSEYSVG-----------------SEEEDEDFDDRPEGRRQSRRQLRNDKD-KPL------PPLLARVGGNLE-------------VLGFNTRQRKAFLNAVMRWGM-PSQDAFSSQWLVRDLKGKSEKEFKAYVSLFMRHLCEPVADGAETF--ADGVPREGLCRQPVLTRIGVMSLVKKKVHEFEHIN 1447          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Planmine SMEST
Match: SMESG000069740.1 (SMESG000069740.1)

HSP 1 Score: 2831.59 bits (7339), Expect = 0.000e+0
Identity = 1390/1395 (99.64%), Postives = 1393/1395 (99.86%), Query Frame = 1
Query:   61 MSANDSQNKSNVRRSKRLIANEESQPVCSKTSKKPKISNENSSDSTSFTTSEKAKEPMILVVDNSCQCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGMDDVGCFVKWRGLGYEFVSTEPLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMSNIVMQLRKCCNHPYLLSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKSFTKIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETINRTILEIVTYKIWDIRTISIEDLENLFTDLGHFEIDFNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDNADIRKCFRNRQRLLENALLIEAQIMKVGAACDGYSVDSFSVERLKYYHDLFFNQGNTIHINPSLVNTKPKLTAIAQLEMIINDVETNLESFKPISIQHLDSGANGNA 4245
            MSANDSQNKSNVRRSKRLIANEESQPVCSKTSKKPKISNENSSDSTSFTTSEKAKEPMILVVDNSCQCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSHRRKLSE EVKLHEKYFQWGIDPEWLQPHKVLGMDDVGCFVKWRGLGYEFVSTEPLTRV+HINGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQNNLEELFNLLNFMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMSNIVMQLRKCCNHPYLLSSEIAEETEDGSYDVPALIAASGKTDIL+KMLKKLQESGHKVLIFSGMTKLLDLLEYLLEHMDIQYERIDGSVSSTSRQNAIDRFNDPNS+SMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKSFTKIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGL PKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETINRTILEIVTYKIWDIRTISIEDLENLFTDLGHFEIDFNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDNADIRKCFRNRQRLLENALLIEAQIMKVGAACDGYSVDSFSVERLKYYHDLFFNQGNTIHINPSLVNTKPKLTAIAQLEMIINDVETNLESFKPISIQHLDSGANGNA
Sbjct:    1 MSANDSQNKSNVRRSKRLIANEESQPVCSKTSKKPKISNENSSDSTSFTTSEKAKEPMILVVDNSCQCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGVTNPDKYFMPREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILSDSHRRKLSEQEVKLHEKYFQWGIDPEWLQPHKVLGMDDVGCFVKWRGLGYEFVSTEPLTRVSHINGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQNNLEELFNLLNFMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMSNIVMQLRKCCNHPYLLSSEIAEETEDGSYDVPALIAASGKTDILQKMLKKLQESGHKVLIFSGMTKLLDLLEYLLEHMDIQYERIDGSVSSTSRQNAIDRFNDPNSVSMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKSFTKIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLPPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETINRTILEIVTYKIWDIRTISIEDLENLFTDLGHFEIDFNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDNADIRKCFRNRQRLLENALLIEAQIMKVGAACDGYSVDSFSVERLKYYHDLFFNQGNTIHINPSLVNTKPKLTAIAQLEMIINDVETNLESFKPISIQHLDSGANGNA 1395          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Planmine SMEST
Match: SMESG000068192.1 (SMESG000068192.1)

HSP 1 Score: 722.235 bits (1863), Expect = 0.000e+0
Identity = 452/1184 (38.18%), Postives = 664/1184 (56.08%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEP-TQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGV-------------TNP----DKYFMP-REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILS---DSHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGM-----DDVGCFVKWRGLGYEFVSTEPLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLT--------------------KLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLL--SSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK---------SFTKIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTE--NPAD--YWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+V   R+       D+++    ++   + ++E  D+  + C +CK+        +  C  C   YH  CL          + P +++      C RC    L  KV  I+TW+W     G               NP     +   P REF + + ++SYW+CEW++E+QL++  P L R Y +K+ D + PP  E  S      R K+++    L E++++W + PEW+Q H+++       + +   +KWR L Y+  + E L     +  ++  ++ +  + K  T   Y  + K+                       ++ + PDY+          LH YQLEG+NWLR S+ N ++TILADEMGLGKTIQ I+FLYSLYK+  S+GPFL+  PLST+ NWEREFEFWAPDF +V Y GDKD+R V+R+ +  Y+             ++     FHVLLT+YELI +D+  L  I+WE+L+VDEAHRLKNN++K F+ L  Y INY++L++GTPLQNNLEELF+LL+FM P  F D+ GFL +F DISKEEQV +L E+L +  LRRLK+DV  D P+K E I+RVEL+P+Q KFYK ILT+N++ALS K  G ++S  NIVM L+KCCNHPYL    S+ A +  +G+Y+  ALI ASGK ++L KML KL+  GH+VLIFS MT+LLD+LE  +++M  ++ERIDG+V+   RQ++IDRFN P+S+S VFLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ  KVMIYRFVTRN++EE++ + +K+K+M+T+LVV+         S +K E  +I+ FGT+DLF E +EN+D KI+YDD AID+L+DR++   +  E    D   S FK+A Y         +D  +   +T    + +  +PAD  YW  LL    +   ++E + +  GKG R +K+VNY      + +  + N A G       D+D++       +     D +  E   T   +++ +  ++P                            LV  N  L    F +      ++R     A+M +GL P        W    L  K+   M  ++  F+ +L E     T  +     V ++ +    +++RI I  ++  KV ++E IN
Sbjct:  405 SCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGG-----DLICCAKCPVSYHPECL----------YPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKN-DMDEPPAPEDGSTYKGRAREKVADPH-NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSIPKEIILKKIPPEHPTTDLKKRMSKQPDYI----EETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDY-LSSFKVAHYSKREVSVNEDDEDDDDEETRGEIIKQDLDPADPTYWEKLLRHHYE--QDQEDLSKSLGKGKRIRKQVNY---SATQQEDDNWNDAVG-------DSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPL--------------------------LVKVNGQLEVLGFNV------RQRKAFINAVMRYGLPPMDFINSH-WMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYS--DQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKIN 1519          

HSP 2 Score: 62.003 bits (149), Expect = 4.009e-9
Identity = 39/112 (34.82%), Postives = 63/112 (56.25%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH-WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDNADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+H+ W    +   RA ++      W++ HDY+LL+ + +HGY ++ D I  D ++ I+  P R  N     +  +I+  F  R+ +LLE AL IE Q+ +  
Sbjct: 1613 FNIADGGFTELHTIW----QNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQD-IHNDVRFAIVNEPFR--NEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAA 1717          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Planmine SMEST
Match: SMESG000068192.1 (SMESG000068192.1)

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 452/1185 (38.14%), Postives = 664/1185 (56.03%), Query Frame = 1
Query:  253 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEP-TQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGV-------------TNP----DKYFMP-REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEILS---DSHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGM-----DDVGCFVKWRGLGYEFVSTEPLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLT--------------------KLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLL--SSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK---------SFTKIEFHQIISFGTKDLFDENNEN-NDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTE--NPAD--YWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 3573
            SC  CE  G+V   R+       D+++    ++   + ++E  D+  + C +CK+        +  C  C   YH  CL          + P +++      C RC    L  KV  I+TW+W     G               NP     +   P REF + + ++SYW+CEW++E+QL++  P L R Y +K+ D + PP  E  S      R K+++    L E++++W + PEW+Q H+++       + +   +KWR L Y+  + E L     +  ++  ++ +  + K  T   Y  + K+                       ++ + PDY+          LH YQLEG+NWLR S+ N ++TILADEMGLGKTIQ I+FLYSLYK+  S+GPFL+  PLST+ NWEREFEFWAPDF +V Y GDKD+R V+R+ +  Y+             ++     FHVLLT+YELI +D+  L  I+WE+L+VDEAHRLKNN++K F+ L  Y INY++L++GTPLQNNLEELF+LL+FM P  F D+ GFL +F DISKEEQV +L E+L +  LRRLK+DV  D P+K E I+RVEL+P+Q KFYK ILT+N++ALS K  G ++S  NIVM L+KCCNHPYL    S+ A +  +G+Y+  ALI ASGK ++L KML KL+  GH+VLIFS MT+LLD+LE  +++M  ++ERIDG+V+   RQ++IDRFN P+S+S VFLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ  KVMIYRFVTRN++EE++ + +K+K+M+T+LVV+         S +K E  +I+ FGT+DLF E +EN +D KI+YDD AID+L+DR++   +  E    D   S FK+A Y         +D  +   +T    + +  +PAD  YW  LL    +   ++E + +  GKG R +K+VNY      + +  + N A G       D+D++       +     D +  E   T   +++ +  ++P                            LV  N  L    F +      ++R     A+M +GL P        W    L  K+   M  ++  F+ +L E     T  +     V ++ +    +++RI I  ++  KV ++E IN
Sbjct:  405 SCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGG-----DLICCAKCPVSYHPECL----------YPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKN-DMDEPPAPEDGSTYKGRAREKVADPH-NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSIPKEIILKKIPPEHPTTDLKKRMSKQPDYI----EETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDY-LSSFKVAHYSKREVSVNEDDEDDDDEETRGEIIKQDLDPADPTYWEKLLRHHYE--QDQEDLSKSLGKGKRIRKQVNY---SATQQEDDNWNDAVG-------DSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPL--------------------------LVKVNGQLEVLGFNV------RQRKAFINAVMRYGLPPMDFINSH-WMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYS--DQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKIN 1520          

HSP 2 Score: 62.003 bits (149), Expect = 4.112e-9
Identity = 39/112 (34.82%), Postives = 63/112 (56.25%), Query Frame = 1
Query: 3679 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH-WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDNADIRKCFRNRQ-RLLENALLIEAQIMKVG 4008
            FNI DGGF+E+H+ W    +   RA ++      W++ HDY+LL+ + +HGY ++ D I  D ++ I+  P R  N     +  +I+  F  R+ +LLE AL IE Q+ +  
Sbjct: 1614 FNIADGGFTELHTIW----QNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQD-IHNDVRFAIVNEPFR--NEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAA 1718          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Planmine SMEST
Match: SMESG000033395.1 (SMESG000033395.1)

HSP 1 Score: 443.351 bits (1139), Expect = 2.281e-133
Identity = 287/700 (41.00%), Postives = 417/700 (59.57%), Query Frame = 1
Query:  925 DDVGCFVKWRGLGYEFVSTEP---LTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFN----DISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLLSSEIAEETE---DGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKS----------------FTKIEFHQIISFGTKDLFDENNENNDQKIIYDDAAIDKLLDRNRFTSDNPET-SFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTENPADYWAALL-EPLIKNINEEESVKE--EFGKGFRQKKKV 2928
            D +   +KW+ L Y + + E    + +    NG+ E  +R R  +K    K      + K   + E PDYL   S T+   L  YQL+GVNWL  +++   + ILADEMGLGKTIQ I FL  L+      GPFL+ VPLST+ +W+ EF  WAP   I+ Y GD  +R VIR+ + Y+   KK    FHV +TTYEL+  D+ +L+ I+W  L VDEAHRLKN+E++L+  L  ++ N R+L++GTP+ N+L EL+ LL+F+ P+ F     F  ++N    +   EE V +L ++L+   LRR K DV    P+K EQIIRV +   Q + YK+ILTKNYEALS +  G   S  NIVM+L+KCCNH  L++  + EETE   D    +   I +SGK  +L K++ +L+E GH+VLIFS M ++LD++   L      ++R+DGS+  + R+ AID FN   S    FLLST+AGGLGINL++ADTV I+D+DWNPQND+QA++RAHR+GQKR+V +YRFV +NSIEEKI+E +KRK+++ +LV++                 F+K E ++I+ FG  DLF+++ E ++++       I  +L R   T+ + E+ +  +   S FK+       + AE ED   I +K             W+ ++ + L + I EEE  K   E   G RQ+KKV
Sbjct:  329 DSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRS-VKIPNRKCEALTRRPKFAPIREQPDYL---SHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYF--PKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNISNENREVEEVVSELYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNP-LDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLFNQDEELDEEQE----LNIQDILQRAETTNHDDESHNPANDLLSAFKVVN---ITETAEDEDIVYIGHK--------GKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKV 1006          
BLAST of Chromodomain helicase DNA binding protein 5 vs. Planmine SMEST
Match: SMESG000047519.1 (SMESG000047519.1)

HSP 1 Score: 389.037 bits (998), Expect = 4.441e-113
Identity = 256/685 (37.37%), Postives = 393/685 (57.37%), Query Frame = 1
Query:  664 REFLIHYSNMSYWDCEWVSEVQLEISE--------PNLYRAYKRKSLDFNSPPPVEILSDSHRRKLSELEVKLHEKYFQWGIDPEWLQPH-KVLGMDDVGCFVKWRGLGYEFVSTEPLTRVTH--INGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQXXXXXXXXXXXXMEPNSFGDISGFLSQFNDISKE----EQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKM-SNIVMQLRKCCNHPYLLSSEIAEETEDGSYDVPA----LIAASGKTDILKKMLKKLQESGHKVLIFSGMTKXXXXXXXXXXHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVKSF-----------TKIE---FHQIISFGTKDLFDENNENND 2616
            +++LI + N SY    W SE  L+                 +K      NS  P E+     RR  +E +++    Y +  ID    + + KV G++    F+KW+ L Y+FV+ E    V      G     + + K  K   + +   R +     L ++  + G PS  ++  L  YQ  GVNW+   ++   N ILADEMGLGKTIQ ISF+  L++     GP+L+ VPLST+ NW+REFE WAP+   + Y GD  +R +I+  + Y  N K     F+ LLTTYE+   D+  L ++ W  L VDEAHRLK+ ++KL+K++  +  N R L++GTPLQNN++EL+ LL+F+ P+ F     F  +F +   E    E++  L+E +    +RR K DV    P K EQI+R+ ++  QK+ Y++IL KN+++L  + +   +  N++++L+KCCNH  L+S     E     + +P     LI +SGK  +L K+L  L+   H+VLIFS M ++LD+L+  L      ++R+DGS SS  R  AI  FN  NS    FLLST+AGGLGINL++ADTV I+D+DWNP  D+QA++RAHR+GQ ++V IYRFV +NS+EEKI+E +KRK+++ +L+++             TK+E   F  I+ F  +++F E ++++D
Sbjct:  137 QQYLIKWKNWSYVHATWESEESLKARGHIEGRKKLDKFIATFKEAERYKNSCSPDEL----ERRLFAEEQIR-ERNYQKMQIDRVIHKQYDKVGGLE---YFIKWKSLDYKFVTAESAESVVEPLFKGAIADYENNLKNNKVPNNNNMYLRKRPVFFPLPKTVTF-GLPS--SRLCLRDYQEIGVNWMMKLWTIGHNGILADEMGLGKTIQIISFISMLFRRYDIYGPYLLIVPLSTIDNWKREFETWAPEIYTIVYTGDIASREIIKKYEWYQPNTKT--LKFNALLTTYEIAMNDKALLGNVYWTFLGVDEAHRLKSPDSKLYKTIYPFRTNCRFLITGTPLQNNIKELWALLHFIMPSIFASFEDFEQKFGNTDNETLCNEKLANLREAISPFIIRREKKDVEKSLPAKSEQILRINMSHKQKELYRLILAKNFDSLLAETNKRTIFKNVIVELKKCCNHVELIS-----EKFKNLHSLPERQEYLIKSSGKMIVLDKLLTHLKSENHRVLIFSQMVRMLDILDDYLCMKGWGFQRLDGSRSSVMRNEAIKNFNAQNSTDFCFLLSTRAGGLGINLTTADTVIIFDSDWNPHADLQAMARAHRIGQTKQVSIYRFVIKNSVEEKIIERAKRKMVLDHLIIQRMEANGITSKNNKTKLEADDFEAILRFSAQEIFKECDDSDD 803          
The following BLAST results are available for this feature:
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHD45.998e-1137.97chromodomain helicase DNA binding protein 4 [Sourc... [more]
CHD45.894e-1137.97chromodomain helicase DNA binding protein 4 [Sourc... [more]
CHD45.906e-1137.97chromodomain helicase DNA binding protein 4 [Sourc... [more]
CHD40.000e+037.97chromodomain helicase DNA binding protein 4 [Sourc... [more]
CHD45.902e-1137.97chromodomain helicase DNA binding protein 4 [Sourc... [more]
back to top
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd-30.000e+033.68Chromodomain-helicase-DNA-binding protein 3 homolo... [more]
let-4185.313e-1136.80pep chromosome:WBcel235:V:5826833:5832866:1 gene:W... [more]
chd-18.988e-12340.20Chromodomain and Helicase Domain protein [Source:... [more]
chd-72.764e-11742.13Chromodomain and Helicase Domain protein [Source:... [more]
isw-12.406e-9739.82Chromatin-remodeling complex ATPase chain isw-1 [... [more]
back to top
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mi-28.003e-1038.49gene:FBgn0262519 transcript:FBtr0074919[more]
Mi-28.003e-1038.49gene:FBgn0262519 transcript:FBtr0302046[more]
Mi-28.342e-1038.49gene:FBgn0262519 transcript:FBtr0332152[more]
Mi-28.348e-1038.49gene:FBgn0262519 transcript:FBtr0100394[more]
Chd30.000e+043.78gene:FBgn0023395 transcript:FBtr0074998[more]
back to top
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd4a7.706e-837.87chromodomain helicase DNA binding protein 4a [Sour... [more]
chd53.293e-1138.99chromodomain helicase DNA binding protein 5 [Sourc... [more]
chd53.221e-1138.99chromodomain helicase DNA binding protein 5 [Sourc... [more]
chd4a1.792e-1039.12chromodomain helicase DNA binding protein 4a [Sour... [more]
chd53.420e-1138.05chromodomain helicase DNA binding protein 5 [Sourc... [more]
back to top
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
son0.000e+037.33SON DNA binding protein [Source:Xenbase;Acc:XB-GEN... [more]
hnf1b0.000e+037.68HNF1 homeobox B [Source:Xenbase;Acc:XB-GENE-485652... [more]
hnf1b0.000e+037.68HNF1 homeobox B [Source:Xenbase;Acc:XB-GENE-485652... [more]
son0.000e+037.10SON DNA binding protein [Source:Xenbase;Acc:XB-GEN... [more]
hnf1b0.000e+037.53HNF1 homeobox B [Source:Xenbase;Acc:XB-GENE-485652... [more]
back to top
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chd57.645e-1239.05chromodomain helicase DNA binding protein 5 [Sourc... [more]
Chd44.415e-1137.97chromodomain helicase DNA binding protein 4 [Sourc... [more]
Chd44.444e-1137.97chromodomain helicase DNA binding protein 4 [Sourc... [more]
Chd44.563e-1137.97chromodomain helicase DNA binding protein 4 [Sourc... [more]
Chd56.818e-1237.90chromodomain helicase DNA binding protein 5 [Sourc... [more]
back to top
BLAST of Chromodomain helicase DNA binding protein 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q22516|CHD3_CAEEL0.000e+033.68Chromodomain-helicase-DNA-binding protein 3 homolo... [more]
sp|Q6PDQ2|CHD4_MOUSE3.192e-1037.97Chromodomain-helicase-DNA-binding protein 4 OS=Mus... [more]
sp|Q14839|CHD4_HUMAN3.008e-1037.97Chromodomain-helicase-DNA-binding protein 4 OS=Hom... [more]
sp|Q8TDI0|CHD5_HUMAN7.694e-1038.10Chromodomain-helicase-DNA-binding protein 5 OS=Hom... [more]
sp|A2A8L1|CHD5_MOUSE5.056e-1137.90Chromodomain-helicase-DNA-binding protein 5 OS=Mus... [more]
back to top
BLAST of Chromodomain helicase DNA binding protein 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A452GTK80.000e+038.70Chromodomain helicase DNA binding protein 5 OS=Gop... [more]
A0A1D1V5T40.000e+036.79Uncharacterized protein OS=Ramazzottius varieornat... [more]
D5LXF20.000e+038.11Chromodomain helicase DNA-binding protein 4 OS=Sch... [more]
A0A5G3H7350.000e+037.68HNF1 homeobox B OS=Xenopus tropicalis OX=8364 GN=h... [more]
A0A5G3IST50.000e+037.68HNF1 homeobox B OS=Xenopus tropicalis OX=8364 GN=h... [more]
back to top
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd4a1.462e-938.47chromodomain helicase DNA binding protein 4a [Sour... [more]
ENSAMXT00000010902.22.838e-1138.20pep primary_assembly:Astyanax_mexicanus-2.0:10:250... [more]
chd52.004e-1044.04chromodomain helicase DNA binding protein 5 [Sourc... [more]
chd25.476e-12140.37chromodomain helicase DNA binding protein 2 [Sourc... [more]
chd28.447e-12140.37chromodomain helicase DNA binding protein 2 [Sourc... [more]
back to top
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004254.15.325e-12245.85pep scaffold:Pmarinus_7.0:GL484668:1435:12215:1 ge... [more]
ENSPMAT00000006729.16.926e-11138.45pep scaffold:Pmarinus_7.0:GL476370:400098:484196:-... [more]
SMARCA51.458e-10839.22SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA56.530e-10740.67SWI/SNF related, matrix associated, actin dependen... [more]
ENSPMAT00000006707.12.755e-9340.57pep scaffold:Pmarinus_7.0:GL476370:281119:459539:-... [more]
back to top
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CHD15.131e-11337.60Chromatin remodeler that regulates various aspects... [more]
ISW21.142e-11043.67ATP-dependent DNA translocase involved in chromati... [more]
ISW12.872e-10343.89ATPase subunit of imitation-switch (ISWI) class ch... [more]
SNF27.126e-9339.92Catalytic subunit of the SWI/SNF chromatin remodel... [more]
STH15.554e-9140.97ATPase component of the RSC chromatin remodeling c... [more]
back to top
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO395850.000e+043.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472981.248e-12640.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407611.839e-9840.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319434.512e-9540.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481163.284e-9435.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Chromodomain helicase DNA binding protein 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000015622.24.358e-938.62chromodomain helicase DNA binding protein 4 [Sourc... [more]
chd4a1.293e-938.79chromodomain-helicase-DNA-binding protein 4 [Sourc... [more]
ENSORLT00000046718.14.073e-938.07chromodomain helicase DNA binding protein 4 [Sourc... [more]
ENSORLT00000043581.14.073e-938.07chromodomain helicase DNA binding protein 4 [Sourc... [more]
chd30.000e+038.66chromodomain-helicase-DNA-binding protein 3 [Sourc... [more]
back to top
BLAST of Chromodomain helicase DNA binding protein 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069740.10.000e+099.64SMESG000069740.1[more]
SMESG000068192.14.009e-938.18SMESG000068192.1[more]
SMESG000068192.14.112e-938.14SMESG000068192.1[more]
SMESG000033395.12.281e-13341.00SMESG000033395.1[more]
SMESG000047519.14.441e-11337.37SMESG000047519.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003234 ID=SMED30003234|Name=Chromodomain helicase DNA binding protein 5|organism=Schmidtea mediterranea sexual|type=transcript|length=4640bp
TTTAAAGTTTTAAAATAAAAATTTATTAATATATCATTTTAGATTATTAT
TTTGTTTTTGATGAGCGCTAATGATTCCCAAAACAAGTCAAATGTGCGGC
GTTCTAAAAGATTAATTGCAAATGAAGAAAGTCAACCCGTTTGTTCAAAA
ACTTCTAAAAAACCTAAAATTAGTAATGAAAATTCTTCTGACTCCACAAG
TTTTACAACTTCTGAAAAAGCCAAAGAACCAATGATTTTAGTTGTTGATA
ATAGTTGCCAGTGTGAAACATGTGGTTTGGTTTTTATAAAAAGAACTGAT
AAGAAAATTGACGAAAAAGACGTGAACAAGTGTTTATCGTGTGTGAAAGC
CGTTAAAGAATTGTCTGATGAATACATTGATGATAGTAATAAAATTTGTG
AAAAATGCAAAGAGAGCTCTTTATCTTTGGATAATCGAATGACTGGATGC
TTAATTTGCATGAAATACTATCACGTTAATTGCCTTCTTTTATCCGACAG
ATCGACAGACCTAAAATTTGAACCAACTCAATTAATACGTCGAAAATTGG
GATGTATTAGATGCGCAGTTGTTCATTTATGTTATAAAGTAAGCAGTATC
GTTACATGGAAATGGCGATCAGAAGCGATTGGAGTAACCAATCCCGACAA
GTATTTCATGCCCCGTGAATTCCTGATTCACTACTCTAACATGTCCTATT
GGGACTGCGAATGGGTATCCGAGGTTCAGCTAGAAATATCAGAACCGAAT
TTATATAGAGCATATAAGAGAAAATCCTTAGATTTTAATTCTCCTCCCCC
CGTTGAAATTCTAAGCGATAGCCACAGACGCAAACTGAGTGAGCTGGAAG
TAAAATTGCACGAGAAATACTTCCAATGGGGTATCGATCCTGAATGGTTG
CAACCACACAAGGTATTGGGAATGGATGATGTGGGATGCTTTGTGAAATG
GCGCGGGTTAGGCTATGAGTTCGTGTCCACTGAACCGCTCACCAGAGTCA
CGCACATCAATGGACTACAAGAGGCCATTGATCGCCACAGGAAACTCATT
AAAGAAATCACCGATAAGTCCTATGTTGCTCGTAATAAATCAAAGCTGAC
AAAATTGGAAGAATCCCCAGATTATTTAGGGCCTCCTTCAACGACTGCGA
AAGCCACGCTCCATCCTTATCAACTGGAAGGAGTGAATTGGTTAAGGAGT
AGCTATTCCAATAATATCAATACTATCCTTGCCGATGAAATGGGGTTAGG
CAAAACTATCCAAGCTATCTCCTTTCTTTATTCTCTTTATAAGGACAAAG
TTTCACGAGGCCCTTTTCTAATCACGGTCCCGTTATCTACAATGAAAAAT
TGGGAACGAGAATTTGAATTCTGGGCTCCTGATTTCTGTATAGTACCATA
TTATGGGGATAAAGATGCTCGCATAGTTATCAGAGACAAAGATATGTATT
ATCAAAATAAAAAGAAGAATTTCCCCACATTCCATGTTTTATTGACGACA
TATGAGTTAATATTTATGGATGAAGGGTTTTTAAGTCACATAAACTGGGA
AATTCTAATAGTAGATGAAGCTCATCGATTGAAAAATAACGAAACTAAGC
TGTTCAAAAGTCTGAAGAAATATAACATAAACTATCGAATGTTAATGAGT
GGAACTCCACTTCAAAACAATTTAGAAGAATTATTTAATTTGTTGAATTT
CATGGAACCTAATTCATTTGGGGATATTTCAGGATTTCTGTCACAATTTA
ACGACATATCTAAAGAAGAACAGGTCATAAAATTACAGGAAATGCTTAAA
AAGCGTTTTCTACGTCGATTGAAATCTGACGTTTTCATTGATTTTCCAAC
AAAAGAAGAACAAATCATTCGTGTAGAATTGACCCCTCTTCAAAAGAAAT
TCTATAAGATAATTCTGACAAAAAATTATGAAGCACTCAGTGGGAAATTC
AGCGGTGTAAAAATGTCGAATATTGTGATGCAATTAAGGAAATGTTGCAA
TCATCCGTATTTGTTGTCGTCTGAAATTGCCGAAGAAACTGAAGATGGTT
CATATGATGTGCCGGCATTGATTGCAGCATCAGGAAAGACTGATATATTA
AAAAAAATGTTGAAAAAACTACAAGAATCCGGTCACAAAGTCCTGATATT
TTCCGGTATGACGAAACTGTTAGATCTTCTTGAGTATCTACTGGAACACA
TGGATATTCAATATGAACGAATCGACGGTAGCGTTTCTTCGACATCACGC
CAGAATGCGATAGACCGATTCAATGATCCAAATTCCATTAGTATGGTATT
TCTACTGTCAACTAAAGCCGGAGGTTTGGGAATCAACCTCAGCTCAGCTG
ATACAGTCTTCATTTACGATGCCGACTGGAATCCTCAAAACGACATACAG
GCCTTATCAAGAGCTCATAGACTGGGACAGAAACGAAAAGTCATGATTTA
TAGATTTGTAACCCGGAATTCGATTGAGGAAAAAATTATGGAAACCTCAA
AACGAAAATTGATGGTTACTAATCTTGTTGTGAAATCTTTTACGAAAATC
GAATTTCATCAAATAATAAGCTTTGGAACAAAAGATTTATTCGATGAAAA
CAATGAAAATAATGACCAGAAAATTATATATGATGATGCCGCAATCGATA
AGTTGCTCGATAGAAACCGGTTTACTTCCGATAATCCAGAGACGAGTTTT
TTGGATTCGTGTTTCAGTGGATTCAAAATGGCAGAATATCAGTTTGCTGT
TGATAAGGCTGAAACAGAAGACTCAGCAGAAATAAAAAACAAAACTGATG
AAAATTCAGTTACAGAAAATCCTGCTGATTATTGGGCCGCGCTTCTTGAG
CCCCTTATTAAAAATATAAACGAAGAAGAAAGTGTTAAAGAAGAGTTTGG
TAAAGGATTTAGACAAAAGAAAAAAGTAAATTATATTACACAAGATATAC
TGAAACATGATCACCATTCCAATAATTCAGCAAATGGCGCCCATGACAAG
GATCCTGATGATACTGATTATGACATATCGGAAGGAGAGAATCCCGATCA
TCCCTCATCTCCCGATCGTAATAGTGACGAGAGTTTCCTAACCAACGATC
TAGAAAAGAAGGCGGAAAACGGGAGATTGCCTTCCAAATTCAATATCGAT
CGCGATTTCAAAGAGTTAGCTAGTTACGGCGTTTCTCCTGATTTGACCAA
TCAAATCAAATGTGAACTAGTCAATGAAAATACAATTTTGCATTTCAAAC
ATTTCGCACTCATCAATGGATTTATGCCGAAGGAGCGAATGGAAATCTAT
GAAGCGCTGATGAACTTTGGACTGGCACCAAAACTCCTGAAAAAAGGGGA
TATCTGGTGGCCGAGTGCTCTGGAACATAAAACGGTCGATGAAATGGAGA
AGTTCCTCTTTACTTTCATGAGCAATCTTGTCGAACATCACGAGTCGTTA
ACGCAGCAGCATGATCGGATCAGCGGAGTGATCAAAGATGAAATTGATTA
CGATTTCATAATTTCAAGGATCGCTATTAACGGATTAATCAATTACAAGG
TTAGCCAATACGAAACCATCAATCGCACAATATTGGAAATCGTTACTTAC
AAGATTTGGGATATTCGAACGATTTCAATTGAAGATTTGGAGAACTTATT
CACTGATTTAGGACATTTCGAAATCGACTTCAATATATATGATGGCGGGT
TTTCGGAAATCCACAGCGATTGGGTTGATTATTATGAAAAGTATAGTCGA
GCAACTCTAAAAAACCCCACTTTACACTGGAATAAGATCCATGATTATTA
TTTGCTATCGTCTATTGCTAGTCATGGTTATGATAAATATATTGATCAGA
TCTTCATTGATCCGCAATATCAAATTCTATTCATTCCTCTGCGAATAGCC
AATTTAGATTTAGTTAAGGACAACGCCGATATCAGAAAATGTTTTCGTAA
TAGGCAAAGATTACTTGAGAACGCGTTGCTTATTGAAGCGCAAATCATGA
AAGTGGGAGCTGCATGTGACGGATATTCAGTTGATTCATTTTCCGTTGAA
AGGTTGAAATATTATCACGATCTATTCTTCAATCAAGGCAATACTATCCA
CATCAATCCGTCCCTGGTTAATACTAAGCCTAAATTAACGGCTATTGCCC
AGTTGGAAATGATTATCAACGACGTCGAAACAAATCTAGAATCTTTCAAA
CCAATTTCTATCCAGCATTTAGATTCCGGAGCAAATGGAAATGCTTGATG
CAATTCTGAATCCTGTACATATTTGTTTAGTAAATATCTACTCGACTTGC
ATTTTTCGTCATTGTTGTTTTCTCTGATCACGTTTTAATTTCAAAATATT
TCTTGGTGGTTTACAAAGCATAACTTTGAGATTTCCCAACAATGCCAATT
TTGTTTGTTTTGAGATCGTTGAATTTGATGAATGAGAATCTAAATCTGGA
ATGCAATATAAATGTGTAGTAACAATTGGAATGTGTAAAAATCAAATAGT
AATTCCAGAACAATTGAGCTAATCGTAATTTCGGTCCATTGGACTGCGAG
GAAAGCGCAAAATTTGGAATGCCTAATATCTTTTGATACTTGTAAAACAT
AAATAATGCCTATCATATAATAAAAAATACATTAAATGCC
back to top

protein sequence of SMED30003234-orf-1

>SMED30003234-orf-1 ID=SMED30003234-orf-1|Name=SMED30003234-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1396bp
MSANDSQNKSNVRRSKRLIANEESQPVCSKTSKKPKISNENSSDSTSFTT
SEKAKEPMILVVDNSCQCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKE
LSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTD
LKFEPTQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGVTNPDKYFM
PREFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVEI
LSDSHRRKLSELEVKLHEKYFQWGIDPEWLQPHKVLGMDDVGCFVKWRGL
GYEFVSTEPLTRVTHINGLQEAIDRHRKLIKEITDKSYVARNKSKLTKLE
ESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTI
QAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGD
KDARIVIRDKDMYYQNKKKNFPTFHVLLTTYELIFMDEGFLSHINWEILI
VDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQNNLEELFNLLNFMEP
NSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEE
QIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMSNIVMQLRKCCNHPY
LLSSEIAEETEDGSYDVPALIAASGKTDILKKMLKKLQESGHKVLIFSGM
TKLLDLLEYLLEHMDIQYERIDGSVSSTSRQNAIDRFNDPNSISMVFLLS
TKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFV
TRNSIEEKIMETSKRKLMVTNLVVKSFTKIEFHQIISFGTKDLFDENNEN
NDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKA
ETEDSAEIKNKTDENSVTENPADYWAALLEPLIKNINEEESVKEEFGKGF
RQKKKVNYITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSS
PDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIK
CELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLAPKLLKKGDIWW
PSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFI
ISRIAINGLINYKVSQYETINRTILEIVTYKIWDIRTISIEDLENLFTDL
GHFEIDFNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLHWNKIHDYYLLS
SIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDNADIRKCFRNRQR
LLENALLIEAQIMKVGAACDGYSVDSFSVERLKYYHDLFFNQGNTIHINP
SLVNTKPKLTAIAQLEMIINDVETNLESFKPISIQHLDSGANGNA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038718SNF2-like_sf
IPR014001Helicase_ATP-bd
IPR000953Chromo/chromo_shadow_dom
IPR000330SNF2_N
IPR013083Znf_RING/FYVE/PHD
IPR027417P-loop_NTPase
IPR009462DUF1086
IPR012957CHD_C2
IPR016197Chromo-like_dom_sf
IPR001650Helicase_C
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0008270zinc ion binding
GO:0003677DNA binding
GO:0016818hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0004386helicase activity
GO:0008017microtubule binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006325chromatin organization
GO:0051225spindle assembly
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0016581NuRD complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 316..336
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 596..819
e-value: 5.9E-186
score: 620.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 22..51
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..51
NoneNo IPR availablePANTHERPTHR45623:SF17CHROMODOMAIN-HELICASE-DNA-BINDING PROTEIN 3-RELATEDcoord: 9..1250
NoneNo IPR availablePANTHERPTHR45623FAMILY NOT NAMEDcoord: 9..1250
NoneNo IPR availableCDDcd17994DEXHc_CHD3_4_5coord: 367..586
e-value: 1.81269E-96
score: 305.903
NoneNo IPR availableCDDcd15489PHD_SFcoord: 112..168
e-value: 8.40734E-4
score: 36.5262
NoneNo IPR availableCDDcd18667CD1_tandem_CHD3-4_likecoord: 175..237
e-value: 9.85551E-17
score: 74.2959
NoneNo IPR availableCDDcd18662CD2_tandem_CHD3-4_likecoord: 277..328
e-value: 2.23862E-4
score: 38.3997
NoneNo IPR availableCDDcd18793SF2_C_SNFcoord: 674..800
e-value: 3.77387E-50
score: 171.506
IPR000953Chromo/chromo shadow domainSMARTSM00298chromo_7coord: 174..239
e-value: 0.018
score: 24.2
coord: 278..327
e-value: 3.1
score: 11.1
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 705..789
e-value: 5.5E-23
score: 92.4
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 676..789
e-value: 5.1E-21
score: 75.1
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 679..828
score: 18.615
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 363..563
e-value: 5.3E-36
score: 135.6
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 379..551
score: 25.567
IPR009462Domain of unknown function DUF1086PFAMPF06461DUF1086coord: 1068..1173
e-value: 3.6E-7
score: 30.1
IPR000330SNF2-related, N-terminal domainPFAMPF00176SNF2_Ncoord: 380..651
e-value: 4.4E-59
score: 200.0
IPR012957CHD, C-terminal 2PFAMPF08074CHDCT2coord: 1240..1379
e-value: 1.6E-9
score: 38.1
IPR038718SNF2-like, N-terminal domain superfamilyGENE3DG3DSA:3.40.50.10810coord: 359..595
e-value: 5.9E-186
score: 620.3
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 353..586
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 588..858
IPR016197Chromo-like domain superfamilySUPERFAMILYSSF54160Chromo domain-likecoord: 170..240