Dach-1

Overview
NameDach-1
Smed IDSMED30003228
Length (bp)7167
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dach-1 (SMED30003228) t-SNE clustered cells

Violin plots show distribution of expression levels for Dach-1 (SMED30003228) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dach-1 (SMED30003228) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dach-1 (SMED30003228) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003228

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30003228SMESG000005090.1 dd_Smed_v4_5823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30003228SMESG000005090.1 dd_Smed_v4_5823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30003228SMESG000005090.1 SMED30003228smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30003228SMESG000002882.1 SMESG000005090.1 dd_Smed_v6_5823_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003228SMESG000005090.1 dd_Smed_v4_5823_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30003228SMESG000005090.1 dd_Smed_v4_5823_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30003228SMESG000005090.1 dd_Smed_v4_5823_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dach-1 vs. Ensembl Human
Match: MYO7A (myosin VIIA [Source:HGNC Symbol;Acc:HGNC:7606])

HSP 1 Score: 2133.61 bits (5527), Expect = 0.000e+0
Identity = 1120/2210 (50.68%), Postives = 1505/2210 (68.10%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPK-GYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAE-QMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSL-LALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            MV+ Q+GD VW++ +   +    VPIGA +K     Q+ V+DD+ +E  + P   T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYTYTG ILVAVNPY +L IY+P+ I+ Y N KIG++ PHIFAIADN Y NM+R SRDQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++ PILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q  DERNYHVFYCMLEG+  + + + GL  +  Y YL  G  I   G  D  ++  + SAMKVL FT+ E  EI +LLAA LHLGN+ ++A+   N+D+CEV        A+ LL+++  DL   LT++ +ITR + V T +S  Q +++RDA VKGIYGRLFVWIV+KIN AIY+P    V         NS+  SIG+LDIFGFENF  NSFEQLCIN+ANE+LQQFFVRH+FK+EQEEY  E IDW HI FTDNQ+ LD+I  K  NI++LIDEES+FPKGTD ++L+KL +    +  +I  K +    FGI HFAG+V+Y+  GFLEKNRD  + D+++L+ +++++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNEFKK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F++RYR+L+PG+  +++  D R T + + + +L     +QIGKTK+FLKD  D+LLE  RDKA+++R+IL+QK  R +  R+ FLK K+AA  IQ   R    R+ +  M+ GF  LQA  R++   ++ +  +  I   Q  CR  L R   + +  A++ +Q+  R   A +  + L+ + +   EA  ++  +E   + +MS +KA EEAE++H+ RL Q+  E   DA+++LK+    +++   + + ER R++PV+ S+M+D++FG +   +   +P     AP  F DLE  R   + +        +P  L +  +ED+SE+ F KFAATYFQ      ++R+PL++PLL+H +   Q++ALAVWI ILRFM DLPEP  + + +  +  +P+MTKIY++LG++  K+++     E E Q+  G    ++     R  +V LTLKKKSK T+EV   L+D E+ +     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQI KQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ L+ KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDAISQCEQ+AKE+G  E  A WRLFFRKE+FTPWH+  +D VAT+LIY QV+RG+KFGEYRC+ +DD+ +L + Q  +D   ++  E L      Y+P   I   K  +K+    +    K +    R D   ++K+KE++V++AR KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ LELSFPEI+AVSSSR         ++    S +L+T+KG  YTF  +N+EDIRDL+V FLEGL++RS Y + +Q    P   +S FLS  KGDL+IL+ +D    +  S W  G N RTK+ GDFP D VY++P +  P + I+AL +   D+               + R K +TLEEFS  YFR P   + S  M    +    LW H+R+ LK  LLKKLL  E+L Q+A   F A+L YMGD PSK   S  E+ + IF+  LK E LKDE Y Q++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     LA++C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD CQNI +++ LK  +GF+LFVK  DK +S+PE DFFFDF+R L+DW+KK RP+KDG +    YQVFFMKKLWT TVPG D +AD +FHY QE+ KYL GYHK   ++ + LGALI R   ++D S   S  + L  L+P D++ +    + ++ ++A ++     S  +AK+AFLK+IF+WPTFGSAFFE  Q+T  N PE +LIAINK GV LI  KTK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLT ++K
Sbjct:    1 MVILQQGDHVWMDLRLGQEFD--VPIGAVVKLCDSGQVQVVDDEDNEHWISPQNATHIKPMHPTSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQYTNKKIGEMPPHIFAIADNCYFNMKRNSRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQALDERNYHVFYCMLEGMSEDQKKKLGLGQASDYNYLAMGNCITCEGRVDSQEYANIRSAMKVLMFTDTENWEISKLLAAILHLGNLQYEARTFENLDACEVLFSPSLATAASLLEVNPPDLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYKPPSQDV--------KNSR-RSIGLLDIFGFENFAVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLESIDWLHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDTTMLHKLNSQHKLNANYIPPKNNHETQFGINHFAGIVYYETQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSGMMETIRIRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQGDLRGTCQRMAEAVLGTHDDWQIGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLKLKNAATLIQRHWRGHNCRKNYGLMRLGFLRLQALHRSRKLHQQYRLARQRIIQFQARCRAYLVRKAFRHRLWAVLTVQAYARGMIARRLHQRLRAEYLWRLEAEKMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLARE---DAERELKEKEAARRKKELLEQMERARHEPVNHSDMVDKMFGFLG--TSGGLPGQEGQAPSGFEDLERGRREMVEE---DLDAALP--LPDEDEEDLSEYKFAKFAATYFQGTTTHSYTRRPLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRELQALQGEGEAQLPEGQKKSSV-----RHKLVHLTLKKKSKLTEEVTKRLHDGESTVQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAKELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHSPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYFVDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAHKKGIYAQRRTD---AQKVKEDVVSYARFKWPLLFSRFYEAYKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEIMAVSSSR--------GAKTTAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEESGFLSFAKGDLIILD-HDTGEQVMNSGWANGINERTKQRGDFPTDSVYVMPTVTMPPREIVALVTMTPDQRQDVVRLLQLRTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGKDRLWSHTREPLKQALLKKLLGSEELSQEACLAFIAVLKYMGDYPSKRTRSVNELTDQIFEGPLKAEPLKDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQNIATRLLLKSSEGFSLFVKIADKVLSVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTFGSAFFE--QTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSK 2167          
BLAST of Dach-1 vs. Ensembl Human
Match: MYO7A (myosin VIIA [Source:HGNC Symbol;Acc:HGNC:7606])

HSP 1 Score: 2132.45 bits (5524), Expect = 0.000e+0
Identity = 1115/2187 (50.98%), Postives = 1494/2187 (68.31%), Query Frame = 3
Query:  228 VPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPK-GYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAE-QMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSL-LALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            VPIGA +K     Q+ V+DD+ +E  + P   T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYTYTG ILVAVNPY +L IY+P+ I+ Y N KIG++ PHIFAIADN Y NM+R SRDQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++ PILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q  DERNYHVFYCMLEG+  + + + GL  +  Y YL  G  I   G  D  ++  + SAMKVL FT+ E  EI +LLAA LHLGN+ ++A+   N+D+CEV        A+ LL+++  DL   LT++ +ITR + V T +S  Q +++RDA VKGIYGRLFVWIV+KIN AIY+P    V         NS+  SIG+LDIFGFENF  NSFEQLCIN+ANE+LQQFFVRH+FK+EQEEY  E IDW HI FTDNQ+ LD+I  K  NI++LIDEES+FPKGTD ++L+KL +    +  +I  K +    FGI HFAG+V+Y+  GFLEKNRD  + D+++L+ +++++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNEFKK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F++RYR+L+PG+  +++  D R T + + + +L     +QIGKTK+FLKD  D+LLE  RDKA+++R+IL+QK  R +  R+ FLK K+AA  IQ   R    R+ +  M+ GF  LQA  R++   ++ +  +  I   Q  CR  L R   + +  A++ +Q+  R   A +  + L+ + +   EA  ++  +E   + +MS +KA EEAE++H+ RL Q+  E   DA+++LK+    +++   + + ER R++PV+ S+M+D++FG +   +   +P     AP  F DLE  R   + +        +P  L +  +ED+SE+ F KFAATYFQ      ++R+PL++PLL+H +   Q++ALAVWI ILRFM DLPEP  + + +  +  +P+MTKIY++LG++  K+++     E E Q+  G    ++     R  +V LTLKKKSK T+EV   L+D E+ +     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQI KQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ L+ KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDAISQCEQ+AKE+G  E  A WRLFFRKE+FTPWH+  +D VAT+LIY QV+RG+KFGEYRC+ +DD+ +L + Q  +D   ++  E L      Y+P   I   K  +K+    +    K +    R D   ++K+KE++V++AR KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ LELSFPEI+AVSSSR         ++    S +L+T+KG  YTF  +N+EDIRDL+V FLEGL++RS Y + +Q    P   +S FLS  KGDL+IL+ +D    +  S W  G N RTK+ GDFP D VY++P +  P + I+AL +   D+               + R K +TLEEFS  YFR P   + S  M    +    LW H+R+ LK  LLKKLL  E+L Q+A   F A+L YMGD PSK   S  E+ + IF+  LK E LKDE Y Q++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     LA++C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD CQNI +++ LK  +GF+LFVK  DK +S+PE DFFFDF+R L+DW+KK RP+KDG +    YQVFFMKKLWT TVPG D +AD +FHY QE+ KYL GYHK   ++ + LGALI R   ++D S   S  + L  L+P D++ +    + ++ ++A ++     S  +AK+AFLK+IF+WPTFGSAFFEVKQ+T  N PE +LIAINK GV LI  KTK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLT ++K
Sbjct:   11 VPIGAVVKLCDSGQVQVVDDEDNEHWISPQNATHIKPMHPTSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQYTNKKIGEMPPHIFAIADNCYFNMKRNSRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQALDERNYHVFYCMLEGMSEDQKKKLGLGQASDYNYLAMGNCITCEGRVDSQEYANIRSAMKVLMFTDTENWEISKLLAAILHLGNLQYEARTFENLDACEVLFSPSLATAASLLEVNPPDLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYKPPSQDV--------KNSR-RSIGLLDIFGFENFAVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLESIDWLHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDTTMLHKLNSQHKLNANYIPPKNNHETQFGINHFAGIVYYETQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSGMMETIRIRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQGDLRGTCQRMAEAVLGTHDDWQIGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLKLKNAATLIQRHWRGHNCRKNYGLMRLGFLRLQALHRSRKLHQQYRLARQRIIQFQARCRAYLVRKAFRHRLWAVLTVQAYARGMIARRLHQRLRAEYLWRLEAEKMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLARE---DAERELKEKEAARRKKELLEQMERARHEPVNHSDMVDKMFGFLG--TSGGLPGQEGQAPSGFEDLERGRREMVEE---DLDAALP--LPDEDEEDLSEYKFAKFAATYFQGTTTHSYTRRPLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRELQALQGEGEAQLPEGQKKSSV-----RHKLVHLTLKKKSKLTEEVTKRLHDGESTVQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAKELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHSPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYFVDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAHKKGIYAQRRTD---AQKVKEDVVSYARFKWPLLFSRFYEAYKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEIMAVSSSR--------GAKTTAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEESGFLSFAKGDLIILD-HDTGEQVMNSGWANGINERTKQRGDFPTDSVYVMPTVTMPPREIVALVTMTPDQRQDVVRLLQLRTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGKDRLWSHTREPLKQALLKKLLGSEELSQEACLAFIAVLKYMGDYPSKRTRSVNELTDQIFEGPLKAEPLKDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQNIATRLLLKSSEGFSLFVKIADKVLSVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSK 2158          
BLAST of Dach-1 vs. Ensembl Human
Match: MYO7A (myosin VIIA [Source:HGNC Symbol;Acc:HGNC:7606])

HSP 1 Score: 2130.52 bits (5519), Expect = 0.000e+0
Identity = 1123/2240 (50.13%), Postives = 1508/2240 (67.32%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPK-GYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAE-QMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNF------------------------------VSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSL-LALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            MV+ Q+GD VW++ +   +    VPIGA +K     Q+ V+DD+ +E  + P   T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYTYTG ILVAVNPY +L IY+P+ I+ Y N KIG++ PHIFAIADN Y NM+R SRDQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++ PILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q  DERNYHVFYCMLEG+  + + + GL  +  Y YL  G  I   G  D  ++  + SAMKVL FT+ E  EI +LLAA LHLGN+ ++A+   N+D+CEV        A+ LL+++  DL   LT++ +ITR + V T +S  Q +++RDA VKGIYGRLFVWIV+KIN AIY+P    V         NS+  SIG+LDIFGFENF  NSFEQLCIN+ANE+LQQFFVRH+FK+EQEEY  E IDW HI FTDNQ+ LD+I  K  NI++LIDEES+FPKGTD ++L+KL +    +  +I  K +    FGI HFAG+V+Y+  GFLEKNRD  + D+++L+ +++++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNEFKK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F++RYR+L+PG+  +++  D R T + + + +L     +QIGKTK+FLKD  D+LLE  RDKA+++R+IL+QK  R +  R+ FLK K+AA  IQ   R    R+ +  M+ GF  LQA  R++   ++ +  +  I   Q  CR  L R   + +  A++ +Q+  R   A +  + L+ + +   EA  ++  +E   + +MS +KA EEAE++H+ RL Q+  E   DA+++LK+    +++   + + ER R++PV+ S+M+D++FG +   +   +P     AP  F DLE  R   + +        +P  L +  +ED+SE+ F KFAATYFQ      ++R+PL++PLL+H +   Q++ALAVWI ILRFM DLPEP  + + +  +  +P+MTKIY++LG++  K+++     E E Q+  G    ++     R  +V LTLKKKSK T+EV   L+D E+ +     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQI KQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ L+ KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDAISQCEQ+AKE+G  E  A WRLFFRKE+FTPWH+  +D VAT+LIY QV+RG+KFGEYRC+ +DD+ +L + Q  +D   ++  E L      Y+P   I   K  +K+    +    K +    R D   ++K+KE++V++AR KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ LELSFPEI+AVSSSR                                   S   ++    S +L+T+KG  YTF  +N+EDIRDL+V FLEGL++RS Y + +Q    P   +S FLS  KGDL+IL+ +D    +  S W  G N RTK+ GDFP D VY++P +  P + I+AL +   D+               + R K +TLEEFS  YFR P   + S  M    +    LW H+R+ LK  LLKKLL  E+L Q+A   F A+L YMGD PSK   S  E+ + IF+  LK E LKDE Y Q++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     LA++C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD CQNI +++ LK  +GF+LFVK  DK +S+PE DFFFDF+R L+DW+KK RP+KDG +    YQVFFMKKLWT TVPG D +AD +FHY QE+ KYL GYHK   ++ + LGALI R   ++D S   S  + L  L+P D++ +    + ++ ++A ++     S  +AK+AFLK+IF+WPTFGSAFFEVKQ+T  N PE +LIAINK GV LI  KTK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLT ++K
Sbjct:    1 MVILQQGDHVWMDLRLGQEFD--VPIGAVVKLCDSGQVQVVDDEDNEHWISPQNATHIKPMHPTSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQYTNKKIGEMPPHIFAIADNCYFNMKRNSRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQALDERNYHVFYCMLEGMSEDQKKKLGLGQASDYNYLAMGNCITCEGRVDSQEYANIRSAMKVLMFTDTENWEISKLLAAILHLGNLQYEARTFENLDACEVLFSPSLATAASLLEVNPPDLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYKPPSQDV--------KNSR-RSIGLLDIFGFENFAVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLESIDWLHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDTTMLHKLNSQHKLNANYIPPKNNHETQFGINHFAGIVYYETQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSGMMETIRIRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQGDLRGTCQRMAEAVLGTHDDWQIGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLKLKNAATLIQRHWRGHNCRKNYGLMRLGFLRLQALHRSRKLHQQYRLARQRIIQFQARCRAYLVRKAFRHRLWAVLTVQAYARGMIARRLHQRLRAEYLWRLEAEKMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLARE---DAERELKEKEAARRKKELLEQMERARHEPVNHSDMVDKMFGFLG--TSGGLPGQEGQAPSGFEDLERGRREMVEE---DLDAALP--LPDEDEEDLSEYKFAKFAATYFQGTTTHSYTRRPLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRELQALQGEGEAQLPEGQKKSSV-----RHKLVHLTLKKKSKLTEEVTKRLHDGESTVQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAKELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHSPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYFVDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAHKKGIYAQRRTD---AQKVKEDVVSYARFKWPLLFSRFYEAYKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEIMAVSSSRECRVWLSLGCSDLGCAAPHSGWAGLTPAGPCSPCWSCRGAKTTAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEESGFLSFAKGDLIILD-HDTGEQVMNSGWANGINERTKQRGDFPTDSVYVMPTVTMPPREIVALVTMTPDQRQDVVRLLQLRTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGKDRLWSHTREPLKQALLKKLLGSEELSQEACLAFIAVLKYMGDYPSKRTRSVNELTDQIFEGPLKAEPLKDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQNIATRLLLKSSEGFSLFVKIADKVLSVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSK 2207          
BLAST of Dach-1 vs. Ensembl Human
Match: MYO7B (myosin VIIB [Source:HGNC Symbol;Acc:HGNC:7607])

HSP 1 Score: 1675.6 bits (4338), Expect = 0.000e+0
Identity = 933/2229 (41.86%), Postives = 1339/2229 (60.07%), Query Frame = 3
Query:  177 GDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPG--TKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDF---KMGF----------------DTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVP-GIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLK-DLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRN--QPVDESEMLDEIFG----SIDGYSVKSVPNSLSHAPRAFRDLELSRMNALN-DVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEY----RCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQ-AFSKPDSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS----DRSFGDSYGGGSNNNHNDSRGKQ-HTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKN-YSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLY---RELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMG-KLIQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQ-LEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            GD VW+E  S+ KT   V IG  IK+    ++ V DD+G E  ++      +  MH +S+QGVDDMI LGDLNEAG++ NLLIRY++++IYTYTG ILVAVNP+ VLP+YT ++++ Y +  +G+L PH+FAIA+N Y +M+R  RDQ  IISGESGAGKTE+TKLILQFLA +SGQHSWIEQQVL++NPILEAFGNAKTIRNDNSSRFGKYIDIYF  +G IEGA+I+QFLLEKSR+  Q  +ERNYH+FYCML G+  E +    L     Y YL  G      G  D  D+  + SAMK+L F++ E  ++ +LLAA LHLGN+ F A +  N+D+ +V     F    KLL++  ++LR  L    I+ R +FV  +++IAQ  + RDA VKGIYG LF+WIV+KIN AI+ P  +Q PK+   A        IG+LDIFGFENF+NNSFEQLCIN+ANE+LQQFFV+H+F MEQEEY +E I W +I +TDN+ TLDL+ +K  +I++L+DEESRFP+GTD ++L KL +  + +  F++ K      FGI HFAG V+YQ +GFLEKNRD  + D++ L+ ++K++FL+ +F  +    K+G                 D+ KR  TLG QF++SLD LMKIL   +P+F+RCIKPNE+KK L FDR LCLRQLRYSGMMET+ IRK+G+PIR+ F +F  R+ +L+P  +    + K  + T  +    +   K ++ GKTK+FL+D QD LLE  R + L    + IQK  R Y +R                       ++F++ ++    LQA +R     +  K  L GF R +Q   R +      +   +  +++Q+  R +   +                          + Q               M   +   +  A+A   +       Q    A++RR+    V ++EM++++FG     I G   ++ P+        F DLE      L  D+ ++     P+  V+ L    +E+TF KFA TYFQK       R+PLR PLL+H +    ++AL +W  ILRFM DLPEP++    + Q +SV  M +I+ +LGR+   Q               +P  + S                     +V + LN  E  L    L +   +RP SNLEK+HFI+G  IL P LRDEIYCQICKQL++N +  S++RG ILL+LC+GCF P+E+F++ L NFI         F   RL+RT++NG R +PP+WLEL+A+K K+ I + V    G + T+  DSAST++E+C  ++ K  L D  GFSL +A+ DK  S+GSG DH+MDAI++CEQ A+E+G+ + ++ WR++FRKE FTPWH+S +D V+T+LIY QV+RG+  GEY      +  + + + C  QL          E L   +P  +   TK   + W +L+  A      T ++  ++   ++E++V  ARL+WP+LFSR +E I  SGP L   ++I  +NW G+  +D  E++ LELSFPE++ ++++R             GQ L LST+    Y F   +S  I +L+  FLEGLKERS +A+ +Q   +  D++ L+ +KGDLL+L     +  + + +W  G+N RT + G  P   +Y +P +  PS  +L+L +     R      G  +     +   ++ HTLEEFS  +FR P     S  +    +  G+LW +S + L+ PLLK++    DL   A   F AIL YMGD PS+  + + E+ + IF   L+H  L+DEVYCQ++ Q+T N N  SE+ GW+L+WL TG+  P+  L    ++ ++  R    LLA +C  R+QK L+ G R+ PPH +E+ A +     I HKIYFPN++ +  E+ +NT+ +D+C +I +++ L  ++G +LF+K  DK IS  EGDFFFD +R++SDWVKK++P K+G  +   YQV+FM+KLW N  PG D  AD + HY QE+ KYL G+HK   +DAI L  LI +A  + D S+L S  + L  L+P ++       E ++ +L  Y   +  +  +AK+AFLK I +WPTFGSAFFEVKQ++  + P+ ILIAIN++GV LIH KTK+ L  YP++ IS+WSSG+TYF+M +G+L  G +LLCET LGYKMDDLLTSY+  +L+ + K
Sbjct:    7 GDHVWLEPPSTHKTG--VAIGGIIKEAKPGKVLVEDDEGKEHWIRAEDFGVLSPMHPNSVQGVDDMIRLGDLNEAGMVHNLLIRYQQHKIYTYTGSILVAVNPFQVLPLYTLEQVQLYYSRHMGELPPHVFAIANNCYFSMKRNKRDQCCIISGESGAGKTETTKLILQFLATISGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIYFNPSGVIEGARIEQFLLEKSRVCRQAPEERNYHIFYCMLMGVSAEDKQLLSLGTPSEYHYLTMGNCTSCEGLNDAKDYAHIRSAMKILQFSDSESWDVIKLLAAILHLGNVGFMASVFENLDASDVMETPAFPTVMKLLEVQHQELRDCLIKHTILIRGEFVTRSLNIAQAADRRDAFVKGIYGHLFLWIVKKINAAIFTPP-AQDPKNVRRA--------IGLLDIFGFENFENNSFEQLCINFANEHLQQFFVQHVFTMEQEEYRSENISWDYIHYTDNRPTLDLLALKPMSIISLLDEESRFPQGTDLTMLQKLNSVHANNKAFLQPKNIHDARFGIAHFAGEVYYQAEGFLEKNRDVLSTDILTLVYSSKNKFLREIFNLELAETKLGHGTIRQAKAGNHLFKSADSNKRPSTLGSQFKQSLDQLMKILTNCQPYFIRCIKPNEYKKPLLFDRELCLRQLRYSGMMETVHIRKSGFPIRYTFEEFSQRFGVLLPNAMRMQLQGKLRQMTLGITDVWLRTDKDWKAGKTKIFLRDHQDTLLEVQRSQVLDRAALSIQKVLRGYRYR-----------------------KEFLRQRRAAVTLQAWWRGYCNRRNFKLILVGFER-LQAIARSQPLARQYQAMRQRTVQLQALCRGYLVRQ--------------------------QVQAKRRAVVVIQAHARGMAARRNFQQRKANAPLVIPAEGQKSQGALPAKKRRSIYDTVTDTEMVEKVFGFLPAMIGGQEGQASPH--------FEDLESKTQKLLEVDLDTVPMAEEPEEDVDGL----AEYTFPKFAVTYFQKSASHTHIRRPLRYPLLYHEDDTDCLAALVIWNVILRFMGDLPEPVLYARSSQQGSSV--MRQIHDTLGREHGAQ---------------VPQHSRSA--------------------QVASQLNIGEEALEPDGLGA---DRPMSNLEKVHFIVGYAILRPSLRDEIYCQICKQLSENFKTSSLARGWILLSLCLGCFPPSERFMKYLLNFIGQGPATYGPFCAERLRRTYANGVRAEPPTWLELQAVKSKKHIPIQVILATGESLTVPVDSASTSREMCMHIAHKQGLSDHLGFSLQVAVYDKFWSLGSGRDHMMDAIARCEQMAQERGESQRQSPWRIYFRKEFFTPWHDSREDPVSTELIYRQVLRGVWSGEYSFEKEEELVELLARHCYVQLGASAESKAVQELLPSCIPHKLY-RTKPPDR-WASLVTAACAKAPYTQKQ--VTPLAVREQVVDAARLQWPLLFSRLFEVITLSGPRLPKTQLILAVNWKGLCFLDQQEKMLLELSFPEVMGLATNREAQ---------GGQRLLLSTMH-EEYEFVSPSSVAIAELVALFLEGLKERSIFAMALQDRKATDDTTLLAFKKGDLLVLTKKQGL--LASENWTLGQNDRTGKTGLVPMACLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQFTEPRPEEPPKEKLHTLEEFSYEFFRAPEKDMVSMAVLPLARARGHLWAYSCEPLRQPLLKRVHANVDLWDIACQIFVAILRYMGDYPSRQAWPTLELTDQIFTLALQHPALQDEVYCQILKQLTHNSNRHSEERGWQLLWLCTGLFPPSKGLLPHAQKFIDTRR--GKLLAPDCSRRIQKVLRTGPRKQPPHQVEVEAAEQNVSRICHKIYFPNDTSEMLEVVANTRVRDVCDSIATRLQLASWEGCSLFIKISDKVISQKEGDFFFDSLREVSDWVKKNKPQKEGAPVTLPYQVYFMRKLWLNISPGKDVNADTILHYHQELPKYLRGFHKCSREDAIHLAGLIYKAQFNNDRSQLASVPKILRELVPENLTRLMSSEEWKKSILLAYDKHKDKTVEEAKVAFLKWICRWPTFGSAFFEVKQTSEPSYPDVILIAINRHGVLLIHPKTKDLLTTYPFTKISSWSSGSTYFHMALGSLGRGSRLLCETSLGYKMDDLLTSYVQQLLSAMNK 2104          
BLAST of Dach-1 vs. Ensembl Human
Match: MYO7B (myosin VIIB [Source:HGNC Symbol;Acc:HGNC:7607])

HSP 1 Score: 1675.6 bits (4338), Expect = 0.000e+0
Identity = 933/2229 (41.86%), Postives = 1339/2229 (60.07%), Query Frame = 3
Query:  177 GDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPG--TKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDF---KMGF----------------DTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVP-GIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLK-DLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRN--QPVDESEMLDEIFG----SIDGYSVKSVPNSLSHAPRAFRDLELSRMNALN-DVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEY----RCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQ-AFSKPDSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS----DRSFGDSYGGGSNNNHNDSRGKQ-HTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKN-YSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLY---RELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMG-KLIQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQ-LEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            GD VW+E  S+ KT   V IG  IK+    ++ V DD+G E  ++      +  MH +S+QGVDDMI LGDLNEAG++ NLLIRY++++IYTYTG ILVAVNP+ VLP+YT ++++ Y +  +G+L PH+FAIA+N Y +M+R  RDQ  IISGESGAGKTE+TKLILQFLA +SGQHSWIEQQVL++NPILEAFGNAKTIRNDNSSRFGKYIDIYF  +G IEGA+I+QFLLEKSR+  Q  +ERNYH+FYCML G+  E +    L     Y YL  G      G  D  D+  + SAMK+L F++ E  ++ +LLAA LHLGN+ F A +  N+D+ +V     F    KLL++  ++LR  L    I+ R +FV  +++IAQ  + RDA VKGIYG LF+WIV+KIN AI+ P  +Q PK+   A        IG+LDIFGFENF+NNSFEQLCIN+ANE+LQQFFV+H+F MEQEEY +E I W +I +TDN+ TLDL+ +K  +I++L+DEESRFP+GTD ++L KL +  + +  F++ K      FGI HFAG V+YQ +GFLEKNRD  + D++ L+ ++K++FL+ +F  +    K+G                 D+ KR  TLG QF++SLD LMKIL   +P+F+RCIKPNE+KK L FDR LCLRQLRYSGMMET+ IRK+G+PIR+ F +F  R+ +L+P  +    + K  + T  +    +   K ++ GKTK+FL+D QD LLE  R + L    + IQK  R Y +R                       ++F++ ++    LQA +R     +  K  L GF R +Q   R +      +   +  +++Q+  R +   +                          + Q               M   +   +  A+A   +       Q    A++RR+    V ++EM++++FG     I G   ++ P+        F DLE      L  D+ ++     P+  V+ L    +E+TF KFA TYFQK       R+PLR PLL+H +    ++AL +W  ILRFM DLPEP++    + Q +SV  M +I+ +LGR+   Q               +P  + S                     +V + LN  E  L    L +   +RP SNLEK+HFI+G  IL P LRDEIYCQICKQL++N +  S++RG ILL+LC+GCF P+E+F++ L NFI         F   RL+RT++NG R +PP+WLEL+A+K K+ I + V    G + T+  DSAST++E+C  ++ K  L D  GFSL +A+ DK  S+GSG DH+MDAI++CEQ A+E+G+ + ++ WR++FRKE FTPWH+S +D V+T+LIY QV+RG+  GEY      +  + + + C  QL          E L   +P  +   TK   + W +L+  A      T ++  ++   ++E++V  ARL+WP+LFSR +E I  SGP L   ++I  +NW G+  +D  E++ LELSFPE++ ++++R             GQ L LST+    Y F   +S  I +L+  FLEGLKERS +A+ +Q   +  D++ L+ +KGDLL+L     +  + + +W  G+N RT + G  P   +Y +P +  PS  +L+L +     R      G  +     +   ++ HTLEEFS  +FR P     S  +    +  G+LW +S + L+ PLLK++    DL   A   F AIL YMGD PS+  + + E+ + IF   L+H  L+DEVYCQ++ Q+T N N  SE+ GW+L+WL TG+  P+  L    ++ ++  R    LLA +C  R+QK L+ G R+ PPH +E+ A +     I HKIYFPN++ +  E+ +NT+ +D+C +I +++ L  ++G +LF+K  DK IS  EGDFFFD +R++SDWVKK++P K+G  +   YQV+FM+KLW N  PG D  AD + HY QE+ KYL G+HK   +DAI L  LI +A  + D S+L S  + L  L+P ++       E ++ +L  Y   +  +  +AK+AFLK I +WPTFGSAFFEVKQ++  + P+ ILIAIN++GV LIH KTK+ L  YP++ IS+WSSG+TYF+M +G+L  G +LLCET LGYKMDDLLTSY+  +L+ + K
Sbjct:    7 GDHVWLEPPSTHKTG--VAIGGIIKEAKPGKVLVEDDEGKEHWIRAEDFGVLSPMHPNSVQGVDDMIRLGDLNEAGMVHNLLIRYQQHKIYTYTGSILVAVNPFQVLPLYTLEQVQLYYSRHMGELPPHVFAIANNCYFSMKRNKRDQCCIISGESGAGKTETTKLILQFLATISGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIYFNPSGVIEGARIEQFLLEKSRVCRQAPEERNYHIFYCMLMGVSAEDKQLLSLGTPSEYHYLTMGNCTSCEGLNDAKDYAHIRSAMKILQFSDSESWDVIKLLAAILHLGNVGFMASVFENLDASDVMETPAFPTVMKLLEVQHQELRDCLIKHTILIRGEFVTRSLNIAQAADRRDAFVKGIYGHLFLWIVKKINAAIFTPP-AQDPKNVRRA--------IGLLDIFGFENFENNSFEQLCINFANEHLQQFFVQHVFTMEQEEYRSENISWDYIHYTDNRPTLDLLALKPMSIISLLDEESRFPQGTDLTMLQKLNSVHANNKAFLQPKNIHDARFGIAHFAGEVYYQAEGFLEKNRDVLSTDILTLVYSSKNKFLREIFNLELAETKLGHGTIRQAKAGNHLFKSADSNKRPSTLGSQFKQSLDQLMKILTNCQPYFIRCIKPNEYKKPLLFDRELCLRQLRYSGMMETVHIRKSGFPIRYTFEEFSQRFGVLLPNAMRMQLQGKLRQMTLGITDVWLRTDKDWKAGKTKIFLRDHQDTLLEVQRSQVLDRAALSIQKVLRGYRYR-----------------------KEFLRQRRAAVTLQAWWRGYCNRRNFKLILVGFER-LQAIARSQPLARQYQAMRQRTVQLQALCRGYLVRQ--------------------------QVQAKRRAVVVIQAHARGMAARRNFQQRKANAPLVIPAEGQKSQGALPAKKRRSIYDTVTDTEMVEKVFGFLPAMIGGQEGQASPH--------FEDLESKTQKLLEVDLDTVPMAEEPEEDVDGL----AEYTFPKFAVTYFQKSASHTHIRRPLRYPLLYHEDDTDCLAALVIWNVILRFMGDLPEPVLYARSSQQGSSV--MRQIHDTLGREHGAQ---------------VPQHSRSA--------------------QVASQLNIGEEALEPDGLGA---DRPMSNLEKVHFIVGYAILRPSLRDEIYCQICKQLSENFKTSSLARGWILLSLCLGCFPPSERFMKYLLNFIGQGPATYGPFCAERLRRTYANGVRAEPPTWLELQAVKSKKHIPIQVILATGESLTVPVDSASTSREMCMHIAHKQGLSDHLGFSLQVAVYDKFWSLGSGRDHMMDAIARCEQMAQERGESQRQSPWRIYFRKEFFTPWHDSREDPVSTELIYRQVLRGVWSGEYSFEKEEELVELLARHCYVQLGASAESKAVQELLPSCIPHKLY-RTKPPDR-WASLVTAACAKAPYTQKQ--VTPLAVREQVVDAARLQWPLLFSRLFEVITLSGPRLPKTQLILAVNWKGLCFLDQQEKMLLELSFPEVMGLATNREAQ---------GGQRLLLSTMH-EEYEFVSPSSVAIAELVALFLEGLKERSIFAMALQDRKATDDTTLLAFKKGDLLVLTKKQGL--LASENWTLGQNDRTGKTGLVPMACLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQFTEPRPEEPPKEKLHTLEEFSYEFFRAPEKDMVSMAVLPLARARGHLWAYSCEPLRQPLLKRVHANVDLWDIACQIFVAILRYMGDYPSRQAWPTLELTDQIFTLALQHPALQDEVYCQILKQLTHNSNRHSEERGWQLLWLCTGLFPPSKGLLPHAQKFIDTRR--GKLLAPDCSRRIQKVLRTGPRKQPPHQVEVEAAEQNVSRICHKIYFPNDTSEMLEVVANTRVRDVCDSIATRLQLASWEGCSLFIKISDKVISQKEGDFFFDSLREVSDWVKKNKPQKEGAPVTLPYQVYFMRKLWLNISPGKDVNADTILHYHQELPKYLRGFHKCSREDAIHLAGLIYKAQFNNDRSQLASVPKILRELVPENLTRLMSSEEWKKSILLAYDKHKDKTVEEAKVAFLKWICRWPTFGSAFFEVKQTSEPSYPDVILIAINRHGVLLIHPKTKDLLTTYPFTKISSWSSGSTYFHMALGSLGRGSRLLCETSLGYKMDDLLTSYVQQLLSAMNK 2104          
BLAST of Dach-1 vs. Ensembl Celegans
Match: hum-6 (Unconventional myosin heavy chain 6 [Source:UniProtKB/Swiss-Prot;Acc:P91443])

HSP 1 Score: 983.786 bits (2542), Expect = 0.000e+0
Identity = 533/1203 (44.31%), Postives = 758/1203 (63.01%), Query Frame = 3
Query: 3177 LDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQA-NSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNF---RDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRID----NVKDLSDETLHKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPD--SSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYF--RTPSSGSRSFTMSLGKQVAG-NLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYS-STEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVK-KHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHC-DKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLI---HGRKLLCETPLGYKMDDLLTSYISLMLT 6713
            +DED+S++ F K+AAT+FQ        +KPL+  LL H+ P+ Q++AL  W  ILRFM DL +     +  S+  +  P+M K+Y +LG++F+  D+    EEA   +     + L     RK ++S+TLK+K K      + ++         + +++LE +P ++L+KLH+IIG GIL  +LRDEIYCQ+CKQL++NP   S +RG ILL+LC+GCFAP+E+F++ L  FI+         +K+I  RL+RT  NGTR+QPPS++EL+A K ++P++LAV  M+G+ +T+ ADSA+TA ELC  L++K+ L + FGFSL+IA+ DKVSS+GSG DHVMDAISQCEQ+AKE+G+ E  A WRLFFRKEIF+PWH+  DD V+T+LIY QVIRGIK+GEYRCD D+++  +CA Q  ID    +V  L +  L  YLP   +   +   + W   +    +          I   ++KE +V+ A+ KWP+LFSRFYEA+KF+GP L  NEVI  +NWTG+Y+VD  E + LE SFPEI      +          R    + ++ TV G  YTF   N++DI +LIV FLEGLK+RS Y + +++  K D  ++FL  EKGDLLIL        + T     GEN RT   G   A+ VY+LP +  PS+N L +F    D S  D +         D   + +TLE F++  F  +    GS+   M+L K+ +    W+ SR+ +  PLLKKL  +ED C+ A+  F+AI+ YMGD+PSK     T + + IF   +  E L+DE+YCQL+ Q+T NP+  SE+ GWEL+W+ATG+  P++ L +E+    +S    +AL+CQ R+QK  K G R+YPPH +E+ A+Q     I HK++FP+ + +A E+ S T+ +D C  I  ++GLK   GF+LFVK  DK +++PE +FFFD++R LSDWV   H   KD  +    YQV+FM+KLW N V G D  ADI+FHY QE +KYL GYHK    D I L ALILR+   D   + L    + LD +IP D L  Y  +E ++ +   Y     +  + AKI FL  I +WPTFGSAFF V Q +++N+P+++L+AIN+ GV + H  TK  L  YP++ I NW+SGNTYFNMT+GN++    G+KLL +T +GYKMDDLLTSYISL+++
Sbjct:  904 VDEDLSKYQFGKYAATFFQAQATATHVKKPLKTALLTHTEPSAQLAALTAWTTILRFMGDLADVKPGSTNGSEVYDKTPVMIKLYATLGKKFSAHDL----EEAMLSSEYGGAKTLKKGMGRK-LISMTLKRKGKINGSDTSSISSDSV---YSSFNAMLENKPMTSLDKLHYIIGLGILREDLRDEIYCQLCKQLSNNPSKLSAARGWILLSLCVGCFAPSERFIKYLFCFIRERGPAGTGYSKYIEDRLRRTQVNGTRHQPPSYVELQANKSQKPVVLAVTFMDGSVKTLCADSATTAAELCKQLAEKVGLTNSFGFSLYIALFDKVSSLGSGTDHVMDAISQCEQYAKEQGRQERNAPWRLFFRKEIFSPWHDPRDDPVSTNLIYQQVIRGIKYGEYRCDKDEELAAICAQQYYIDEGTMDVNKL-ENNLPSYLPDFEMSGKEMALEKWTQTIMHQYRKKFTGRLPSQI---EVKENVVSVAKTKWPLLFSRFYEALKFAGPPLPKNEVIIAVNWTGVYVVDDREHVMLEFSFPEISTAYYGK--------GKRSTTDTCTVRTVVGDEYTFQSPNADDITNLIVMFLEGLKKRSRYLVAIKS-QKGDEKNNFLEFEKGDLLILVNEFTGNTLLTESVVKGENSRTCLFGLIRAENVYVLPTLVKPSKNTLQIFPKDMDLSL-DLFNNNKQVTVVDYNAEPYTLENFAEDNFNSQVKRVGSQISLMTLRKKESQIECWRFSREHIDQPLLKKLNGREDACRGAIEIFAAIMKYMGDEPSKRSRLGTHLTDHIFKLPISMEALRDELYCQLVKQLTLNPSIMSEERGWELLWMATGLFAPSAALAKEISHFLKSRPHPIALDCQNRMQKLAKGGSRKYPPHLVEVEAIQHKTTQIFHKVFFPDNTDEAIEVDSATRARDFCHKIGYRLGLKSSDGFSLFVKIKDKVLAVPESEFFFDYVRSLSDWVHTNHATQKDATMIPINYQVYFMRKLWYNFVAGADPQADIIFHYHQESQKYLLGYHKTTKNDVIELAALILRSMTKDGKNAPLAQIPQLLDEIIPKDSLKMYSASEWRKTISNAYARIEHLKSDQAKIEFLNYICRWPTFGSAFFPVSQYSDLNLPDRLLLAINQTGVNIYHLDTKNLLVQYPFNVICNWTSGNTYFNMTVGNMLKGNEGKKLLLDTTVGYKMDDLLTSYISLLIS 2084          

HSP 2 Score: 870.922 bits (2249), Expect = 0.000e+0
Identity = 442/847 (52.18%), Postives = 584/847 (68.95%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKG-YQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTK 2696
            MV+  KGDF+WIE     KT   +PIGA++ D    ++ VIDD G+E  L    ++R MH +S+QGV+DM  LGD +E+ ILRNL IRY+   IY YTG IL+AVNPY  + IYT  EI+ YK  +IG+L PHIFAIADNAY NMRR  ++QS+IISGESGAGKTESTKL+LQFLA +SGQHSWIEQQVL++NP+LEAFGNAKTIRNDNSSRFGKYID++F  +G+IEGAKI+Q+LLEKSRIV+Q  +ERNYH+FYC+L GL  E +S   L  +  Y YL QG  +   G  D  D   + SAM+VL   E E   IF+LLA+ LH+GNI F+     NM+S +V+  S     +KLLQL  ++L  A+TTK+++TR++ V++ ++  Q ++ RDAL K IYG+LF+ IV ++N AIY+P             S S+ TSIG+LDIFGFENF++NSFEQLCIN+ANE LQQFFV H+FKMEQ+EY  E I+W+HI F DNQ T+DLI  +  NIL+LIDEES FPKGTD ++L KL +T  ++  +++ K+++ + FG+ HFAG V Y   GFLEKNRD F+ADL  LI ++K  FL  LF+ D +    +RK+  T+G QFR+SL+ LM  L +  PFF+RCIKPNE K+ L  DR L LRQLRYSGMMETI+IR++GYPIRH++  F+ RYR+LV  I       D  +  K +C  IL     YQ+GKTK+FLKD  D++LE    + L ++ I+IQK  R++  R  F K++ AA+ IQT  R    R+++ ++  GF  LQA  R++      + L+  I   Q  CRG L R  + +K K
Sbjct:    1 MVLVSKGDFIWIE---PGKTEGSIPIGARVIDQDHGRLKVIDDLGNEQWLSADRRVRLMHPTSVQGVEDMCQLGDFHESAILRNLFIRYREKLIYAYTGSILIAVNPYMDIAIYTADEIRMYKRKRIGELPPHIFAIADNAYTNMRREKKNQSVIISGESGAGKTESTKLVLQFLATISGQHSWIEQQVLEANPVLEAFGNAKTIRNDNSSRFGKYIDVHFNESGSIEGAKIEQYLLEKSRIVTQSENERNYHIFYCLLAGLSREEKSELELGTAADYYYLIQGKTLTAEGRDDAADLAEIRSAMRVLMINEQEIGSIFKLLASLLHIGNIRFRQNTNDNMESVDVADPSTLVRIAKLLQLHEQNLLDAITTKSLVTREERVISRLNGQQAVDARDALAKAIYGKLFIHIVRRVNDAIYKP-------------SQSRRTSIGILDIFGFENFESNSFEQLCINFANETLQQFFVHHVFKMEQKEYDEEHINWRHIKFVDNQATVDLIAQRPLNILSLIDEESIFPKGTDKTMLLKLHSTHGRNELYLQPKSELQRAFGVTHFAGNVFYNTRGFLEKNRDSFSADLSVLISSSKMPFLARLFD-DIEYDTSSRKKV-TVGNQFRRSLEQLMSQLTQTHPFFIRCIKPNEMKRALVMDRDLVLRQLRYSGMMETIKIRRSGYPIRHDYYPFVFRYRVLVSSIQGPVNRIDLHDAAKKICHMILGTNADYQLGKTKVFLKDKHDLVLEQEYYRILKDKAIVIQKNVRRWLVRKDFEKQRQAAVTIQTAWRGFDQRKRYRQIISGFSRLQAVLRSRQLVSHYQTLRKTIIQFQAVCRGSLVRRQVGEKRK 829          
BLAST of Dach-1 vs. Ensembl Celegans
Match: hum-5 (Heavy chain, Unconventional Myosin; Myosin IA [Source:UniProtKB/TrEMBL;Acc:G5ECZ0])

HSP 1 Score: 488.034 bits (1255), Expect = 1.597e-147
Identity = 278/745 (37.32%), Postives = 425/745 (57.05%), Query Frame = 3
Query:  354 GVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVS-----GQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGL-RASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMK-VLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEE-SRFPKGTDHSLLNKLVNTCSKHPRF----IKQ--KADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGI-PSSFRCKDTRETTKLVCKNILDPKGYQ----IGKTKLFLKDAQDIL-LEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKL 2528
            GV+D++ L  ++   +++NL +R+++  IYTY G +LVAVNPY  L IY    +  YK  +I + +PH+FAIAD AY +M+R  RD  I+ISGESGAGKTE++K+I+++LAA++     G+   ++  +L SN ILEAFG AKT RNDNSSRFGKY+ I F  +G   G  I  +LLEKSR+V Q   ERN+HVFY ++ G       +FGL + +  Y +LNQG    +    D  DF  + +A++ + TF + + + ++ ++A  +HLGN+ F    E +  +  ++  +    A++ L +  ++L K+L+++ +    D V     +      RDAL K +Y RLF W+V K+N AI          S  N+   SK   IGVLDI+GFE F  NSFEQLCINY NE LQQ F+  + K EQEEY  E I W  I + +N+   DL+ +    IL+++DE  +     TD   L +L      H  +    +KQ  K+   + F I H+AG V Y + GF++KN+D    DL  L+  +K++ +K LF    K   +  +R PT G  F+ S+  L+K L ++EP ++RCIKPNE K    FD      Q+RY G++E +R+R+AG+  R  +  F++RY+++     P+  R +  +++    C  IL+  G       G+TK+F++  Q +  LE+LR + L N I  +QK  R    R ++ +  +    I  + R KL
Sbjct:   12 GVEDLVLLSTIDLKSVVQNLQLRFQKGRIYTYIGEVLVAVNPYRQLGIYEKSTVDQYKGREIYERAPHVFAIADAAYRSMKRFGRDSCIVISGESGAGKTETSKIIMKYLAAITNVRQQGEIERVKNVLLRSNCILEAFGCAKTTRNDNSSRFGKYMHINFDYDGDPVGGNISNYLLEKSRVVRQQEGERNFHVFYQLVNGGDDGLLRQFGLTKDAKQYYFLNQGQSHKVASINDSRDFAEVQTALRSIHTFDKQDVESMWSVIAGLIHLGNVRF-IDGENSSGAVHIAEKAALQNAARCLNVTPDELAKSLSSQVVAAHGDIVKKQHDVNAAYYTRDALAKALYERLFSWMVSKVNEAI----------SVQNSSRYSKSHVIGVLDIYGFEIFGTNSFEQLCINYCNEKLQQLFIELVLKQEQEEYEREGIKWVKIEYFNNKVICDLVEIPRTGILSILDEACASIGNVTDKVFLGELDKKLKSHKHYTSRNLKQSDKSMGFEEFKITHYAGDVTYSVMGFMDKNKDTLFQDLKRLLYHSKNRLVKSLFPDGSKSMAEVNRRPPTAGFLFKNSMSELVKQLAQKEPHYIRCIKPNEEKNSNVFDLERVEHQVRYLGLLENVRVRRAGFAHRMPYDRFVNRYKLICASTWPNPRRGQQLKDS----CMQILESAGLAQDCVQGRTKIFIRSPQTVFRLEELRTEQLPNVITFLQKMVRGVQQRERYRRMLAVRKIIGAYRRYKL 741          
BLAST of Dach-1 vs. Ensembl Celegans
Match: hum-5 (Heavy chain, Unconventional Myosin; Myosin IA [Source:UniProtKB/TrEMBL;Acc:G5ECZ0])

HSP 1 Score: 488.034 bits (1255), Expect = 1.597e-147
Identity = 278/745 (37.32%), Postives = 425/745 (57.05%), Query Frame = 3
Query:  354 GVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVS-----GQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGL-RASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMK-VLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEE-SRFPKGTDHSLLNKLVNTCSKHPRF----IKQ--KADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGI-PSSFRCKDTRETTKLVCKNILDPKGYQ----IGKTKLFLKDAQDIL-LEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKL 2528
            GV+D++ L  ++   +++NL +R+++  IYTY G +LVAVNPY  L IY    +  YK  +I + +PH+FAIAD AY +M+R  RD  I+ISGESGAGKTE++K+I+++LAA++     G+   ++  +L SN ILEAFG AKT RNDNSSRFGKY+ I F  +G   G  I  +LLEKSR+V Q   ERN+HVFY ++ G       +FGL + +  Y +LNQG    +    D  DF  + +A++ + TF + + + ++ ++A  +HLGN+ F    E +  +  ++  +    A++ L +  ++L K+L+++ +    D V     +      RDAL K +Y RLF W+V K+N AI          S  N+   SK   IGVLDI+GFE F  NSFEQLCINY NE LQQ F+  + K EQEEY  E I W  I + +N+   DL+ +    IL+++DE  +     TD   L +L      H  +    +KQ  K+   + F I H+AG V Y + GF++KN+D    DL  L+  +K++ +K LF    K   +  +R PT G  F+ S+  L+K L ++EP ++RCIKPNE K    FD      Q+RY G++E +R+R+AG+  R  +  F++RY+++     P+  R +  +++    C  IL+  G       G+TK+F++  Q +  LE+LR + L N I  +QK  R    R ++ +  +    I  + R KL
Sbjct:   12 GVEDLVLLSTIDLKSVVQNLQLRFQKGRIYTYIGEVLVAVNPYRQLGIYEKSTVDQYKGREIYERAPHVFAIADAAYRSMKRFGRDSCIVISGESGAGKTETSKIIMKYLAAITNVRQQGEIERVKNVLLRSNCILEAFGCAKTTRNDNSSRFGKYMHINFDYDGDPVGGNISNYLLEKSRVVRQQEGERNFHVFYQLVNGGDDGLLRQFGLTKDAKQYYFLNQGQSHKVASINDSRDFAEVQTALRSIHTFDKQDVESMWSVIAGLIHLGNVRF-IDGENSSGAVHIAEKAALQNAARCLNVTPDELAKSLSSQVVAAHGDIVKKQHDVNAAYYTRDALAKALYERLFSWMVSKVNEAI----------SVQNSSRYSKSHVIGVLDIYGFEIFGTNSFEQLCINYCNEKLQQLFIELVLKQEQEEYEREGIKWVKIEYFNNKVICDLVEIPRTGILSILDEACASIGNVTDKVFLGELDKKLKSHKHYTSRNLKQSDKSMGFEEFKITHYAGDVTYSVMGFMDKNKDTLFQDLKRLLYHSKNRLVKSLFPDGSKSMAEVNRRPPTAGFLFKNSMSELVKQLAQKEPHYIRCIKPNEEKNSNVFDLERVEHQVRYLGLLENVRVRRAGFAHRMPYDRFVNRYKLICASTWPNPRRGQQLKDS----CMQILESAGLAQDCVQGRTKIFIRSPQTVFRLEELRTEQLPNVITFLQKMVRGVQQRERYRRMLAVRKIIGAYRRYKL 741          
BLAST of Dach-1 vs. Ensembl Celegans
Match: hum-1 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:Q19901])

HSP 1 Score: 490.345 bits (1261), Expect = 2.184e-147
Identity = 283/742 (38.14%), Postives = 419/742 (56.47%), Query Frame = 3
Query:  318 TKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSG-----QHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNI----ITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKN-CNILALIDEESRFP----KGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNI-LDPKGYQIGKTKLFLKDAQDI-LLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAA 2495
            +K+   HV    GVDDM+ L  L E  I+ NL  R + N I+TY G +L++VNP+  +P +T KE+  Y+     + +PHI+A+ADN Y NM   +  Q +IISGESGAGKT + K I+ +++ +SG     QH  I+  +L SNP+LEAFGN+ T+RN NSSRFGKY++I F   G   G K+  FLLEKSR+V Q   +RN+HVFY +  G     RS FG+    +Y YLN  G      T D  +F +   AMKV+   + +  E+ +++A  LH+GNI F    E N     VS      + + LL L S D+   LT + +     T+ + +   +++ Q    RDA VK IY RLF ++V+K+N A+            + ++S S   S+G+LDI+GFE F+NN FEQ CIN+ NE LQQ F+    K EQEEY  E I W  I + DN+   DLI  K    I++L+D+         +G D  LL  L  + + HP F       V    I+H+AG V Y +DGF ++NRD    DL+ L+Q +   F++ LF ++  +     KR  T   + R   ++L++ LM+  P +VRCIKPNE K+  D++ S    Q+ Y G+ E IR+R+AG+  R  F  F  RY I+ P     F+  D +   +++C ++ ++   YQ+GKTK+F+K+ + + LLE+ R++       +IQK WR++  R Q +K+K  A
Sbjct:    7 SKVNVQHV----GVDDMVLLPKLTEQSIVENLKKRLQANSIFTYIGPVLISVNPFKQMPYFTEKEMLLYQGAAQYENAPHIYALADNMYRNMLIDNESQCVIISGESGAGKTVNAKFIMNYISRISGGGQKVQH--IKDVILQSNPLLEAFGNSATVRNWNSSRFGKYVEIVFSRGGEPIGGKLSNFLLEKSRVVHQNEGDRNFHVFYQLCAGADKNLRSTFGIGELQYYNYLNMSGVFKADDTDDGKEFESTLHAMKVVGVNDQDQLEVLRIVATVLHIGNITFTE--ENNF--AAVSGKDYLEYPAFLLGLTSADIEAKLTGRKMESKWGTQKEEIDMKLNVEQASYTRDAWVKAIYARLFDYLVKKVNDAM-----------NITSQSTSDNFSVGILDIYGFEIFNNNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVREGIKWTEIDYFDNKIVCDLIETKRPPGIMSLLDDTCAQNHGQREGVDRQLLTTLSKSFAGHPHFGPGSDSFV----IKHYAGDVTYNVDGFCDRNRDVLYPDLILLMQKSSRPFIQALFPEN--VAASAGKRPTTFSTKIRTQANTLVESLMKCSPHYVRCIKPNETKRPNDWEESRVKHQVEYLGLRENIRVRRAGFAYRRAFDKFAQRYAIVSPQTWPCFQ-GDQQRACEIICDSVHMEKNQYQMGKTKIFVKNPESLFLLEETRERKFDGYARVIQKAWRQFSARKQHIKQKEQA 720          
BLAST of Dach-1 vs. Ensembl Celegans
Match: hum-2 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:A0A168H5A5])

HSP 1 Score: 489.574 bits (1259), Expect = 1.059e-141
Identity = 333/917 (36.31%), Postives = 496/917 (54.09%), Query Frame = 3
Query:  171 QKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQ-----ITVIDDDGHEFILKPGTKIRHMHVSS-LQGVDDMISLGDLNEAGILRNLLIRY-KRNEIYTYTGRILVAVNPYA-VLPIYTPKEIKNYKNC--KIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVS------GQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGA-IEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDS--EFN-FASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTS--IGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCS--KHPR--FIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKM-----------GFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTW------RKY-------------------YHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASK---KLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIR 2726
            +KG  +W  + +      LV IGA +++ +  Q     I + DD   E+ +K   ++  +   + L G DD+  L  L+E  +L NL +R+ K + IYTY G +LVA+NPYA    IY  + I+ Y+       ++ PHIFA+A+ A+ +M    + QSII+SGESGAGKT S K ++++LA+V+      G  + IE +VL SNPI+E+ GNAKTIRNDNSSRFGK+I I F   G  I GA++  +LLEKSR+V Q   ERNYH+FY +      +      L   + Y+YL QGG   + G  D  DF  L  A+++L F E +  ++F+LLA  L LGN++F    E    S  VS  S  E +    +  ++   DLR  LT + I   ++ V   ++  + +  RDAL K +Y  LF W+V+KIN A+         K  L+  +  K     IGVLDI+GFE FD NSFEQ  INYANE LQQ F +H+FK+EQEEY  E I+W  + F DNQ  +DLI      ++ L+DE+ +   G+D   L++L N+    ++P+  F K +++    F + HFA  V Y  DGF+EKNRD     L++++  +K  F++ +                  G  T K+  T+  QFR SL  LM +L    P +VRCIKPN+ K   DF+    ++QLR  G++ET+RI  AG+P R+ + +F  RYR++     + +R K  ++  +L C+  L+   Y +GKTK+FL+  Q  +LE +R   L+    +IQK W      RKY                   + R ++L+   A I +Q+ VR  L RRK+ +++     +QA F+A    +   KL+  K  I  +Q   RG L R       K ++ +Q  +R
Sbjct:   19 KKGVRIWHRHPT------LVWIGATLEEDITFQTRNVRIRLEDDTEVEYAIKSLDQLPFLRNPAFLVGKDDLTLLSYLHEPAVLHNLQVRFVKGSSIYTYCGIVLVAINPYADCSHIYGEEIIQVYRGAGKSAREMDPHIFAVAEEAHFDMGAFGKSQSIIVSGESGAGKTVSAKFVMRYLASVAASKTRNGGTTSIEARVLASNPIMESIGNAKTIRNDNSSRFGKFIQINFCERGRRIVGAEMKTYLLEKSRLVFQAPGERNYHIFYQLCAARNHQVLKDLHLGPCESYSYLTQGGDSRIPGVDDKADFEALLKALQLLGFDEKQMSDVFRLLAGLLLLGNVHF----ENGEGSSAVSASSCQEISRLCREFWKISESDLRIWLTRREIRAVNEIVTKPLTKNEAVRSRDALTKMLYSHLFGWLVDKINEALNE-------KDKLDGTNQKKRPDRFIGVLDIYGFETFDVNSFEQFSINYANEKLQQQFNQHVFKLEQEEYIREEIEWVRVDFHDNQPAIDLIE-GPVGMINLLDEQCKRLNGSDADWLSQLQNSTELKRNPQLAFPKVRSN---DFIVRHFAADVTYSTDGFVEKNRDAIGEQLLDVVVASKFPFIRTVIGSTAPTSVSSSSSSSTPGKRTIKK--TVASQFRDSLKELMSVLCSTRPHYVRCIKPNDSKISFDFEPKRAIQQLRACGVLETVRISAAGFPSRYPYEEFARRYRVIYTKEAALWRDK-PKQFAELACQQCLEEGKYAVGKTKIFLRTGQVAVLERVRLDTLAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRYEKSAI-TIQAAWRGYLARREQIANRKKVVMVQCAVR 910          
BLAST of Dach-1 vs. Ensembl Fly
Match: ck (gene:FBgn0000317 transcript:FBtr0080724)

HSP 1 Score: 2128.21 bits (5513), Expect = 0.000e+0
Identity = 1125/2212 (50.86%), Postives = 1503/2212 (67.95%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNIL----DEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMT-NGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTI-----IGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPD--SSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS--DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKN-YSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDG-QLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSS 6734
            MV+  +GD++WIE  S  +    V IGA++      +I V DDDG E  L P  +I+ MH SS+QGV+DMISLGDL+EAGILRNLLIRYK N IYTYTG ILVAVNPY +LPIYT  +IK YK  KIG+L PHIFAI DNAY +M+R  +DQ I+ISGESGAGKTESTKLILQ+LAA+SG+HSWIEQQ+L++NPILEAFGNAKTIRNDNSSRFGKYIDI+F  NG IEGAKI+Q+LLEKSRIVSQ   ERNYHVFYC+L GL  + +SR  L  +  Y YL  G  I   G  D  +F  + SAMKVL F++ E  EI +LLAA LH GNI +KA +  N+D+ E+         + LL L  + L  ALT + +    + VV+ +S  Q +++RDA VKGIYGR+FV IV KINTAI++P               +   +IGVLDIFGFENFD NSFEQ CINYANENLQQFFV+HIFK+EQEEY  E I+WQHI F DNQ+ LDLI +K  NI+ALIDEE+RFPKGTD ++L KL  T   H  ++K K+DI   FG+ HFAGVV Y   GFL+KNRD F+ DL+ L+  + ++FL+ +F +D +MG +TRKR PTL  QFRKSLD+LMK L   +PFF+RCIKPNE KK + FDR LC RQLRYSGMMETIRIR+AGYPIRH F +F++RYR L+PG+P + R  D +  T  +C  +L    YQ+G TK+FLKDA D+ LE  RD+ L+ +I+++Q++ R + +R +FL+ ++AAI +Q F +    R+++  M+ G+  LQA  R++V S + + L+G I  +Q H RG L R     K  A+IKIQS +R+  A+++++ L+ +  +  E L L+K +E    ++ ++       +       +++H     + Q+QL++   ++     I +A R++ +PVD+ ++++ +F  +        P+S S AP      E S     ND+         D +  I     +ED+SEF F KFAATYFQ + +  +++K L+ PLL       Q++A A+WI ILRF  D+PEP  +     + ++  +M+K+  +LGR F +    K  +EA+ M  +   +     R+ R  +VSLTLK+K+K  ++V   L D E      +  S L+ RPTSNLEKLHFIIG+GIL  ELRDEIYCQICKQL +NP   S +RG ILL+LC+GCFAP+EKFV  LR FI+      A +   RL+RTF+NGTRNQPPSWLEL+A K K+PI+L +  M+GNT+T+ ADSA+TA+ELC+ LS KI LKDQFGFSL+IA+ DKVSS+GSGGDHVMDAISQCEQ+AKE+G  E  A WRLFFRKEIF PWH    D VAT+LIY QV+RG+KFGEYRCD ++D+  + A Q  I+   D+S E L   LP  I      G+ K  ++ W AL+ +A K       KD I+  K+KE+IV++A+ KWP+LFSRFYEA + SGP+L  N+VI  +NWTG+Y+VD  E++ LELSFPEI AVSS +        T+++  Q+ SLSTV+G  +TF   N+EDIRDL+V+FL+GLK+RS Y I +Q +  P   +SFLS  KGDL+ILE       +  + W  G   R++E GDFPA+ VY+LP ++ P Q+ILALF+  +   G      SN    + R + HTL E++  +FR P   + S T++L  + +  LW++SR  +K PLL+KL +KE+  ++A   F+AIL YMGD PSK      EI + IFD  LKHEIL+DE+YCQL+ Q+T N N  SE+ GWEL+WLATG+   +  L +ELL   R+    ++ +   RLQKT++ GQR+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+T+ KD C NI  ++ L+  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP++DG   +F YQVFFMKKLWTNTVPG D+ AD++FHY QE+ K L GYHK   ++A  L AL+ R    ++  +LQ+  + L  LIP D++     +E ++ ++A Y+    M+  DAK+AFLKI+++WPTFGSAFFEVKQ+T  N PE +LIAINK+GV LIH  TK+ L  +P++ ISNWSSGNTYF+MTIGNL+ G KLLCET LGYKMDDLLTSYISLMLT + K+ +
Sbjct:    1 MVIVTRGDYIWIEPASGREFD--VAIGARVVSAEGRRIQVRDDDGDEVWLAPERRIKAMHASSVQGVEDMISLGDLHEAGILRNLLIRYKENLIYTYTGSILVAVNPYQILPIYTGDQIKLYKERKIGELPPHIFAIGDNAYAHMKRYRQDQCIVISGESGAGKTESTKLILQYLAAISGKHSWIEQQILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFSANGVIEGAKIEQYLLEKSRIVSQNHSERNYHVFYCILAGLSADEKSRLDLGMAADYKYLTGGNSITCEGRDDAAEFSDIRSAMKVLLFSDQEIWEIIKLLAALLHCGNIKYKATVVDNLDATEIPEHINVERVAGLLGLPIQPLIDALTRRTLFAHGETVVSTLSRDQSVDVRDAFVKGIYGRMFVHIVRKINTAIFKP-------------RGTSRNAIGVLDIFGFENFDQNSFEQFCINYANENLQQFFVQHIFKLEQEEYNHEAINWQHIEFVDNQDALDLIAIKQLNIMALIDEEARFPKGTDQTMLAKLHKTHGSHKNYLKPKSDINTSFGLNHFAGVVFYDTRGFLDKNRDTFSPDLLHLVSQSTNKFLRQIFAQDIEMGAETRKRTPTLSTQFRKSLDALMKTLSSCQPFFIRCIKPNELKKPMMFDRGLCCRQLRYSGMMETIRIRRAGYPIRHGFREFVERYRFLIPGVPPAHRT-DCQAATSRICAVVLGKSDYQLGHTKVFLKDAHDLFLEQERDRVLTRKILILQRSIRGWVYRRRFLRLRAAAITVQRFWKGYAQRKRYRNMRVGYMRLQALIRSRVLSHRFRHLRGHIVGLQAHARGYLVRREYGHKMWAVIKIQSHVRRMIAMRRYRKLRLEHKQFAEVLQLRKLEEQELLHRGNKHAREIAEQHYR----DRLHELERREIQEQLENRRRVEVNMNIINDAARKQEEPVDDGKLVEAMFDFL--------PDSSSDAPTPHGGRETS---VFNDLPHAQNVNQDDIIAPIHISEDEEDLSEFKFQKFAATYFQGNVNHQYAKKALKHPLLPLHTQGDQLAAQALWITILRFTGDMPEPKYHT--MDRMDTTSVMSKVTATLGRNFIRS---KEFQEAQLMGLDPDAFLKQKPRSIRHKLVSLTLKRKNKLGEDVRRRLQDDE--YTADSYQSWLQSRPTSNLEKLHFIIGHGILRAELRDEIYCQICKQLTNNPLKSSHARGWILLSLCVGCFAPSEKFVNYLRAFIREGPPGYAPYCEERLKRTFNNGTRNQPPSWLELQATKSKKPIMLPITFMDGNTKTLLADSATTARELCNQLSDKISLKDQFGFSLYIALFDKVSSLGSGGDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIFAPWHEPTHDQVATNLIYQQVVRGVKFGEYRCDKEEDLAMIAAQQYFIEYSTDMSMERLFTLLPNFIPDFCLSGVDKAIER-WAALVLQAYKKSYYV--KDKIAPLKIKEDIVSYAKYKWPLLFSRFYEAYRNSGPNLPKNDVIIAVNWTGVYVVDDQEQVLLELSFPEITAVSSQK--------TNKVFTQTFSLSTVRGEEFTFQSPNAEDIRDLVVYFLDGLKKRSKYVIALQDYRAPSDGTSFLSFFKGDLIILEDESCGESVLNNGWCIGRCDRSQERGDFPAETVYVLPTLSKPPQDILALFNIEEAHHGRRLSMASNGGAVEPRDRPHTLMEYALDHFRLPPKRTMSKTLTLSSKRSEELWRYSRDPIKAPLLRKLQSKEEFAEEACFAFAAILKYMGDLPSKRPRMGNEITDHIFDGPLKHEILRDEIYCQLMKQLTDNRNRMSEERGWELMWLATGLFACSQGLLKELLLFLRTRRHPISQDSMHRLQKTIRHGQRKYPPHQVEVEAIQHKTTQIFHKVYFPDDTDEAFEVDSSTRAKDFCNNISQRLSLRTSEGFSLFVKIADKVISVPEGDFFFDFVRHLTDWIKKARPIRDGANPQFTYQVFFMKKLWTNTVPGKDRNADLIFHYHQELPKLLRGYHKCSREEAAKLAALVFRVRFGENKQELQAIPQMLRELIPSDIMKIQSTSEWKRSIVASYNQDGGMTSEDAKVAFLKIVYRWPTFGSAFFEVKQTTEPNYPEMLLIAINKHGVSLIHPVTKDILVTHPFTRISNWSSGNTYFHMTIGNLVRGSKLLCETSLGYKMDDLLTSYISLMLTNMNKNRT 2163          
BLAST of Dach-1 vs. Ensembl Fly
Match: ck (gene:FBgn0000317 transcript:FBtr0343687)

HSP 1 Score: 2128.21 bits (5513), Expect = 0.000e+0
Identity = 1125/2212 (50.86%), Postives = 1503/2212 (67.95%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNIL----DEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMT-NGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTI-----IGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPD--SSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS--DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKN-YSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDG-QLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSS 6734
            MV+  +GD++WIE  S  +    V IGA++      +I V DDDG E  L P  +I+ MH SS+QGV+DMISLGDL+EAGILRNLLIRYK N IYTYTG ILVAVNPY +LPIYT  +IK YK  KIG+L PHIFAI DNAY +M+R  +DQ I+ISGESGAGKTESTKLILQ+LAA+SG+HSWIEQQ+L++NPILEAFGNAKTIRNDNSSRFGKYIDI+F  NG IEGAKI+Q+LLEKSRIVSQ   ERNYHVFYC+L GL  + +SR  L  +  Y YL  G  I   G  D  +F  + SAMKVL F++ E  EI +LLAA LH GNI +KA +  N+D+ E+         + LL L  + L  ALT + +    + VV+ +S  Q +++RDA VKGIYGR+FV IV KINTAI++P               +   +IGVLDIFGFENFD NSFEQ CINYANENLQQFFV+HIFK+EQEEY  E I+WQHI F DNQ+ LDLI +K  NI+ALIDEE+RFPKGTD ++L KL  T   H  ++K K+DI   FG+ HFAGVV Y   GFL+KNRD F+ DL+ L+  + ++FL+ +F +D +MG +TRKR PTL  QFRKSLD+LMK L   +PFF+RCIKPNE KK + FDR LC RQLRYSGMMETIRIR+AGYPIRH F +F++RYR L+PG+P + R  D +  T  +C  +L    YQ+G TK+FLKDA D+ LE  RD+ L+ +I+++Q++ R + +R +FL+ ++AAI +Q F +    R+++  M+ G+  LQA  R++V S + + L+G I  +Q H RG L R     K  A+IKIQS +R+  A+++++ L+ +  +  E L L+K +E    ++ ++       +       +++H     + Q+QL++   ++     I +A R++ +PVD+ ++++ +F  +        P+S S AP      E S     ND+         D +  I     +ED+SEF F KFAATYFQ + +  +++K L+ PLL       Q++A A+WI ILRF  D+PEP  +     + ++  +M+K+  +LGR F +    K  +EA+ M  +   +     R+ R  +VSLTLK+K+K  ++V   L D E      +  S L+ RPTSNLEKLHFIIG+GIL  ELRDEIYCQICKQL +NP   S +RG ILL+LC+GCFAP+EKFV  LR FI+      A +   RL+RTF+NGTRNQPPSWLEL+A K K+PI+L +  M+GNT+T+ ADSA+TA+ELC+ LS KI LKDQFGFSL+IA+ DKVSS+GSGGDHVMDAISQCEQ+AKE+G  E  A WRLFFRKEIF PWH    D VAT+LIY QV+RG+KFGEYRCD ++D+  + A Q  I+   D+S E L   LP  I      G+ K  ++ W AL+ +A K       KD I+  K+KE+IV++A+ KWP+LFSRFYEA + SGP+L  N+VI  +NWTG+Y+VD  E++ LELSFPEI AVSS +        T+++  Q+ SLSTV+G  +TF   N+EDIRDL+V+FL+GLK+RS Y I +Q +  P   +SFLS  KGDL+ILE       +  + W  G   R++E GDFPA+ VY+LP ++ P Q+ILALF+  +   G      SN    + R + HTL E++  +FR P   + S T++L  + +  LW++SR  +K PLL+KL +KE+  ++A   F+AIL YMGD PSK      EI + IFD  LKHEIL+DE+YCQL+ Q+T N N  SE+ GWEL+WLATG+   +  L +ELL   R+    ++ +   RLQKT++ GQR+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+T+ KD C NI  ++ L+  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP++DG   +F YQVFFMKKLWTNTVPG D+ AD++FHY QE+ K L GYHK   ++A  L AL+ R    ++  +LQ+  + L  LIP D++     +E ++ ++A Y+    M+  DAK+AFLKI+++WPTFGSAFFEVKQ+T  N PE +LIAINK+GV LIH  TK+ L  +P++ ISNWSSGNTYF+MTIGNL+ G KLLCET LGYKMDDLLTSYISLMLT + K+ +
Sbjct:    1 MVIVTRGDYIWIEPASGREFD--VAIGARVVSAEGRRIQVRDDDGDEVWLAPERRIKAMHASSVQGVEDMISLGDLHEAGILRNLLIRYKENLIYTYTGSILVAVNPYQILPIYTGDQIKLYKERKIGELPPHIFAIGDNAYAHMKRYRQDQCIVISGESGAGKTESTKLILQYLAAISGKHSWIEQQILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFSANGVIEGAKIEQYLLEKSRIVSQNHSERNYHVFYCILAGLSADEKSRLDLGMAADYKYLTGGNSITCEGRDDAAEFSDIRSAMKVLLFSDQEIWEIIKLLAALLHCGNIKYKATVVDNLDATEIPEHINVERVAGLLGLPIQPLIDALTRRTLFAHGETVVSTLSRDQSVDVRDAFVKGIYGRMFVHIVRKINTAIFKP-------------RGTSRNAIGVLDIFGFENFDQNSFEQFCINYANENLQQFFVQHIFKLEQEEYNHEAINWQHIEFVDNQDALDLIAIKQLNIMALIDEEARFPKGTDQTMLAKLHKTHGSHKNYLKPKSDINTSFGLNHFAGVVFYDTRGFLDKNRDTFSPDLLHLVSQSTNKFLRQIFAQDIEMGAETRKRTPTLSTQFRKSLDALMKTLSSCQPFFIRCIKPNELKKPMMFDRGLCCRQLRYSGMMETIRIRRAGYPIRHGFREFVERYRFLIPGVPPAHRT-DCQAATSRICAVVLGKSDYQLGHTKVFLKDAHDLFLEQERDRVLTRKILILQRSIRGWVYRRRFLRLRAAAITVQRFWKGYAQRKRYRNMRVGYMRLQALIRSRVLSHRFRHLRGHIVGLQAHARGYLVRREYGHKMWAVIKIQSHVRRMIAMRRYRKLRLEHKQFAEVLQLRKLEEQELLHRGNKHAREIAEQHYR----DRLHELERREIQEQLENRRRVEVNMNIINDAARKQEEPVDDGKLVEAMFDFL--------PDSSSDAPTPHGGRETS---VFNDLPHAQNVNQDDIIAPIHISEDEEDLSEFKFQKFAATYFQGNVNHQYAKKALKHPLLPLHTQGDQLAAQALWITILRFTGDMPEPKYHT--MDRMDTTSVMSKVTATLGRNFIRS---KEFQEAQLMGLDPDAFLKQKPRSIRHKLVSLTLKRKNKLGEDVRRRLQDDE--YTADSYQSWLQSRPTSNLEKLHFIIGHGILRAELRDEIYCQICKQLTNNPLKSSHARGWILLSLCVGCFAPSEKFVNYLRAFIREGPPGYAPYCEERLKRTFNNGTRNQPPSWLELQATKSKKPIMLPITFMDGNTKTLLADSATTARELCNQLSDKISLKDQFGFSLYIALFDKVSSLGSGGDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIFAPWHEPTHDQVATNLIYQQVVRGVKFGEYRCDKEEDLAMIAAQQYFIEYSTDMSMERLFTLLPNFIPDFCLSGVDKAIER-WAALVLQAYKKSYYV--KDKIAPLKIKEDIVSYAKYKWPLLFSRFYEAYRNSGPNLPKNDVIIAVNWTGVYVVDDQEQVLLELSFPEITAVSSQK--------TNKVFTQTFSLSTVRGEEFTFQSPNAEDIRDLVVYFLDGLKKRSKYVIALQDYRAPSDGTSFLSFFKGDLIILEDESCGESVLNNGWCIGRCDRSQERGDFPAETVYVLPTLSKPPQDILALFNIEEAHHGRRLSMASNGGAVEPRDRPHTLMEYALDHFRLPPKRTMSKTLTLSSKRSEELWRYSRDPIKAPLLRKLQSKEEFAEEACFAFAAILKYMGDLPSKRPRMGNEITDHIFDGPLKHEILRDEIYCQLMKQLTDNRNRMSEERGWELMWLATGLFACSQGLLKELLLFLRTRRHPISQDSMHRLQKTIRHGQRKYPPHQVEVEAIQHKTTQIFHKVYFPDDTDEAFEVDSSTRAKDFCNNISQRLSLRTSEGFSLFVKIADKVISVPEGDFFFDFVRHLTDWIKKARPIRDGANPQFTYQVFFMKKLWTNTVPGKDRNADLIFHYHQELPKLLRGYHKCSREEAAKLAALVFRVRFGENKQELQAIPQMLRELIPSDIMKIQSTSEWKRSIVASYNQDGGMTSEDAKVAFLKIVYRWPTFGSAFFEVKQTTEPNYPEMLLIAINKHGVSLIHPVTKDILVTHPFTRISNWSSGNTYFHMTIGNLVRGSKLLCETSLGYKMDDLLTSYISLMLTNMNKNRT 2163          
BLAST of Dach-1 vs. Ensembl Fly
Match: ck (gene:FBgn0000317 transcript:FBtr0343686)

HSP 1 Score: 2128.21 bits (5513), Expect = 0.000e+0
Identity = 1125/2212 (50.86%), Postives = 1503/2212 (67.95%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNIL----DEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMT-NGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTI-----IGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPD--SSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS--DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKN-YSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDG-QLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSS 6734
            MV+  +GD++WIE  S  +    V IGA++      +I V DDDG E  L P  +I+ MH SS+QGV+DMISLGDL+EAGILRNLLIRYK N IYTYTG ILVAVNPY +LPIYT  +IK YK  KIG+L PHIFAI DNAY +M+R  +DQ I+ISGESGAGKTESTKLILQ+LAA+SG+HSWIEQQ+L++NPILEAFGNAKTIRNDNSSRFGKYIDI+F  NG IEGAKI+Q+LLEKSRIVSQ   ERNYHVFYC+L GL  + +SR  L  +  Y YL  G  I   G  D  +F  + SAMKVL F++ E  EI +LLAA LH GNI +KA +  N+D+ E+         + LL L  + L  ALT + +    + VV+ +S  Q +++RDA VKGIYGR+FV IV KINTAI++P               +   +IGVLDIFGFENFD NSFEQ CINYANENLQQFFV+HIFK+EQEEY  E I+WQHI F DNQ+ LDLI +K  NI+ALIDEE+RFPKGTD ++L KL  T   H  ++K K+DI   FG+ HFAGVV Y   GFL+KNRD F+ DL+ L+  + ++FL+ +F +D +MG +TRKR PTL  QFRKSLD+LMK L   +PFF+RCIKPNE KK + FDR LC RQLRYSGMMETIRIR+AGYPIRH F +F++RYR L+PG+P + R  D +  T  +C  +L    YQ+G TK+FLKDA D+ LE  RD+ L+ +I+++Q++ R + +R +FL+ ++AAI +Q F +    R+++  M+ G+  LQA  R++V S + + L+G I  +Q H RG L R     K  A+IKIQS +R+  A+++++ L+ +  +  E L L+K +E    ++ ++       +       +++H     + Q+QL++   ++     I +A R++ +PVD+ ++++ +F  +        P+S S AP      E S     ND+         D +  I     +ED+SEF F KFAATYFQ + +  +++K L+ PLL       Q++A A+WI ILRF  D+PEP  +     + ++  +M+K+  +LGR F +    K  +EA+ M  +   +     R+ R  +VSLTLK+K+K  ++V   L D E      +  S L+ RPTSNLEKLHFIIG+GIL  ELRDEIYCQICKQL +NP   S +RG ILL+LC+GCFAP+EKFV  LR FI+      A +   RL+RTF+NGTRNQPPSWLEL+A K K+PI+L +  M+GNT+T+ ADSA+TA+ELC+ LS KI LKDQFGFSL+IA+ DKVSS+GSGGDHVMDAISQCEQ+AKE+G  E  A WRLFFRKEIF PWH    D VAT+LIY QV+RG+KFGEYRCD ++D+  + A Q  I+   D+S E L   LP  I      G+ K  ++ W AL+ +A K       KD I+  K+KE+IV++A+ KWP+LFSRFYEA + SGP+L  N+VI  +NWTG+Y+VD  E++ LELSFPEI AVSS +        T+++  Q+ SLSTV+G  +TF   N+EDIRDL+V+FL+GLK+RS Y I +Q +  P   +SFLS  KGDL+ILE       +  + W  G   R++E GDFPA+ VY+LP ++ P Q+ILALF+  +   G      SN    + R + HTL E++  +FR P   + S T++L  + +  LW++SR  +K PLL+KL +KE+  ++A   F+AIL YMGD PSK      EI + IFD  LKHEIL+DE+YCQL+ Q+T N N  SE+ GWEL+WLATG+   +  L +ELL   R+    ++ +   RLQKT++ GQR+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+T+ KD C NI  ++ L+  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP++DG   +F YQVFFMKKLWTNTVPG D+ AD++FHY QE+ K L GYHK   ++A  L AL+ R    ++  +LQ+  + L  LIP D++     +E ++ ++A Y+    M+  DAK+AFLKI+++WPTFGSAFFEVKQ+T  N PE +LIAINK+GV LIH  TK+ L  +P++ ISNWSSGNTYF+MTIGNL+ G KLLCET LGYKMDDLLTSYISLMLT + K+ +
Sbjct:    1 MVIVTRGDYIWIEPASGREFD--VAIGARVVSAEGRRIQVRDDDGDEVWLAPERRIKAMHASSVQGVEDMISLGDLHEAGILRNLLIRYKENLIYTYTGSILVAVNPYQILPIYTGDQIKLYKERKIGELPPHIFAIGDNAYAHMKRYRQDQCIVISGESGAGKTESTKLILQYLAAISGKHSWIEQQILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFSANGVIEGAKIEQYLLEKSRIVSQNHSERNYHVFYCILAGLSADEKSRLDLGMAADYKYLTGGNSITCEGRDDAAEFSDIRSAMKVLLFSDQEIWEIIKLLAALLHCGNIKYKATVVDNLDATEIPEHINVERVAGLLGLPIQPLIDALTRRTLFAHGETVVSTLSRDQSVDVRDAFVKGIYGRMFVHIVRKINTAIFKP-------------RGTSRNAIGVLDIFGFENFDQNSFEQFCINYANENLQQFFVQHIFKLEQEEYNHEAINWQHIEFVDNQDALDLIAIKQLNIMALIDEEARFPKGTDQTMLAKLHKTHGSHKNYLKPKSDINTSFGLNHFAGVVFYDTRGFLDKNRDTFSPDLLHLVSQSTNKFLRQIFAQDIEMGAETRKRTPTLSTQFRKSLDALMKTLSSCQPFFIRCIKPNELKKPMMFDRGLCCRQLRYSGMMETIRIRRAGYPIRHGFREFVERYRFLIPGVPPAHRT-DCQAATSRICAVVLGKSDYQLGHTKVFLKDAHDLFLEQERDRVLTRKILILQRSIRGWVYRRRFLRLRAAAITVQRFWKGYAQRKRYRNMRVGYMRLQALIRSRVLSHRFRHLRGHIVGLQAHARGYLVRREYGHKMWAVIKIQSHVRRMIAMRRYRKLRLEHKQFAEVLQLRKLEEQELLHRGNKHAREIAEQHYR----DRLHELERREIQEQLENRRRVEVNMNIINDAARKQEEPVDDGKLVEAMFDFL--------PDSSSDAPTPHGGRETS---VFNDLPHAQNVNQDDIIAPIHISEDEEDLSEFKFQKFAATYFQGNVNHQYAKKALKHPLLPLHTQGDQLAAQALWITILRFTGDMPEPKYHT--MDRMDTTSVMSKVTATLGRNFIRS---KEFQEAQLMGLDPDAFLKQKPRSIRHKLVSLTLKRKNKLGEDVRRRLQDDE--YTADSYQSWLQSRPTSNLEKLHFIIGHGILRAELRDEIYCQICKQLTNNPLKSSHARGWILLSLCVGCFAPSEKFVNYLRAFIREGPPGYAPYCEERLKRTFNNGTRNQPPSWLELQATKSKKPIMLPITFMDGNTKTLLADSATTARELCNQLSDKISLKDQFGFSLYIALFDKVSSLGSGGDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIFAPWHEPTHDQVATNLIYQQVVRGVKFGEYRCDKEEDLAMIAAQQYFIEYSTDMSMERLFTLLPNFIPDFCLSGVDKAIER-WAALVLQAYKKSYYV--KDKIAPLKIKEDIVSYAKYKWPLLFSRFYEAYRNSGPNLPKNDVIIAVNWTGVYVVDDQEQVLLELSFPEITAVSSQK--------TNKVFTQTFSLSTVRGEEFTFQSPNAEDIRDLVVYFLDGLKKRSKYVIALQDYRAPSDGTSFLSFFKGDLIILEDESCGESVLNNGWCIGRCDRSQERGDFPAETVYVLPTLSKPPQDILALFNIEEAHHGRRLSMASNGGAVEPRDRPHTLMEYALDHFRLPPKRTMSKTLTLSSKRSEELWRYSRDPIKAPLLRKLQSKEEFAEEACFAFAAILKYMGDLPSKRPRMGNEITDHIFDGPLKHEILRDEIYCQLMKQLTDNRNRMSEERGWELMWLATGLFACSQGLLKELLLFLRTRRHPISQDSMHRLQKTIRHGQRKYPPHQVEVEAIQHKTTQIFHKVYFPDDTDEAFEVDSSTRAKDFCNNISQRLSLRTSEGFSLFVKIADKVISVPEGDFFFDFVRHLTDWIKKARPIRDGANPQFTYQVFFMKKLWTNTVPGKDRNADLIFHYHQELPKLLRGYHKCSREEAAKLAALVFRVRFGENKQELQAIPQMLRELIPSDIMKIQSTSEWKRSIVASYNQDGGMTSEDAKVAFLKIVYRWPTFGSAFFEVKQTTEPNYPEMLLIAINKHGVSLIHPVTKDILVTHPFTRISNWSSGNTYFHMTIGNLVRGSKLLCETSLGYKMDDLLTSYISLMLTNMNKNRT 2163          
BLAST of Dach-1 vs. Ensembl Fly
Match: ck (gene:FBgn0000317 transcript:FBtr0080723)

HSP 1 Score: 2128.21 bits (5513), Expect = 0.000e+0
Identity = 1125/2212 (50.86%), Postives = 1503/2212 (67.95%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNIL----DEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMT-NGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTI-----IGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPD--SSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS--DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKN-YSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDG-QLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSS 6734
            MV+  +GD++WIE  S  +    V IGA++      +I V DDDG E  L P  +I+ MH SS+QGV+DMISLGDL+EAGILRNLLIRYK N IYTYTG ILVAVNPY +LPIYT  +IK YK  KIG+L PHIFAI DNAY +M+R  +DQ I+ISGESGAGKTESTKLILQ+LAA+SG+HSWIEQQ+L++NPILEAFGNAKTIRNDNSSRFGKYIDI+F  NG IEGAKI+Q+LLEKSRIVSQ   ERNYHVFYC+L GL  + +SR  L  +  Y YL  G  I   G  D  +F  + SAMKVL F++ E  EI +LLAA LH GNI +KA +  N+D+ E+         + LL L  + L  ALT + +    + VV+ +S  Q +++RDA VKGIYGR+FV IV KINTAI++P               +   +IGVLDIFGFENFD NSFEQ CINYANENLQQFFV+HIFK+EQEEY  E I+WQHI F DNQ+ LDLI +K  NI+ALIDEE+RFPKGTD ++L KL  T   H  ++K K+DI   FG+ HFAGVV Y   GFL+KNRD F+ DL+ L+  + ++FL+ +F +D +MG +TRKR PTL  QFRKSLD+LMK L   +PFF+RCIKPNE KK + FDR LC RQLRYSGMMETIRIR+AGYPIRH F +F++RYR L+PG+P + R  D +  T  +C  +L    YQ+G TK+FLKDA D+ LE  RD+ L+ +I+++Q++ R + +R +FL+ ++AAI +Q F +    R+++  M+ G+  LQA  R++V S + + L+G I  +Q H RG L R     K  A+IKIQS +R+  A+++++ L+ +  +  E L L+K +E    ++ ++       +       +++H     + Q+QL++   ++     I +A R++ +PVD+ ++++ +F  +        P+S S AP      E S     ND+         D +  I     +ED+SEF F KFAATYFQ + +  +++K L+ PLL       Q++A A+WI ILRF  D+PEP  +     + ++  +M+K+  +LGR F +    K  +EA+ M  +   +     R+ R  +VSLTLK+K+K  ++V   L D E      +  S L+ RPTSNLEKLHFIIG+GIL  ELRDEIYCQICKQL +NP   S +RG ILL+LC+GCFAP+EKFV  LR FI+      A +   RL+RTF+NGTRNQPPSWLEL+A K K+PI+L +  M+GNT+T+ ADSA+TA+ELC+ LS KI LKDQFGFSL+IA+ DKVSS+GSGGDHVMDAISQCEQ+AKE+G  E  A WRLFFRKEIF PWH    D VAT+LIY QV+RG+KFGEYRCD ++D+  + A Q  I+   D+S E L   LP  I      G+ K  ++ W AL+ +A K       KD I+  K+KE+IV++A+ KWP+LFSRFYEA + SGP+L  N+VI  +NWTG+Y+VD  E++ LELSFPEI AVSS +        T+++  Q+ SLSTV+G  +TF   N+EDIRDL+V+FL+GLK+RS Y I +Q +  P   +SFLS  KGDL+ILE       +  + W  G   R++E GDFPA+ VY+LP ++ P Q+ILALF+  +   G      SN    + R + HTL E++  +FR P   + S T++L  + +  LW++SR  +K PLL+KL +KE+  ++A   F+AIL YMGD PSK      EI + IFD  LKHEIL+DE+YCQL+ Q+T N N  SE+ GWEL+WLATG+   +  L +ELL   R+    ++ +   RLQKT++ GQR+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+T+ KD C NI  ++ L+  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP++DG   +F YQVFFMKKLWTNTVPG D+ AD++FHY QE+ K L GYHK   ++A  L AL+ R    ++  +LQ+  + L  LIP D++     +E ++ ++A Y+    M+  DAK+AFLKI+++WPTFGSAFFEVKQ+T  N PE +LIAINK+GV LIH  TK+ L  +P++ ISNWSSGNTYF+MTIGNL+ G KLLCET LGYKMDDLLTSYISLMLT + K+ +
Sbjct:    1 MVIVTRGDYIWIEPASGREFD--VAIGARVVSAEGRRIQVRDDDGDEVWLAPERRIKAMHASSVQGVEDMISLGDLHEAGILRNLLIRYKENLIYTYTGSILVAVNPYQILPIYTGDQIKLYKERKIGELPPHIFAIGDNAYAHMKRYRQDQCIVISGESGAGKTESTKLILQYLAAISGKHSWIEQQILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFSANGVIEGAKIEQYLLEKSRIVSQNHSERNYHVFYCILAGLSADEKSRLDLGMAADYKYLTGGNSITCEGRDDAAEFSDIRSAMKVLLFSDQEIWEIIKLLAALLHCGNIKYKATVVDNLDATEIPEHINVERVAGLLGLPIQPLIDALTRRTLFAHGETVVSTLSRDQSVDVRDAFVKGIYGRMFVHIVRKINTAIFKP-------------RGTSRNAIGVLDIFGFENFDQNSFEQFCINYANENLQQFFVQHIFKLEQEEYNHEAINWQHIEFVDNQDALDLIAIKQLNIMALIDEEARFPKGTDQTMLAKLHKTHGSHKNYLKPKSDINTSFGLNHFAGVVFYDTRGFLDKNRDTFSPDLLHLVSQSTNKFLRQIFAQDIEMGAETRKRTPTLSTQFRKSLDALMKTLSSCQPFFIRCIKPNELKKPMMFDRGLCCRQLRYSGMMETIRIRRAGYPIRHGFREFVERYRFLIPGVPPAHRT-DCQAATSRICAVVLGKSDYQLGHTKVFLKDAHDLFLEQERDRVLTRKILILQRSIRGWVYRRRFLRLRAAAITVQRFWKGYAQRKRYRNMRVGYMRLQALIRSRVLSHRFRHLRGHIVGLQAHARGYLVRREYGHKMWAVIKIQSHVRRMIAMRRYRKLRLEHKQFAEVLQLRKLEEQELLHRGNKHAREIAEQHYR----DRLHELERREIQEQLENRRRVEVNMNIINDAARKQEEPVDDGKLVEAMFDFL--------PDSSSDAPTPHGGRETS---VFNDLPHAQNVNQDDIIAPIHISEDEEDLSEFKFQKFAATYFQGNVNHQYAKKALKHPLLPLHTQGDQLAAQALWITILRFTGDMPEPKYHT--MDRMDTTSVMSKVTATLGRNFIRS---KEFQEAQLMGLDPDAFLKQKPRSIRHKLVSLTLKRKNKLGEDVRRRLQDDE--YTADSYQSWLQSRPTSNLEKLHFIIGHGILRAELRDEIYCQICKQLTNNPLKSSHARGWILLSLCVGCFAPSEKFVNYLRAFIREGPPGYAPYCEERLKRTFNNGTRNQPPSWLELQATKSKKPIMLPITFMDGNTKTLLADSATTARELCNQLSDKISLKDQFGFSLYIALFDKVSSLGSGGDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIFAPWHEPTHDQVATNLIYQQVVRGVKFGEYRCDKEEDLAMIAAQQYFIEYSTDMSMERLFTLLPNFIPDFCLSGVDKAIER-WAALVLQAYKKSYYV--KDKIAPLKIKEDIVSYAKYKWPLLFSRFYEAYRNSGPNLPKNDVIIAVNWTGVYVVDDQEQVLLELSFPEITAVSSQK--------TNKVFTQTFSLSTVRGEEFTFQSPNAEDIRDLVVYFLDGLKKRSKYVIALQDYRAPSDGTSFLSFFKGDLIILEDESCGESVLNNGWCIGRCDRSQERGDFPAETVYVLPTLSKPPQDILALFNIEEAHHGRRLSMASNGGAVEPRDRPHTLMEYALDHFRLPPKRTMSKTLTLSSKRSEELWRYSRDPIKAPLLRKLQSKEEFAEEACFAFAAILKYMGDLPSKRPRMGNEITDHIFDGPLKHEILRDEIYCQLMKQLTDNRNRMSEERGWELMWLATGLFACSQGLLKELLLFLRTRRHPISQDSMHRLQKTIRHGQRKYPPHQVEVEAIQHKTTQIFHKVYFPDDTDEAFEVDSSTRAKDFCNNISQRLSLRTSEGFSLFVKIADKVISVPEGDFFFDFVRHLTDWIKKARPIRDGANPQFTYQVFFMKKLWTNTVPGKDRNADLIFHYHQELPKLLRGYHKCSREEAAKLAALVFRVRFGENKQELQAIPQMLRELIPSDIMKIQSTSEWKRSIVASYNQDGGMTSEDAKVAFLKIVYRWPTFGSAFFEVKQTTEPNYPEMLLIAINKHGVSLIHPVTKDILVTHPFTRISNWSSGNTYFHMTIGNLVRGSKLLCETSLGYKMDDLLTSYISLMLTNMNKNRT 2163          
BLAST of Dach-1 vs. Ensembl Fly
Match: Myo28B1 (gene:FBgn0040299 transcript:FBtr0079473)

HSP 1 Score: 1432.16 bits (3706), Expect = 0.000e+0
Identity = 871/2219 (39.25%), Postives = 1264/2219 (56.96%), Query Frame = 3
Query:  168 PQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGL--RASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKG-YQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEA---ERRRNQP-------------------VDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFI-QTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRID----NVKDLSDETLHKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDS----ISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPD-SSFLSCEKGDLLILE---TNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVK---DGQLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYI 6698
            P+KG++VW++ +++T +   VP GA+I    K Q  V DD   +F +  G  ++ MH++S + V+DMI+LGDL E  ILRNL  RY +  IYTYTG +LVA+NPY +LPIYT +EI+ Y+N  + +L PHIFAI+DNA+  ++R+  +Q ++ISGESGAGKTESTKLILQ+LAA+SG+HSWIEQQ++++NPI+EAFGNAKT+RNDNSSRFGKYI+I F   GAI+GA+I Q+LLEKSRIV Q RDERNYH+FYCML GL    R R  L  ++   Y YL QGG   L G  D  DF  + +AMKVL+F  +E   I  LLAA LHLGN+ F A    N+ + E+         ++LL +    L  ALT + I    + V T++S    I  RDA VK +Y  +FV IV +IN  I             N + +    SIGVLDIFGFENFDNNSFEQLCINYANENLQQFFV HIFKMEQ+EY  E I+WQHI F DNQ+ LDLIG+K  N+++LIDEES+FPKGTD +LL KL         ++K K     +FGI H+AGVV Y   GFLEKNRD F+ DL  L+Q + +++L  +F  +  M  DT K+ PTL ++FR SLD LM+ L +  P+F+RCIKPNE+K+  +FD+ LC+RQLRYSGMMET RIR+AGYPIRH +  F++RYR+LVP +    +C D R+  + +C+  L      Q GKTKLFL+D  D  LE  R + +   I+ IQ+  R+   R    + + A I +Q + R +L RRK+  M++GF  L A   A+  + K   ++     +Q   RG L R   K   K +++ + Q +            K+  +L     LK++ E   + Q  +    E+  K      N +   +V    QQ +    +KQ   +A   + R + P                   V     + E  G+ID  S K + + +    R   D   + +  LN++ S     +P  + N +  D S+F++ K+AATYF         RKPL+K LL H +P  ++++ A+W+ ILRFM DLP+ +V+       ++  +M+     L    N  D  K                L +R +++ I    L    K   E   H       LN           PTS+LEK+HFIIG+GI+   LRDEI  QICKQL  NP   S SRG +LL+LC+ CF P+++F   LR+F+ Q   +  A   + RL+RT  NG R QPPS  EL AI+ + P+ L +  M+G    +  D+ASTA+E  + L Q + L D FGF L +++  K+  +G+G +HV+DAIS+CEQ        +  A W+L+ RKE+F  W++   D  AT LIY Q++ G+K GEYRC ++ D+  +CA    ++     +  L    +  ++P  ++   +   + W  L+    +  +    + +     + ++ KE+I  FA L WPM  SR +E ++  GP L ++E++  IN  G++L+D  E++     F E++ V        V S+  +LH     + T +  N+   C++++D  ++I + L+ L++RS Y + +    + D    L    GDL+  E   T   +      D Y G      + G F A  V +L  +  PS+ +  +  +  F +        N+  SR +QH + + ++ +FR P    ++            L + S + LK PLLK ++    L QQA+     IL YMGD    N       + IF P L+H +L DE+YCQL+ Q++ NP+ +SEK GW+L++LATG++ P+  + REL+ + R  +  LA  C  RL+++L  GQR+  PH IE+  +Q   L I HKIYFP+++V+AFEI S+T+  +L  +I  ++ LK   G+++F+K+ D+  +MPE +F FDFI QL  W+++ R ++   DGQ    YQ+ FM+KLW N  PG D   D++F YPQE+ KYL GY+ +  + A  L  L+  A  D DVS LQ   E L  LIP D++      E +Q++L + H    ++++ AKI FL+ +  +  FGS FF VKQ  +  +PE +LIAIN  G +++   TKE L  Y YS +  WSSG  +F++  GN+I   KLLC T  GYKMDDLL SY+
Sbjct:    7 PRKGEYVWVKPQNTT-SEFAVPFGARIVRTEKTQTLVCDDRNKQFWVPAGDVLKAMHITSQEDVEDMITLGDLQEYTILRNLQNRYAKQLIYTYTGSMLVAINPYQILPIYTNREIQLYRNKSLAELPPHIFAISDNAFQRLQRLKENQCVVISGESGAGKTESTKLILQYLAAISGKHSWIEQQIIEANPIMEAFGNAKTVRNDNSSRFGKYIEIRFTPQGAIQGARIQQYLLEKSRIVFQSRDERNYHIFYCMLAGLSTAERERLKLQEQSPSQYHYLAQGGCFTLPGRGDAKDFADIRAAMKVLSFKPEEVWSILSLLAAILHLGNLRFTATEVANLATAEIDDTPNLQRVAQLLGIPISALNAALTQRTIFVHGEHVTTSLSKEAAIEGRDAFVKSLYDGIFVRIVRRINETI-------------NKQVDQPMNSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVGHIFKMEQDEYQNEHINWQHIEFQDNQQILDLIGMKPMNLMSLIDEESKFPKGTDQTLLEKLHVQHGNRSIYVKGKTTQTSLFGIRHYAGVVMYNPLGFLEKNRDSFSGDLRTLVQRSTNKYLVDIFPHEMPM--DTAKKQPTLCVKFRNSLDMLMRTLSQAHPYFIRCIKPNEYKEPKNFDKELCVRQLRYSGMMETARIRRAGYPIRHAYRAFVERYRLLVPPVGPLEQC-DCRKLARQICEVALPADSDRQYGKTKLFLRDEDDASLELQRSQLMLKSIVTIQRGIRRVLFRRYMKRYREAIITVQRYWRGRLQRRKYQVMRQGFHRLGACIAAQQLTTKFTMVRCRTIKLQALSRGYLVR---KDFQKKLLERRKQNQLKKEELLKLAKMKEAEELLRLQQLKEQKEREQREQQEKRLQEEQRLKAEAAARNALAMAAV----QQKRRTKPVKQEAPKAPTLQARNSLPPPPTTLIVAAPLPTRPASAVTRINTIPESPGTIDVESSKQMVDDVF---RFLNDEPDAALRKLNNISSGDTIRLPKSVPNNI--DTSDFSYLKYAATYFGGGATAQHERKPLKKSLLKHEHPIDEMASKAIWLTILRFMGDLPD-VVSSPTLHVFDNENLMS----DLASLLNTSDSYKP--------------RLFVRQSQRRIPK-PLASGEKEAQEFYQHW------LNV----------PTSHLEKIHFIIGHGIIKNSLRDEILAQICKQLYLNPSRSSYSRGWLLLSLCLSCFPPSKEFEPHLRSFMKQGTAQLQATPSLQRLERTLVNGPRCQPPSLFELHAIRGRHPLRLDIHLMDGQQRRLQVDAASTAREAVNQLCQGMGLTDTFGFGLVMSLNGKLMPLGAGQEHVLDAISECEQR-------QLDAPWKLYIRKEMFATWYDPSMDPKATQLIYKQILNGLKCGEYRCRSEKDIAMVCALACFVEYGPGEILRLKPSEITAFVPSDLLAPGERAIENWSRLIAATYEKSSYVKEEQNDLLLEAQKRAKEDICLFAHLSWPMRHSRLFEVVRKEGPKLQSDELMLGINSAGLFLIDETEQVLASCCFSEVLKVH-------VESD-DKLH-----VMTFQHVNFVLQCSSAQDANEVINYMLDNLRQRSSYGVALDPVVEGDLEDCLVLNPGDLIEFEAGVTGAQLMAGNAQDCYRG--CVNGQWGQFLAGNVRVLATLTKPSEKLQDILREGRFQEPPKPTPRANY--SRRRQHNISQLAESHFREPLDSDKA-----------PLSKFSPEPLKAPLLKAVVKVPPLFQQALVMHHHILKYMGDIARSNLPVN--TDLIFQPALQHPLLCDELYCQLMKQLSDNPSSESEKRGWDLLYLATGLVAPSVLVMRELIILLRMRADALADACLKRLKRSLAQGQRKKAPHLIEVEGIQQRCLHIYHKIYFPDDTVEAFEIESHTRGAELIADIAQRLELKSPVGYSIFLKTGDRVYAMPEEEFVFDFITQLIYWLRQQRTIRSISDGQ----YQLHFMRKLWLNNHPGEDLNGDMIFSYPQELHKYLKGYYPIDCEQASRLAILVYSA--DHDVS-LQRLPEVLTRLIPEDLIPLQTVAEWRQQILPKVHRDH-LTEDHAKILFLQELSHFACFGSTFFVVKQQNDDALPETLLIAINSTGFHMLDPTTKEILRSYEYSQLGIWSSGKNHFHIRFGNMIGASKLLCSTTQGYKMDDLLASYV 2115          
BLAST of Dach-1 vs. Ensembl Zebrafish
Match: myo7aa (myosin VIIAa [Source:ZFIN;Acc:ZDB-GENE-020709-1])

HSP 1 Score: 2159.41 bits (5594), Expect = 0.000e+0
Identity = 1138/2211 (51.47%), Postives = 1507/2211 (68.16%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILD-PKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIA---EAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELS-RMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS----DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSAS-SLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            MV+ Q+GD+VW++ K+  +    VPIGA +K     QI V+DD+G+E  + P   T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYTYTG ILVAVNPY +LPIYT  +I+ Y N KIG++ PHIFAIADN Y NM+R ++DQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++NPILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q RDERNYH+FYCML+G+  + + + GL  +  Y YL  G      G  D  ++  + SAMKVL FT+ E  EI +LLAA LH+GN+ ++A+   N+D+CEV   S    A+ LL++D +DL   LT++ IITR + V T +SI Q +++RDA VKGIYGRLFVWIVEKIN AIY+P     P   L A       SIG+LDIFGFENF  NSFEQLCIN+ANENLQQFFVRH+FK+EQEEY  E I+WQHI FTDNQ+ LD+I +K  NI++LIDEES+FPKGTD ++LNKL +    +  +I  K      FGI+HFAGVV+Y+  GFLEKNRD  + D+++L+ ++K++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNE+KK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F+DRYR+L+PG+  +++ +D R T + + + +L     +Q+GKTK+FLKD  D+LLE  RDKA+++++ILIQK  R +  R+ FLK K +A+ IQ   R    R+ +  M+ GF  LQA +R++   +     +  I   Q  CRG L R   + +  A+I IQ+  R   A + +K LK +  +  EA  L+  +E   +NQMS  KA EEAEK H+ RL Q+  E   DA+++ K+  + ++++    + E+ R +PV++S+M+D++FG +   +  S P     AP  F DLE + R   + D+         D       ED+SE+ F KF+ATYFQ      + R+PL++PLLFH +   Q++ALAVWI +LRFM DLPEP  + + +  +  +P+MTKIY++LG++  K+++     E E  TN   ++  S+   R  +VSLTLKKKSK T+EV   LND E  ++    +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQICKQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ LS KI L+D+FGFSL+IA+ DKVSS+GSG DHVMDA+SQCEQ+AKE+G  E  A WRLFFRKEIFTPWH+  +D VAT+LIY Q++RG+KFGEYRCD  +D+ +L + Q  +D   ++  E L      Y+P   I   K  ++ W   +  A K    T ++  +  +K+KEE+V FAR KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ LELSFPEI AVSSS+          +L  QS +L+T+K   +TF   N+EDIRDL+V FLEGL++RS + + +Q    P   DS+FLS  KGDL++L+  D    + TS W +G N RTK+ GDFPAD VY+LP +  P  +++A  +     R               + R K +TLEEFS  YFR P   + S  M    +    LW  +R+ +K  LLKK    E+L Q+A   F A++ YMGD PSK   S  E+ + IF+  LK E LKDE+YCQ++ Q+T N    SE+ GWEL+WL  G+  P++ L   +    +S     LAL+C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD C NI S++ LK  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP KDG +    YQVFFMKKLWT TVPG D  AD +FHY QE+ KYL GYHK   ++   LGALI R   + D S   S  + L  +IP D++ +    + ++ ++A ++     S  +AK+ FLKIIF+WPTFGSAFFEVKQ+T  + PE +LIAINK GV LI  K K+ L  YP++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLTT++K
Sbjct:    1 MVILQQGDYVWLDLKTGHEFE--VPIGAVVKLCDSGQIQVLDDEGNEHWISPQNATNIKPMHPTSIHGVEDMIRLGDLNEAGILRNLLIRYREHLIYTYTGSILVAVNPYQLLPIYTADQIRLYTNKKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQARDERNYHIFYCMLKGMTPDQKKQLGLSKATDYTYLTIGNCTVCDGRDDQKEYSNIRSAMKVLMFTDKENWEISKLLAAILHMGNLRYEARTYDNLDACEVVRCSALTTAAVLLEVDLKDLMNCLTSRTIITRGETVSTPLSIEQALDVRDAFVKGIYGRLFVWIVEKINAAIYKP-----PSLELKAVRR----SIGLLDIFGFENFMVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLENINWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDTTMLNKLNSQHKLNTNYIPPKNTYETQFGIQHFAGVVYYETRGFLEKNRDTLHGDIIQLVHSSKNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMMETIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQEDLRGTCQRIAEAVLGRDDDWQMGKTKIFLKDHHDMLLEIERDKAITDKVILIQKVVRGFKDRSNFLKMKKSAMLIQKTWRGYYCRKNYGAMRGGFSRLQALYRSRKLYQTYHVARQRIMLFQGRCRGFLVRRAFRHRLWAVITIQAYTRGMIARRLYKRLKGEYRRRLEAEKLRLAEEQKLRNQMSARKAKEEAEKMHQERLAQLARE---DAEREKKERQEARRKMEMLDQMEKARQEPVNDSDMVDKMFGFLG--TTNSFPGQEGQAPAGFEDLERTHRELEVEDLDESLPLPEDDL------EDLSEYKFAKFSATYFQGTSTHTYMRRPLKQPLLFHEDEGDQLAALAVWITVLRFMGDLPEPKYHTAISDGSEKIPVMTKIYETLGKKTYKRELQALQGEGEN-TNIESHKKSSV---RHKLVSLTLKKKSKITEEVTKRLNDGEYTVHG---NSMLEDRPTSNLEKLHFIIGNGILRPGLRDEIYCQICKQLNQNPSKSSHARGWILMSLCVGCFAPSEKFVKYLRNFISEGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAKELCNALSDKISLQDRFGFSLYIALFDKVSSLGSGNDHVMDAVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHDPAEDAVATNLIYQQIVRGVKFGEYRCDR-EDLAELASQQYYVDYGSEILVERLLSLIPSYIPDREISSAKTVER-WAQFIMAAHKKGVYTQKR--VDPQKVKEEVVDFARYKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEITAVSSSK--------GGKLQAQSFTLATIKADEFTFTSNNAEDIRDLVVTFLEGLRKRSKFVVALQDNPSPAADDSTFLSFLKGDLIVLD-QDTGEQVMTSGWAHGTNDRTKQRGDFPADCVYVLPTVVRPPHDVVAFVTMTPDQRQESLRISHVPALTETEERVKPYTLEEFSYDYFRPPPKHTLSRVMITKNRGKDKLWCCTREPIKQALLKKCGGHEELSQEACMAFIAVMKYMGDYPSKRTRSVNELTDQIFEGALKAEPLKDEIYCQILKQLTENHIKYSEEKGWELLWLCVGLFPPSNVLLPHVQRFLQSKKHHPLALDCMQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCLNISSRLLLKTPEGFSLFVKISDKVISVPEGDFFFDFVRHLTDWIKKARPAKDGIVPSLTYQVFFMKKLWTTTVPGKDSFADSIFHYYQELPKYLRGYHKCSREEVFQLGALIYRVKFEDDKSHFPSIPKMLKEMIPQDLIRQLSPDDWKRSIVAYFNRHAGKSREEAKLMFLKIIFKWPTFGSAFFEVKQTTEPHFPEILLIAINKYGVSLIDPKNKDILTTYPFTKISNWSSGNTYFHITIGNLVQGSKLLCETSLGYKMDDLLTSYISQMLTTMSK 2169          
BLAST of Dach-1 vs. Ensembl Zebrafish
Match: myo7aa (myosin VIIAa [Source:ZFIN;Acc:ZDB-GENE-020709-1])

HSP 1 Score: 2159.41 bits (5594), Expect = 0.000e+0
Identity = 1138/2211 (51.47%), Postives = 1507/2211 (68.16%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILD-PKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIA---EAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELS-RMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS----DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSAS-SLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            MV+ Q+GD+VW++ K+  +    VPIGA +K     QI V+DD+G+E  + P   T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYTYTG ILVAVNPY +LPIYT  +I+ Y N KIG++ PHIFAIADN Y NM+R ++DQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++NPILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q RDERNYH+FYCML+G+  + + + GL  +  Y YL  G      G  D  ++  + SAMKVL FT+ E  EI +LLAA LH+GN+ ++A+   N+D+CEV   S    A+ LL++D +DL   LT++ IITR + V T +SI Q +++RDA VKGIYGRLFVWIVEKIN AIY+P     P   L A       SIG+LDIFGFENF  NSFEQLCIN+ANENLQQFFVRH+FK+EQEEY  E I+WQHI FTDNQ+ LD+I +K  NI++LIDEES+FPKGTD ++LNKL +    +  +I  K      FGI+HFAGVV+Y+  GFLEKNRD  + D+++L+ ++K++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNE+KK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F+DRYR+L+PG+  +++ +D R T + + + +L     +Q+GKTK+FLKD  D+LLE  RDKA+++++ILIQK  R +  R+ FLK K +A+ IQ   R    R+ +  M+ GF  LQA +R++   +     +  I   Q  CRG L R   + +  A+I IQ+  R   A + +K LK +  +  EA  L+  +E   +NQMS  KA EEAEK H+ RL Q+  E   DA+++ K+  + ++++    + E+ R +PV++S+M+D++FG +   +  S P     AP  F DLE + R   + D+         D       ED+SE+ F KF+ATYFQ      + R+PL++PLLFH +   Q++ALAVWI +LRFM DLPEP  + + +  +  +P+MTKIY++LG++  K+++     E E  TN   ++  S+   R  +VSLTLKKKSK T+EV   LND E  ++    +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQICKQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ LS KI L+D+FGFSL+IA+ DKVSS+GSG DHVMDA+SQCEQ+AKE+G  E  A WRLFFRKEIFTPWH+  +D VAT+LIY Q++RG+KFGEYRCD  +D+ +L + Q  +D   ++  E L      Y+P   I   K  ++ W   +  A K    T ++  +  +K+KEE+V FAR KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ LELSFPEI AVSSS+          +L  QS +L+T+K   +TF   N+EDIRDL+V FLEGL++RS + + +Q    P   DS+FLS  KGDL++L+  D    + TS W +G N RTK+ GDFPAD VY+LP +  P  +++A  +     R               + R K +TLEEFS  YFR P   + S  M    +    LW  +R+ +K  LLKK    E+L Q+A   F A++ YMGD PSK   S  E+ + IF+  LK E LKDE+YCQ++ Q+T N    SE+ GWEL+WL  G+  P++ L   +    +S     LAL+C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD C NI S++ LK  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP KDG +    YQVFFMKKLWT TVPG D  AD +FHY QE+ KYL GYHK   ++   LGALI R   + D S   S  + L  +IP D++ +    + ++ ++A ++     S  +AK+ FLKIIF+WPTFGSAFFEVKQ+T  + PE +LIAINK GV LI  K K+ L  YP++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLTT++K
Sbjct:    1 MVILQQGDYVWLDLKTGHEFE--VPIGAVVKLCDSGQIQVLDDEGNEHWISPQNATNIKPMHPTSIHGVEDMIRLGDLNEAGILRNLLIRYREHLIYTYTGSILVAVNPYQLLPIYTADQIRLYTNKKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQARDERNYHIFYCMLKGMTPDQKKQLGLSKATDYTYLTIGNCTVCDGRDDQKEYSNIRSAMKVLMFTDKENWEISKLLAAILHMGNLRYEARTYDNLDACEVVRCSALTTAAVLLEVDLKDLMNCLTSRTIITRGETVSTPLSIEQALDVRDAFVKGIYGRLFVWIVEKINAAIYKP-----PSLELKAVRR----SIGLLDIFGFENFMVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLENINWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDTTMLNKLNSQHKLNTNYIPPKNTYETQFGIQHFAGVVYYETRGFLEKNRDTLHGDIIQLVHSSKNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMMETIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQEDLRGTCQRIAEAVLGRDDDWQMGKTKIFLKDHHDMLLEIERDKAITDKVILIQKVVRGFKDRSNFLKMKKSAMLIQKTWRGYYCRKNYGAMRGGFSRLQALYRSRKLYQTYHVARQRIMLFQGRCRGFLVRRAFRHRLWAVITIQAYTRGMIARRLYKRLKGEYRRRLEAEKLRLAEEQKLRNQMSARKAKEEAEKMHQERLAQLARE---DAEREKKERQEARRKMEMLDQMEKARQEPVNDSDMVDKMFGFLG--TTNSFPGQEGQAPAGFEDLERTHRELEVEDLDESLPLPEDDL------EDLSEYKFAKFSATYFQGTSTHTYMRRPLKQPLLFHEDEGDQLAALAVWITVLRFMGDLPEPKYHTAISDGSEKIPVMTKIYETLGKKTYKRELQALQGEGEN-TNIESHKKSSV---RHKLVSLTLKKKSKITEEVTKRLNDGEYTVHG---NSMLEDRPTSNLEKLHFIIGNGILRPGLRDEIYCQICKQLNQNPSKSSHARGWILMSLCVGCFAPSEKFVKYLRNFISEGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAKELCNALSDKISLQDRFGFSLYIALFDKVSSLGSGNDHVMDAVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHDPAEDAVATNLIYQQIVRGVKFGEYRCDR-EDLAELASQQYYVDYGSEILVERLLSLIPSYIPDREISSAKTVER-WAQFIMAAHKKGVYTQKR--VDPQKVKEEVVDFARYKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEITAVSSSK--------GGKLQAQSFTLATIKADEFTFTSNNAEDIRDLVVTFLEGLRKRSKFVVALQDNPSPAADDSTFLSFLKGDLIVLD-QDTGEQVMTSGWAHGTNDRTKQRGDFPADCVYVLPTVVRPPHDVVAFVTMTPDQRQESLRISHVPALTETEERVKPYTLEEFSYDYFRPPPKHTLSRVMITKNRGKDKLWCCTREPIKQALLKKCGGHEELSQEACMAFIAVMKYMGDYPSKRTRSVNELTDQIFEGALKAEPLKDEIYCQILKQLTENHIKYSEEKGWELLWLCVGLFPPSNVLLPHVQRFLQSKKHHPLALDCMQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCLNISSRLLLKTPEGFSLFVKISDKVISVPEGDFFFDFVRHLTDWIKKARPAKDGIVPSLTYQVFFMKKLWTTTVPGKDSFADSIFHYYQELPKYLRGYHKCSREEVFQLGALIYRVKFEDDKSHFPSIPKMLKEMIPQDLIRQLSPDDWKRSIVAYFNRHAGKSREEAKLMFLKIIFKWPTFGSAFFEVKQTTEPHFPEILLIAINKYGVSLIDPKNKDILTTYPFTKISNWSSGNTYFHITIGNLVQGSKLLCETSLGYKMDDLLTSYISQMLTTMSK 2169          
BLAST of Dach-1 vs. Ensembl Zebrafish
Match: myo7aa (myosin VIIAa [Source:ZFIN;Acc:ZDB-GENE-020709-1])

HSP 1 Score: 2151.33 bits (5573), Expect = 0.000e+0
Identity = 1135/2206 (51.45%), Postives = 1503/2206 (68.13%), Query Frame = 3
Query:  174 KGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILD-PKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIA---EAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELS-RMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS----DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSAS-SLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            +GD+VW++ K+  +    VPIGA +K     QI V+DD+G+E  + P   T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYTYTG ILVAVNPY +LPIYT  +I+ Y N KIG++ PHIFAIADN Y NM+R ++DQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++NPILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q RDERNYH+FYCML+G+  + + + GL  +  Y YL  G      G  D  ++  + SAMKVL FT+ E  EI +LLAA LH+GN+ ++A+   N+D+CEV   S    A+ LL++D +DL   LT++ IITR + V T +SI Q +++RDA VKGIYGRLFVWIVEKIN AIY+P     P   L A       SIG+LDIFGFENF  NSFEQLCIN+ANENLQQFFVRH+FK+EQEEY  E I+WQHI FTDNQ+ LD+I +K  NI++LIDEES+FPKGTD ++LNKL +    +  +I  K      FGI+HFAGVV+Y+  GFLEKNRD  + D+++L+ ++K++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNE+KK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F+DRYR+L+PG+  +++ +D R T + + + +L     +Q+GKTK+FLKD  D+LLE  RDKA+++++ILIQK  R +  R+ FLK K +A+ IQ   R    R+ +  M+ GF  LQA +R++   +     +  I   Q  CRG L R   + +  A+I IQ+  R   A + +K LK +  +  EA  L+  +E   +NQMS  KA EEAEK H+ RL Q+  E   DA+++ K+  + ++++    + E+ R +PV++S+M+D++FG +   +  S P     AP  F DLE + R   + D+         D       ED+SE+ F KF+ATYFQ      + R+PL++PLLFH +   Q++ALAVWI +LRFM DLPEP  + + +  +  +P+MTKIY++LG++  K+++     E E  TN   ++  S+   R  +VSLTLKKKSK T+EV   LND E  ++    +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQICKQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ LS KI L+D+FGFSL+IA+ DKVSS+GSG DHVMDA+SQCEQ+AKE+G  E  A WRLFFRKEIFTPWH+  +D VAT+LIY Q++RG+KFGEYRCD  +D+ +L + Q  +D   ++  E L      Y+P   I   K  ++ W   +  A K    T ++  +  +K+KEE+V FAR KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ LELSFPEI AVSSS+          +L  QS +L+T+K   +TF   N+EDIRDL+V FLEGL++RS + + +Q    P   DS+FLS  KGDL++L+  D    + TS W +G N RTK+ GDFPAD VY+LP +  P  +++A  +     R               + R K +TLEEFS  YFR P   + S  M    +    LW  +R+ +K  LLKK    E+L Q+A   F A++ YMGD PSK   S  E+ + IF+  LK E LKDE+YCQ++ Q+T N    SE+ GWEL+WL  G+  P++ L   +    +S     LAL+C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD C NI S++ LK  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP KDG +    YQVFFMKKLWT TVPG D  AD +FHY QE+ KYL GYHK   ++   LGALI R   + D S   S  + L  +IP D++ +    + ++ ++A ++     S  +AK+ FLKIIF+WPTFGSAFFEVKQ+T  + PE +LIAINK GV LI  K K+ L  YP++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLTT++K
Sbjct:   17 QGDYVWLDLKTGHEFE--VPIGAVVKLCDSGQIQVLDDEGNEHWISPQNATNIKPMHPTSIHGVEDMIRLGDLNEAGILRNLLIRYREHLIYTYTGSILVAVNPYQLLPIYTADQIRLYTNKKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQARDERNYHIFYCMLKGMTPDQKKQLGLSKATDYTYLTIGNCTVCDGRDDQKEYSNIRSAMKVLMFTDKENWEISKLLAAILHMGNLRYEARTYDNLDACEVVRCSALTTAAVLLEVDLKDLMNCLTSRTIITRGETVSTPLSIEQALDVRDAFVKGIYGRLFVWIVEKINAAIYKP-----PSLELKAVRR----SIGLLDIFGFENFMVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLENINWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDTTMLNKLNSQHKLNTNYIPPKNTYETQFGIQHFAGVVYYETRGFLEKNRDTLHGDIIQLVHSSKNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMMETIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQEDLRGTCQRIAEAVLGRDDDWQMGKTKIFLKDHHDMLLEIERDKAITDKVILIQKVVRGFKDRSNFLKMKKSAMLIQKTWRGYYCRKNYGAMRGGFSRLQALYRSRKLYQTYHVARQRIMLFQGRCRGFLVRRAFRHRLWAVITIQAYTRGMIARRLYKRLKGEYRRRLEAEKLRLAEEQKLRNQMSARKAKEEAEKMHQERLAQLARE---DAEREKKERQEARRKMEMLDQMEKARQEPVNDSDMVDKMFGFLG--TTNSFPGQEGQAPAGFEDLERTHRELEVEDLDESLPLPEDDL------EDLSEYKFAKFSATYFQGTSTHTYMRRPLKQPLLFHEDEGDQLAALAVWITVLRFMGDLPEPKYHTAISDGSEKIPVMTKIYETLGKKTYKRELQALQGEGEN-TNIESHKKSSV---RHKLVSLTLKKKSKITEEVTKRLNDGEYTVHG---NSMLEDRPTSNLEKLHFIIGNGILRPGLRDEIYCQICKQLNQNPSKSSHARGWILMSLCVGCFAPSEKFVKYLRNFISEGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAKELCNALSDKISLQDRFGFSLYIALFDKVSSLGSGNDHVMDAVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHDPAEDAVATNLIYQQIVRGVKFGEYRCDR-EDLAELASQQYYVDYGSEILVERLLSLIPSYIPDREISSAKTVER-WAQFIMAAHKKGVYTQKR--VDPQKVKEEVVDFARYKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEITAVSSSK--------GGKLQAQSFTLATIKADEFTFTSNNAEDIRDLVVTFLEGLRKRSKFVVALQDNPSPAADDSTFLSFLKGDLIVLD-QDTGEQVMTSGWAHGTNDRTKQRGDFPADCVYVLPTVVRPPHDVVAFVTMTPDQRQESLRISHVPALTETEERVKPYTLEEFSYDYFRPPPKHTLSRVMITKNRGKDKLWCCTREPIKQALLKKCGGHEELSQEACMAFIAVMKYMGDYPSKRTRSVNELTDQIFEGALKAEPLKDEIYCQILKQLTENHIKYSEEKGWELLWLCVGLFPPSNVLLPHVQRFLQSKKHHPLALDCMQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCLNISSRLLLKTPEGFSLFVKISDKVISVPEGDFFFDFVRHLTDWIKKARPAKDGIVPSLTYQVFFMKKLWTTTVPGKDSFADSIFHYYQELPKYLRGYHKCSREEVFQLGALIYRVKFEDDKSHFPSIPKMLKEMIPQDLIRQLSPDDWKRSIVAYFNRHAGKSREEAKLMFLKIIFKWPTFGSAFFEVKQTTEPHFPEILLIAINKYGVSLIDPKNKDILTTYPFTKISNWSSGNTYFHITIGNLVQGSKLLCETSLGYKMDDLLTSYISQMLTTMSK 2180          
BLAST of Dach-1 vs. Ensembl Zebrafish
Match: BX324225.1 (myosin VIIAb [Source:NCBI gene;Acc:556141])

HSP 1 Score: 2135.92 bits (5533), Expect = 0.000e+0
Identity = 1117/2222 (50.27%), Postives = 1511/2222 (68.00%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHE--FILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETT-KLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNT------------SRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILAL--FSDRSFGDSYGGGSNNNHNDSRGKQ-HTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSAS-SLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSSN 6737
            MV+ Q+GD+VW++ ++  +    VP+GA +K     QI V+DD+G E    L+  T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY    IYTYTG ILVAVNPY +LPIYTP +I+ Y N KIG++ PHIF IADN Y +M+R  +DQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++NPILEAFGNAKTIRNDNSSRFGKY+DI+F   GAIEGAKI+Q+LLEKSR+  Q  DERNYH+FYCML G+  + +++ GL  +  Y YL  G      G  D+ ++ ++ SAMK+L FTE E  EI +LLAA LH+GN+ F+A+ +RN+D+C V    +   A+ LL++D +D+   LTT+ +ITR + V T +S+ QG+++RDA VKGIYGRLFVWIV+KIN  I+R         A + ++ +   SIG+LDIFGFENF  NSFEQLCIN+ANENLQQFFV H+FK+EQEEY  E I+WQ I FTDNQ+ LD+I +K  NI++LIDEES+FPKGTD ++LNKL +    +  +I  K      FGI+HFAGVVHY+  GFLEKNRD  ++D+++L+ ++K++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNE KK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F+DRYR+L+PG+  + + +D R T  ++V   +L    +QIGKTK+FLKD  D+LLE  RDK +++++ILIQKT R    RT+FLK + A + IQ   R  +TR+ +  M+ GF  LQA +R++   ++ +  +  +  +Q  CRG L R    ++  A++ IQ+  R   A ++ K L+ +  +  EA   +  +E   +NQM+  +A  EA ++H+ RL Q+  E       +  +    K+ + + ER + +PV++S+M+D++FG +   +  S+PN    AP  F DLE    NA      +    +P  L +  +ED+SE+ F KFAATYFQ +    + R+PL++PLLFH +   Q++ALAVWI +LRFM DLPEP  + S +  +  +P+MTKIY++LG++  K+++     + E  T  +   N    + R  +VSLTLKKKSK T+EV   L D +  L     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQICKQL+ N    S +RG ILL+LC+GCFAP+EKFV+ LR FI +     A +   RL+RTF+N TR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ LS KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDA+SQCEQ+AKE+G  E  A WRLFFRKEIFTPWHN  +D VAT+LIY Q++RG+KFGEYRCD ++D+ +L + Q  +D   ++  E L      Y+P   I  +K  +K W  ++         T ++    S+++KEE+V FAR KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ L+LSFPEI AVSSSR +  +  N+             +L GQS +L+T+KG  YTF   N+EDIRDL+V FLEGL+ RS + + +     P   D+SFL   KGDL+ L+ +   + + TS W +G N RTK+ GDFPAD VY+LP I  P  +I++L   S     DS      N  +     Q +TLEEFS  +FR PS  + S  +    +    +W  +R+ LK PLLKK+L+ E+L Q A         YMGD PSK   S  E+ + IF+  LK E LKDE+YCQ+I Q+T N    SE+ GWEL+WL TG+  P++ L   + +  +S     +A +C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD C+NI  ++ L   +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK R VKDG +    YQVFFMKKLWTNT PG D +AD +FHY QE+ KYL GYHK  +++A  L ALI R   ++D S    + +    L+P D++++    + ++ V+  ++     S  +AK+ FL+II++WPTFGSAFFEVKQS++ + PE +LIAINK GV LI  KTK+ L  +P++ ISNWSSG+TYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLTT+TK  S+
Sbjct:    1 MVILQQGDYVWLDLRTDHEFD--VPVGAVVKFCDSGQIQVLDDEGKEQQISLQNATNIKPMHPTSIHGVEDMIRLGDLNEAGILRNLLIRYNDRVIYTYTGSILVAVNPYQLLPIYTPDQIRLYTNKKIGEMPPHIFGIADNCYFSMQRNKKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYVDIHFNKRGAIEGAKIEQYLLEKSRVCRQAADERNYHIFYCMLAGMSPDQKTKLGLGRATDYTYLTMGNCTVCEGRDDMKEYSSILSAMKILMFTETEYWEISKLLAAILHMGNLRFEARTQRNLDTCVVVRSPDLANAASLLEVDPQDVMMCLTTRTLITRGESVSTPLSVEQGLDVRDAFVKGIYGRLFVWIVDKINATIFR---------APSTENRTVRRSIGLLDIFGFENFTVNSFEQLCINFANENLQQFFVHHVFKLEQEEYNLEDINWQDIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDATMLNKLNSQHKLNTNYIPPKHSHETQFGIQHFAGVVHYETKGFLEKNRDSLHSDIIQLVHSSKNKFIKQIFQADVAMGMETRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNELKKPMMFDRGLCVRQLRYSGMMETIRIRRAGYPIRYTFAEFVDRYRVLMPGVKPAHKQEDLRGTCQRIVVSVLLRDDDWQIGKTKIFLKDHHDMLLEMERDKVITDKVILIQKTVRGMKERTKFLKVRRAVMLIQRIWRGYITRKHYAVMRVGFLRLQALYRSRKLHQEYQATRIRVTLLQAWCRGLLVRRTFSKRFHAVLTIQAYARGMIARRQCKRLRLERDRRLEAERQRLAEEERLRNQMTARRARAEAARKHQERLAQLDREQEERELAERNETRRKKELLEQMEREKKEPVNDSDMVDKMFGFLG--NANSLPNLEGEAPEGFEDLE----NAPKQFKEVIDEPLP--LPDDEEEDLSEYKFAKFAATYFQGNATHMYVRRPLKQPLLFHEDEGDQLAALAVWITVLRFMGDLPEPKYHISISDGSEKIPVMTKIYETLGKRTYKRELQALQVDEESSTTDIQKRN----SVRHKLVSLTLKKKSKLTEEVTRRLTDGDYSLQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQICKQLSQNASKSSHARGWILLSLCVGCFAPSEKFVKYLRTFINSGPPGYAPYCEERLRRTFANKTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAEELCNALSDKISLKDRFGFSLYIALFDKVSSLGSGKDHVMDAVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHNPAEDGVATNLIYQQIVRGVKFGEYRCDREEDLAELASQQYYVDYGPEILPERLLSLIQSYIPDREITPSKTVEK-WAQMIIAIHIKGIYTQKR--FDSQRVKEEVVDFARFKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLDLSFPEITAVSSSRLLTVLYINSFSSTFNQCAFRGGKLQGQSFTLATIKGDEYTFTSNNAEDIRDLVVAFLEGLRSRSKFVVAMMDSHYPAGQDASFLRFSKGDLIFLDEHTGEQ-VLTSGWAHGVNDRTKKRGDFPADNVYVLPTITRPQYDIVSLIIMSPDQRKDSVNLSQQNLLDSGEKVQPYTLEEFSYDHFRPPSKSTLSRVIINKGRGKDKIWCCTREPLKQPLLKKILSHEELSQDACQ-------YMGDYPSKRSRSVNELTDQIFEGALKAEPLKDEIYCQIIKQLTENHVKYSEEKGWELLWLCTGLFPPSNMLLPHVQKFLQSKKHHPVAPDCMQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCRNIAGRMMLHSSEGFSLFVKISDKVISVPEGDFFFDFVRHLTDWIKKARAVKDGTVPSLTYQVFFMKKLWTNTFPGKDPMADSIFHYFQELPKYLRGYHKCSVEEAFQLAALIYRVRFEEDKSHFVHFSKMQKELLPQDLIHQLSPDDWKRSVVTHFNKHAGKSREEAKLMFLEIIYKWPTFGSAFFEVKQSSDPHFPEVLLIAINKLGVTLIDPKTKDILGTHPFTKISNWSSGHTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTTMTKQRSS 2185          
BLAST of Dach-1 vs. Ensembl Zebrafish
Match: myo7ab (myosin VIIAb [Source:ZFIN;Acc:ZDB-GENE-091110-4])

HSP 1 Score: 2135.53 bits (5532), Expect = 0.000e+0
Identity = 1118/2222 (50.32%), Postives = 1512/2222 (68.05%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHE--FILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETT-KLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNT------------SRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILAL--FSDRSFGDSYGGGSNNNHNDSRGKQ-HTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSAS-SLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSSN 6737
            MV+ Q+GD+VW++ ++  +    VP+GA +K     QI V+DD+G E    L+  T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY    IYTYTG ILVAVNPY +LPIYTP +I+ Y N KIG++ PHIF IADN Y +M+R  +DQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++NPILEAFGNAKTIRNDNSSRFGKY+DI+F   GAIEGAKI+Q+LLEKSR+  Q  DERNYH+FYCML G+  + +++ GL  +  Y YL  G      G  D+ ++ ++ SAMK+L FTE E  EI +LLAA LH+GN+ F+A+ +RN+D+C V    +   A+ LL++D +D+   LTT+ +ITR + V T +S+ QG+++RDA VKGIYGRLFVWIV+KIN  I+R         A + ++ +   SIG+LDIFGFENF  NSFEQLCIN+ANENLQQFFV H+FK+EQEEY  E I+WQ I FTDNQ+ LD+I +K  NI++LIDEES+FPKGTD ++LNKL +    +  +I  K      FGI+HFAGVVHY+  GFLEKNRD  ++D+++L+ ++K++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNE KK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F+DRYR+L+PG+  + + +D R T  ++V   +L    +QIGKTK+FLKD  D+LLE  RDK +++++ILIQKT R    RT+FLK + A + IQ   R  +TR+ +  M+ GF  LQA +R++   ++ +  +  +  +Q  CRG L R    ++  A++ IQ+  R   A ++ K L+ +  +  EA   +  +E   KNQM+  +A  EA ++H+ RL Q+  E       +  +    K+ + + ER + +PV++S+M+D++FG +   +  S+PN    AP  F DLE    NA      +    +P  L +  +ED+SE+ F KFAATYFQ +    + R+PL++PLLFH +   Q++ALAVWI +LRFM DLPEP  + S +  +  +P+MTKIY++LG++  K+++     + E  T  +   N    + R  +VSLTLKKKSK T+EV   L D++  L     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQICKQL+ N    S +RG ILL+LC+GCFAP+EKFV+ LR FI +     A +   RL+RTF+N TR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ LS KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDA+SQCEQ+AKE+G  E  A WRLFFRKEIFTPWHN  +D VAT+LIY Q++RG+KFGEYRCD ++D+ +L + Q  +D   ++  E L      Y+P   I  +K  +K W  ++         T ++    S+++KEE+V FAR KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ L+LSFPEI AVSSSR +  +  N+             +L GQS +L+T+KG  YTF   N+EDIRDL+V FLEGL+ RS + + +     P   D+SFL   KGDL+ L+ +   + + TS W +G N RTK+ GDFPAD VY+LP I  P  +I++L   S     DS      N  +     Q +TLEEFS  +FR PS  + S  +    +    +W  +R+ LK PLLKK+L+ E+L Q A         YMGD PSK   S  E+ + IF+  LK E LKDE+YCQ+I Q+T N    SE+ GWEL+WL TG+  P++ L   + +  +S     +A +C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD C+NI  ++ L   +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK R VKDG +    YQVFFMKKLWTNT PG D +AD +FHY QE+ KYL GYHK  +++A  L ALI R   ++D S    + +    L+P D++++    + ++ V+  ++     S  +AK+ FL+II++WPTFGSAFFEVKQS++ + PE +LIAINK GV LI  KTK+ L  +P++ ISNWSSG+TYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLTT+TK  S+
Sbjct:    1 MVILQQGDYVWLDLRTDHEFD--VPVGAVVKFCDSGQIQVLDDEGKEQQISLQNATNIKPMHPTSIHGVEDMIRLGDLNEAGILRNLLIRYNDRVIYTYTGSILVAVNPYQLLPIYTPDQIRLYTNKKIGEMPPHIFGIADNCYFSMQRNKKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYVDIHFNKRGAIEGAKIEQYLLEKSRVCRQAADERNYHIFYCMLAGMSPDQKTKLGLGRATDYTYLTMGNCTVCEGRDDMKEYSSILSAMKILMFTETEYWEISKLLAAILHMGNLRFEARTQRNLDTCVVVRSPDLANAASLLEVDPQDVMMCLTTRTLITRGESVSTPLSVEQGLDVRDAFVKGIYGRLFVWIVDKINATIFR---------APSTENRTVRRSIGLLDIFGFENFTVNSFEQLCINFANENLQQFFVHHVFKLEQEEYNLEDINWQDIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDATMLNKLNSQHKLNTNYIPPKHSHETQFGIQHFAGVVHYETKGFLEKNRDSLHSDIIQLVHSSKNKFIKQIFQADVAMGMETRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNELKKPMMFDRGLCVRQLRYSGMMETIRIRRAGYPIRYTFAEFVDRYRVLMPGVKPAHKQEDLRGTCQRIVVSVLLRDDDWQIGKTKIFLKDHHDMLLEMERDKVITDKVILIQKTVRGMKERTKFLKVRRAVMLIQRIWRGYITRKHYAVMRVGFLRLQALYRSRKLHQEYQATRIRVTLLQAWCRGLLVRRTFSKRFHAVLTIQAYARGMIARRQCKRLRLERDRRLEAERQRLAEEERLKNQMTARRARAEAARKHQERLAQLDREQEERELAERNETRRKKELLEQMEREKKEPVNDSDMVDKMFGFLG--NANSLPNLEGEAPEGFEDLE----NAPKQFKEVIDEPLP--LPDDEEEDLSEYKFAKFAATYFQGNATHMYVRRPLKQPLLFHEDEGDQLAALAVWITVLRFMGDLPEPKYHISISDGSEKIPVMTKIYETLGKRTYKRELQALQVDEESSTTDIQKRN----SVRHKLVSLTLKKKSKLTEEVTRRLTDSDYSLQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQICKQLSQNASKSSHARGWILLSLCVGCFAPSEKFVKYLRTFINSGPPGYAPYCEERLRRTFANKTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAEELCNALSDKIGLKDRFGFSLYIALFDKVSSLGSGKDHVMDAVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHNPAEDGVATNLIYQQIVRGVKFGEYRCDREEDLAELASQQYYVDYGPEILPERLLSLIQSYIPDREITPSKTVEK-WAQMIIAIHIKGIYTQKR--FDSQRVKEEVVDFARFKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLDLSFPEITAVSSSRLLTVLYINSFSSTFNQCAFRGGKLQGQSFTLATIKGDEYTFTSNNAEDIRDLVVAFLEGLRSRSKFVVAMMDSHYPAGQDASFLRFSKGDLIFLDEHTGEQ-VLTSGWAHGVNDRTKKRGDFPADNVYVLPTITRPQYDIVSLIIMSPDQRKDSVNLSQQNLLDSGEKVQPYTLEEFSYDHFRPPSKSTLSRVIINKGRGKDKIWCCTREPLKQPLLKKILSHEELSQDACQ-------YMGDYPSKRSRSVNELTDQIFEGALKAEPLKDEIYCQIIKQLTENHVKYSEEKGWELLWLCTGLFPPSNMLLPHVQKFLQSKKHHPVAPDCMQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCRNIAGRMMLHSSEGFSLFVKISDKVISVPEGDFFFDFVRHLTDWIKKARAVKDGTVPSLTYQVFFMKKLWTNTFPGKDPMADSIFHYFQELPKYLRGYHKCSVEEAFQLAALIYRVRFEEDKSHFVHFSKMQKELLPQDLIHQLSPDDWKRSVVTHFNKHAGKSREEAKLMFLEIIYKWPTFGSAFFEVKQSSDPHFPEVLLIAINKLGVTLIDPKTKDILGTHPFTKISNWSSGHTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTTMTKQRSS 2185          
BLAST of Dach-1 vs. Ensembl Xenopus
Match: MYO7A (myosin 7a [Source:NCBI gene;Acc:100491335])

HSP 1 Score: 2157.49 bits (5589), Expect = 0.000e+0
Identity = 1129/2209 (51.11%), Postives = 1522/2209 (68.90%), Query Frame = 3
Query:  177 GDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYT------YTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDP-KGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRS-ASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            GD+VW++ K+  +    VP+GA +K     QI V+DD+G+E  + P   + I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYT      YTG ILVAVNPY +LPIYTP +I+ Y N KIG++ PHIFAIADN Y NM+R ++DQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++NPILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q +DERNYH+FYCML+G+  E + +  L  +  Y YL  G      G  D  ++  + SAMKVL FT+ E  EI +LLAA LH+GN+ ++A++  N+D+CEV   +    A+ LL++  ++L   LT++ IITR + V T +S+ Q +++RDA VKGIYGRLFVWIV+KIN AIYRP LS  PK+A          SIG+LDIFGFENF  NSFEQLCIN+ANENLQQFFVRH+FK+EQEEY  E I+WQHI FTDNQ+ LD+I +K  NI++LIDEES+FPKGTD ++LNKL      +  +I  K +    FGI HFAG+V+Y+  GFLEKNRD  + D+++L+ + K++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNE+KK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F+DRYR+L+PG+  +++  D R T + + +++L     +QIGKTK+FLKD  D+LLE  RDKA+++++ILIQK  R +  R+ FLK + AA+ IQ   R    RR +  M+ GF  LQA +R++    +    +  I   Q  CRG L R   + +  A+  IQ+  R   A + +K LK +  +  EA  L+  +E  FK +MS +KA +EAEK+H+ RL Q+  E   DA++++++  + +++   + + E+ RN+PV++S+M+D++FG +   +  S+P     AP  F DLE  R     +   + G      L    +ED+SE+ F KFAATYFQ      + R+PL++PLL+H +   Q++ALAVWI ILRFM DLPEP  + + ++ +  +P+MTKIY++LG++  K++ L+A +   + T    Y+  S+   R  +VSLTLKKKSK T+EV   L+D E+ L     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQI KQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF+NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ L+ KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDA+SQCEQ+AKE+G  E  A WRLFFRKEIFTPWH+  +D VAT+LIY Q++RG+KFGEYRCD ++D+ +L + Q  +D   +L  E L      Y+P   I  +K  +K+   ++    K +    R D   S+K+KE +V FAR KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ LELSFPEI AVSSSR          ++ GQS +++T+KG  YTF   N+EDIRDL+V FLEGL++RS Y + +Q    P   DS FLS +KGDL++L+ +D    I  S W +G N RTK  GDFP +IVY++P +  PS  ++AL +   D+          N +  + + K +TLEEFS  YFR P   + S  M    +    LW ++R+ +K  LLKK+L  +++ Q+A   F AIL YMGD PSK   S  E+ + IF+  LK E LKDE+YCQ++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     LA +C  RLQ+ L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD CQ+I +++ LK  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP KDG +    YQVFFMKKLWT TVPG D +AD +FHY QE+ KYL GYHK   +D + L ALI R   + D S   +  + L  L+P D++ +    E ++ ++A ++     +  ++K+AFLK+I++WPTFGSAFFEVKQ+T  + PE +LIAINK+GV LI  KTK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLT++ K
Sbjct:   36 GDYVWLDLKTGREFD--VPVGAVVKLCDSGQIQVLDDEGNEHWISPQNASHIKPMHPTSIHGVEDMIRLGDLNEAGILRNLLIRYREHLIYTNCGGRTYTGSILVAVNPYQLLPIYTPDQIRLYTNRKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKKGAIEGAKIEQYLLEKSRVCRQAQDERNYHIFYCMLKGMSPEQKKKLSLGQASDYNYLCMGKCTTCDGRDDSKEYANIRSAMKVLMFTDTENWEISRLLAAILHMGNLRYEARMYDNLDACEVVYSTSLTTAATLLEVGPQELMNCLTSRTIITRGETVSTPLSMEQALDVRDAFVKGIYGRLFVWIVDKINAAIYRP-LSNEPKAARR--------SIGLLDIFGFENFTVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLENINWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDTTMLNKLNVQHKLNTFYIPPKNNYETQFGINHFAGIVYYETKGFLEKNRDTLHGDIIQLVHSAKNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMMETIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQGDLRGTCERIAESVLGKDDDWQIGKTKIFLKDHHDMLLEIERDKAITDKVILIQKVVRGFKDRSNFLKIRKAALLIQRCWRGHNCRRNYTAMRIGFLRLQALYRSRKLHTQYHVARMRISYFQARCRGYLVRKAFRHRLWAVYTIQAHARGMIARRLYKRLKGEYHRRLEAEKLRLAEEERFKKEMSAKKAKQEAEKKHQERLAQLARE---DAEREVREKEEARRKKELLEKMEKARNEPVNDSDMVDKMFGFLG--TTSSLPGQEGQAPTGFEDLE--RPQGEMEEEDLDGALP---LPEEEEEDLSEYKFAKFAATYFQGTTTNTYIRRPLKQPLLYHEDEGDQLAALAVWITILRFMGDLPEPKYHTAMSNGSEKIPVMTKIYETLGKKTYKRE-LQALQGEGESTQIDGYKKNSV---RHKLVSLTLKKKSKITEEVTKRLHDGESTLQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTQNPSKSSHARGWILMSLCVGCFAPSEKFVKYLRNFISGGPPGYAPYCEERLRRTFANGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAKELCNSLADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHDPTEDNVATNLIYQQIVRGVKFGEYRCDKEEDLAELASQQYYVDYGSELIMERLLNLIPSYIPDREITPSKNVEKWAQFIIAAHKKGIYAQKRSD---SQKVKENVVDFARFKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEITAVSSSR--------GGKMQGQSFTMATIKGDEYTFTSNNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPVGEDSGFLSFQKGDLILLD-HDTGETIMNSGWAHGYNERTKHKGDFPTEIVYVMPTVTKPSGEVVALVTMTPDQKQDVVRAVQLNPSEQEEKMKPYTLEEFSYDYFRPPPKHTLSRVMITKNRGKDKLWSYTREPIKQALLKKVLMSDEMSQEACMAFIAILKYMGDYPSKRMRSVNELTDQIFEGALKGEPLKDEIYCQVLKQLTDNHIKYSEEKGWELLWLITGLFPPSNVLLPHIQRFIQSRKQHALATDCMHRLQRALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQDIANRLLLKSAEGFSLFVKISDKVISVPEGDFFFDFVRHLTDWIKKARPSKDGIVPSLTYQVFFMKKLWTTTVPGKDSMADSIFHYYQELPKYLRGYHKCTREDVLQLAALIYRVKFEDDKSYFPNIPKMLKELVPQDLIRQLNPDEWKRSIIAYFNKHAGKTREESKVAFLKLIYKWPTFGSAFFEVKQTTEPHFPEILLIAINKHGVSLIDPKTKDILATHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTSMNK 2204          
BLAST of Dach-1 vs. Ensembl Xenopus
Match: MYO7A (myosin 7a [Source:NCBI gene;Acc:100491335])

HSP 1 Score: 2154.02 bits (5580), Expect = 0.000e+0
Identity = 1129/2225 (50.74%), Postives = 1530/2225 (68.76%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDP-KGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSR-TMNFVSSNT-------------SRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAIL--IYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRS-ASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            + + Q GD+VW++ K+  +    VP+GA +K     QI V+DD+G+E  + P   + I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYTYTG ILVAVNPY +LPIYTP +I+ Y N KIG++ PHIFAIADN Y NM+R ++DQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++NPILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q+ DERNYH+FYCML+G+  E + +  L  +  Y YL  G      G  D  ++  + SAMKVL FT+ E  EI +LLAA LH+GN+ ++A++  N+D+CEV   +    A+ LL++  ++L   LT++ IITR + V T +S+ Q +++RDA VKGIYGRLFVWIV+KIN AIYRP LS  PK+A          SIG+LDIFGFENF  NSFEQLCIN+ANENLQQFFVRH+FK+EQEEY  E I+WQHI FTDNQ+ LD+I +K  NI++LIDEES+FPKGTD ++LNKL      +  +I  K +    FGI HFAG+V+Y+  GFLEKNRD  + D+++L+ + K++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNE+KK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F+DRYR+L+PG+  +++  D R T + + +++L     +QIGKTK+FLKD  D+LLE  RDKA+++++ILIQK  R +  R+ FLK + AA+ IQ   R    RR +  M+ GF  LQA +R++    +    +  I   Q  CRG L R   + +  A+  IQ+  R   A + +K LK +  +  EA  L+  +E  FK +MS +KA +EAEK+H+ RL Q+  E   DA++++++  + +++   + + E+ RN+PV++S+M+D++FG +   +  S+P     AP  F DLE  R     +   + G      L    +ED+SE+ F KFAATYFQ      + R+PL++PLL+H +   Q++ALAVWI ILRFM DLPEP  + + ++ +  +P+MTKIY++LG++  K++ L+A +   + T    Y+  S+   R  +VSLTLKKKSK T+EV   L+D E+ L     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQI KQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF+NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ L+ KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDA+SQCEQ+AKE+G  E  A WRLFFRKEIFTPWH+  +D VAT+LIY Q++RG+KFGEYRCD ++D+ +L + Q  +D   +L  E L      Y+P   I  +K  +K+   ++    K +    R D   S+K+KE +V FAR KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ LELSFPEI AVSSSR  +++++ +               ++ GQS +++T+KG  YTF   N+EDIRDL+V FLEGL++RS Y + +Q    P   DS FLS +KGDL++L+ +D    I  S W +G N RTK  GDFP +IVY++P +  PS  ++AL +   D+          N +  + + K +TLEEFS  YFR P   + S  M    +    LW ++R+ +K  LLKK+L  +++ Q+A   F  IL   YMGD PSK   S  E+ + IF+  LK E LKDE+YCQ++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     LA +C  RLQ+ L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD CQ+I +++ LK  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP KDG +    YQVFFMKKLWT TVPG D +AD +FHY QE+ KYL GYHK   +D + L ALI R   + D S   +  + L  L+P D++ +    E ++ ++A ++     +  ++K+AFLK+I++WPTFGSAFFEVKQ+T  + PE +LIAINK+GV LI  KTK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLT++ K
Sbjct:    1 LFILQPGDYVWLDLKTGREFD--VPVGAVVKLCDSGQIQVLDDEGNEHWISPQNASHIKPMHPTSIHGVEDMIRLGDLNEAGILRNLLIRYREHLIYTYTGSILVAVNPYQLLPIYTPDQIRLYTNRKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKKGAIEGAKIEQYLLEKSRVCRQVPDERNYHIFYCMLKGMSPEQKKKLSLGQASDYNYLCMGKCTTCDGRDDSKEYANIRSAMKVLMFTDTENWEISRLLAAILHMGNLRYEARMYDNLDACEVVYSTSLTTAATLLEVGPQELMNCLTSRTIITRGETVSTPLSMEQALDVRDAFVKGIYGRLFVWIVDKINAAIYRP-LSNEPKAARR--------SIGLLDIFGFENFTVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLENINWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDTTMLNKLNVQHKLNTFYIPPKNNYETQFGINHFAGIVYYETKGFLEKNRDTLHGDIIQLVHSAKNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMMETIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQGDLRGTCERIAESVLGKDDDWQIGKTKIFLKDHHDMLLEIERDKAITDKVILIQKVVRGFKDRSNFLKIRKAALLIQRCWRGHNCRRNYTAMRIGFLRLQALYRSRKLHTQYHVARMRISYFQARCRGYLVRKAFRHRLWAVYTIQAHARGMIARRLYKRLKGEYHRRLEAEKLRLAEEERFKKEMSAKKAKQEAEKKHQERLAQLARE---DAEREVREKEEARRKKELLEKMEKARNEPVNDSDMVDKMFGFLG--TTSSLPGQEGQAPTGFEDLE--RPQGEMEEEDLDGALP---LPEEEEEDLSEYKFAKFAATYFQGTTTNTYIRRPLKQPLLYHEDEGDQLAALAVWITILRFMGDLPEPKYHTAMSNGSEKIPVMTKIYETLGKKTYKRE-LQALQGEGESTQIDGYKKNSV---RHKLVSLTLKKKSKITEEVTKRLHDGESTLQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTQNPSKSSHARGWILMSLCVGCFAPSEKFVKYLRNFISGGPPGYAPYCEERLRRTFANGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAKELCNSLADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHDPTEDNVATNLIYQQIVRGVKFGEYRCDKEEDLAELASQQYYVDYGSELIMERLLNLIPSYIPDREITPSKNVEKWAQFIIAAHKKGIYAQKRSD---SQKVKENVVDFARFKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEITAVSSSRKCLHWLNQSAVLFLCVCKAVPIGGKMQGQSFTMATIKGDEYTFTSNNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPVGEDSGFLSFQKGDLILLD-HDTGETIMNSGWAHGYNERTKHKGDFPTEIVYVMPTVTKPSGEVVALVTMTPDQKQDVVRAVQLNPSEQEEKMKPYTLEEFSYDYFRPPPKHTLSRVMITKNRGKDKLWSYTREPIKQALLKKVLMSDEMSQEACMAFIDILSQSYMGDYPSKRMRSVNELTDQIFEGALKGEPLKDEIYCQVLKQLTDNHIKYSEEKGWELLWLITGLFPPSNVLLPHIQRFIQSRKQHALATDCMHRLQRALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQDIANRLLLKSAEGFSLFVKISDKVISVPEGDFFFDFVRHLTDWIKKARPSKDGIVPSLTYQVFFMKKLWTTTVPGKDSMADSIFHYYQELPKYLRGYHKCTREDVLQLAALIYRVKFEDDKSYFPNIPKMLKELVPQDLIRQLNPDEWKRSIIAYFNKHAGKTREESKVAFLKLIYKWPTFGSAFFEVKQTTEPHFPEILLIAINKHGVSLIDPKTKDILATHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTSMNK 2193          
BLAST of Dach-1 vs. Ensembl Xenopus
Match: MYO7A (myosin 7a [Source:NCBI gene;Acc:100491335])

HSP 1 Score: 2150.56 bits (5571), Expect = 0.000e+0
Identity = 1129/2222 (50.81%), Postives = 1522/2222 (68.50%), Query Frame = 3
Query:  177 GDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKM-------------------GFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDP-KGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRS-ASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            GD+VW++ K+  +    VP+GA +K     QI V+DD+G+E  + P   + I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYTYTG ILVAVNPY +LPIYTP +I+ Y N KIG++ PHIFAIADN Y NM+R ++DQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++NPILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q +DERNYH+FYCML+G+  E + +  L  +  Y YL  G      G  D  ++  + SAMKVL FT+ E  EI +LLAA LH+GN+ ++A++  N+D+CEV   +    A+ LL++  ++L   LT++ IITR + V T +S+ Q +++RDA VKGIYGRLFVWIV+KIN AIYRP LS  PK+A          SIG+LDIFGFENF  NSFEQLCIN+ANENLQQFFVRH+FK+EQEEY  E I+WQHI FTDNQ+ LD+I +K  NI++LIDEES+FPKGTD ++LNKL      +  +I  K +    FGI HFAG+V+Y+  GFLEKNRD  + D+++L+ + K++F+K +F+ D  M                   G +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNE+KK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F+DRYR+L+PG+  +++  D R T + + +++L     +QIGKTK+FLKD  D+LLE  RDKA+++++ILIQK  R +  R+ FLK + AA+ IQ   R    RR +  M+ GF  LQA +R++    +    +  I   Q  CRG L R   + +  A+  IQ+  R   A + +K LK +  +  EA  L+  +E  FK +MS +KA +EAEK+H+ RL Q+  E   DA++++++  + +++   + + E+ RN+PV++S+M+D++FG +   +  S+P     AP  F DLE  R     +   + G      L    +ED+SE+ F KFAATYFQ      + R+PL++PLL+H +   Q++ALAVWI ILRFM DLPEP  + + ++ +  +P+MTKIY++LG++  K++ L+A +   + T    Y+  S+   R  +VSLTLKKKSK T+EV   L+D E+ L     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQI KQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF+NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ L+ KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDA+SQCEQ+AKE+G  E  A WRLFFRKEIFTPWH+  +D VAT+LIY Q++RG+KFGEYRCD ++D+ +L + Q  +D   +L  E L      Y+P   I  +K  +K+   ++    K +    R D   S+K+KE +V FAR KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ LELSFPEI AVSSSR          ++ GQS +++T+KG  YTF   N+EDIRDL+V FLEGL++RS Y + +Q    P   DS FLS +KGDL++L+ +D    I  S W +G N RTK  GDFP +IVY++P +  PS  ++AL +   D+          N +  + + K +TLEEFS  YFR P   + S  M    +    LW ++R+ +K  LLKK+L  +++ Q+A   F AIL YMGD PSK   S  E+ + IF+  LK E LKDE+YCQ++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     LA +C  RLQ+ L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD CQ+I +++ LK  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP KDG +    YQVFFMKKLWT TVPG D +AD +FHY QE+ KYL GYHK   +D + L ALI R   + D S   +  + L  L+P D++ +    E ++ ++A ++     +  ++K+AFLK+I++WPTFGSAFFEVKQ+T  + PE +LIAINK+GV LI  KTK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLT++ K
Sbjct:   36 GDYVWLDLKTGREFD--VPVGAVVKLCDSGQIQVLDDEGNEHWISPQNASHIKPMHPTSIHGVEDMIRLGDLNEAGILRNLLIRYREHLIYTYTGSILVAVNPYQLLPIYTPDQIRLYTNRKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKKGAIEGAKIEQYLLEKSRVCRQAQDERNYHIFYCMLKGMSPEQKKKLSLGQASDYNYLCMGKCTTCDGRDDSKEYANIRSAMKVLMFTDTENWEISRLLAAILHMGNLRYEARMYDNLDACEVVYSTSLTTAATLLEVGPQELMNCLTSRTIITRGETVSTPLSMEQALDVRDAFVKGIYGRLFVWIVDKINAAIYRP-LSNEPKAARR--------SIGLLDIFGFENFTVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLENINWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDTTMLNKLNVQHKLNTFYIPPKNNYETQFGINHFAGIVYYETKGFLEKNRDTLHGDIIQLVHSAKNKFIKQIFQADVAMFLCGYPSTAFGLSSTPPIKGAETRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMMETIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQGDLRGTCERIAESVLGKDDDWQIGKTKIFLKDHHDMLLEIERDKAITDKVILIQKVVRGFKDRSNFLKIRKAALLIQRCWRGHNCRRNYTAMRIGFLRLQALYRSRKLHTQYHVARMRISYFQARCRGYLVRKAFRHRLWAVYTIQAHARGMIARRLYKRLKGEYHRRLEAEKLRLAEEERFKKEMSAKKAKQEAEKKHQERLAQLARE---DAEREVREKEEARRKKELLEKMEKARNEPVNDSDMVDKMFGFLG--TTSSLPGQEGQAPTGFEDLE--RPQGEMEEEDLDGALP---LPEEEEEDLSEYKFAKFAATYFQGTTTNTYIRRPLKQPLLYHEDEGDQLAALAVWITILRFMGDLPEPKYHTAMSNGSEKIPVMTKIYETLGKKTYKRE-LQALQGEGESTQIDGYKKNSV---RHKLVSLTLKKKSKITEEVTKRLHDGESTLQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTQNPSKSSHARGWILMSLCVGCFAPSEKFVKYLRNFISGGPPGYAPYCEERLRRTFANGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAKELCNSLADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHDPTEDNVATNLIYQQIVRGVKFGEYRCDKEEDLAELASQQYYVDYGSELIMERLLNLIPSYIPDREITPSKNVEKWAQFIIAAHKKGIYAQKRSD---SQKVKENVVDFARFKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEITAVSSSR--------GGKMQGQSFTMATIKGDEYTFTSNNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPVGEDSGFLSFQKGDLILLD-HDTGETIMNSGWAHGYNERTKHKGDFPTEIVYVMPTVTKPSGEVVALVTMTPDQKQDVVRAVQLNPSEQEEKMKPYTLEEFSYDYFRPPPKHTLSRVMITKNRGKDKLWSYTREPIKQALLKKVLMSDEMSQEACMAFIAILKYMGDYPSKRMRSVNELTDQIFEGALKGEPLKDEIYCQVLKQLTDNHIKYSEEKGWELLWLITGLFPPSNVLLPHIQRFIQSRKQHALATDCMHRLQRALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQDIANRLLLKSAEGFSLFVKISDKVISVPEGDFFFDFVRHLTDWIKKARPSKDGIVPSLTYQVFFMKKLWTTTVPGKDSMADSIFHYYQELPKYLRGYHKCTREDVLQLAALIYRVKFEDDKSYFPNIPKMLKELVPQDLIRQLNPDEWKRSIIAYFNKHAGKTREESKVAFLKLIYKWPTFGSAFFEVKQTTEPHFPEILLIAINKHGVSLIDPKTKDILATHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTSMNK 2217          
BLAST of Dach-1 vs. Ensembl Xenopus
Match: MYO7A (myosin 7a [Source:NCBI gene;Acc:100491335])

HSP 1 Score: 2149.78 bits (5569), Expect = 0.000e+0
Identity = 1131/2234 (50.63%), Postives = 1527/2234 (68.35%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYT------YTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKM-------------------GFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDP-KGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRS-ASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            MV+ ++GD+VW++ K+  +    VP+GA +K     QI V+DD+G+E  + P   + I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYT      YTG ILVAVNPY +LPIYTP +I+ Y N KIG++ PHIFAIADN Y NM+R ++DQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++NPILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q +DERNYH+FYCML+G+  E + +  L  +  Y YL  G      G  D  ++  + SAMKVL FT+ E  EI +LLAA LH+GN+ ++A++  N+D+CEV   +    A+ LL++  ++L   LT++ IITR + V T +S+ Q +++RDA VKGIYGRLFVWIV+KIN AIYRP LS  PK+A          SIG+LDIFGFENF  NSFEQLCIN+ANENLQQFFVRH+FK+EQEEY  E I+WQHI FTDNQ+ LD+I +K  NI++LIDEES+FPKGTD ++LNKL      +  +I  K +    FGI HFAG+V+Y+  GFLEKNRD  + D+++L+ + K++F+K +F+ D  M                   G +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNE+KK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F+DRYR+L+PG+  +++  D R T + + +++L     +QIGKTK+FLKD  D+LLE  RDKA+++++ILIQK  R +  R+ FLK + AA+ IQ   R    RR +  M+ GF  LQA +R++    +    +  I   Q  CRG L R   + +  A+  IQ+  R   A + +K LK +  +  EA  L+  +E  FK +MS +KA +EAEK+H+ RL Q+  E   DA++++++  + +++   + + E+ RN+PV++S+M+D++FG +   +  S+P     AP  F DLE  R     +   + G      L    +ED+SE+ F KFAATYFQ      + R+PL++PLL+H +   Q++ALAVWI ILRFM DLPEP  + + ++ +  +P+MTKIY++LG++  K++ L+A +   + T    Y+  S+   R  +VSLTLKKKSK T+EV   L+D E+ L     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQI KQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF+NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ L+ KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDA+SQCEQ+AKE+G  E  A WRLFFRKEIFTPWH+  +D VAT+LIY Q++RG+KFGEYRCD ++D+ +L + Q  +D   +L  E L      Y+P   I  +K  +K+   ++    K +    R D   S+K+KE +V FAR KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ LELSFPEI AVSSSR          ++ GQS +++T+KG  YTF   N+EDIRDL+V FLEGL++RS Y + +Q    P   DS FLS +KGDL++L+ +D    I  S W +G N RTK  GDFP +IVY++P +  PS  ++AL +   D+          N +  + + K +TLEEFS  YFR P   + S  M    +    LW ++R+ +K  LLKK+L  +++ Q+A   F AIL YMGD PSK   S  E+ + IF+  LK E LKDE+YCQ++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     LA +C  RLQ+ L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD CQ+I +++ LK  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP KDG +    YQVFFMKKLWT TVPG D +AD +FHY QE+ KYL GYHK   +D + L ALI R   + D S   +  + L  L+P D++ +    E ++ ++A ++     +  ++K+AFLK+I++WPTFGSAFFEVKQ+T  + PE +LIAINK+GV LI  KTK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLT++ K
Sbjct:    1 MVILRQGDYVWLDLKTGREFD--VPVGAVVKLCDSGQIQVLDDEGNEHWISPQNASHIKPMHPTSIHGVEDMIRLGDLNEAGILRNLLIRYREHLIYTNCGGRTYTGSILVAVNPYQLLPIYTPDQIRLYTNRKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKKGAIEGAKIEQYLLEKSRVCRQAQDERNYHIFYCMLKGMSPEQKKKLSLGQASDYNYLCMGKCTTCDGRDDSKEYANIRSAMKVLMFTDTENWEISRLLAAILHMGNLRYEARMYDNLDACEVVYSTSLTTAATLLEVGPQELMNCLTSRTIITRGETVSTPLSMEQALDVRDAFVKGIYGRLFVWIVDKINAAIYRP-LSNEPKAARR--------SIGLLDIFGFENFTVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLENINWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDTTMLNKLNVQHKLNTFYIPPKNNYETQFGINHFAGIVYYETKGFLEKNRDTLHGDIIQLVHSAKNKFIKQIFQADVAMFLCGYPSTAFGLSSTPPIKGAETRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMMETIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQGDLRGTCERIAESVLGKDDDWQIGKTKIFLKDHHDMLLEIERDKAITDKVILIQKVVRGFKDRSNFLKIRKAALLIQRCWRGHNCRRNYTAMRIGFLRLQALYRSRKLHTQYHVARMRISYFQARCRGYLVRKAFRHRLWAVYTIQAHARGMIARRLYKRLKGEYHRRLEAEKLRLAEEERFKKEMSAKKAKQEAEKKHQERLAQLARE---DAEREVREKEEARRKKELLEKMEKARNEPVNDSDMVDKMFGFLG--TTSSLPGQEGQAPTGFEDLE--RPQGEMEEEDLDGALP---LPEEEEEDLSEYKFAKFAATYFQGTTTNTYIRRPLKQPLLYHEDEGDQLAALAVWITILRFMGDLPEPKYHTAMSNGSEKIPVMTKIYETLGKKTYKRE-LQALQGEGESTQIDGYKKNSV---RHKLVSLTLKKKSKITEEVTKRLHDGESTLQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTQNPSKSSHARGWILMSLCVGCFAPSEKFVKYLRNFISGGPPGYAPYCEERLRRTFANGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAKELCNSLADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHDPTEDNVATNLIYQQIVRGVKFGEYRCDKEEDLAELASQQYYVDYGSELIMERLLNLIPSYIPDREITPSKNVEKWAQFIIAAHKKGIYAQKRSD---SQKVKENVVDFARFKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEITAVSSSR--------GGKMQGQSFTMATIKGDEYTFTSNNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPVGEDSGFLSFQKGDLILLD-HDTGETIMNSGWAHGYNERTKHKGDFPTEIVYVMPTVTKPSGEVVALVTMTPDQKQDVVRAVQLNPSEQEEKMKPYTLEEFSYDYFRPPPKHTLSRVMITKNRGKDKLWSYTREPIKQALLKKVLMSDEMSQEACMAFIAILKYMGDYPSKRMRSVNELTDQIFEGALKGEPLKDEIYCQVLKQLTDNHIKYSEEKGWELLWLITGLFPPSNVLLPHIQRFIQSRKQHALATDCMHRLQRALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQDIANRLLLKSAEGFSLFVKISDKVISVPEGDFFFDFVRHLTDWIKKARPSKDGIVPSLTYQVFFMKKLWTTTVPGKDSMADSIFHYYQELPKYLRGYHKCTREDVLQLAALIYRVKFEDDKSYFPNIPKMLKELVPQDLIRQLNPDEWKRSIIAYFNKHAGKTREESKVAFLKLIYKWPTFGSAFFEVKQTTEPHFPEILLIAINKHGVSLIDPKTKDILATHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTSMNK 2194          
BLAST of Dach-1 vs. Ensembl Xenopus
Match: MYO7A (myosin 7a [Source:NCBI gene;Acc:100491335])

HSP 1 Score: 2149.78 bits (5569), Expect = 0.000e+0
Identity = 1129/2226 (50.72%), Postives = 1525/2226 (68.51%), Query Frame = 3
Query:  177 GDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDP-KGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSR-----------TMNFV----------SSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAIL--IYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRS-ASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            GD+VW++ K+  +    VP+GA +K     QI V+DD+G+E  + P   + I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYTYTG ILVAVNPY +LPIYTP +I+ Y N KIG++ PHIFAIADN Y NM+R ++DQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++NPILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q +DERNYH+FYCML+G+  E + +  L  +  Y YL  G      G  D  ++  + SAMKVL FT+ E  EI +LLAA LH+GN+ ++A++  N+D+CEV   +    A+ LL++  ++L   LT++ IITR + V T +S+ Q +++RDA VKGIYGRLFVWIV+KIN AIYRP LS  PK+A          SIG+LDIFGFENF  NSFEQLCIN+ANENLQQFFVRH+FK+EQEEY  E I+WQHI FTDNQ+ LD+I +K  NI++LIDEES+FPKGTD ++LNKL      +  +I  K +    FGI HFAG+V+Y+  GFLEKNRD  + D+++L+ + K++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNE+KK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F+DRYR+L+PG+  +++  D R T + + +++L     +QIGKTK+FLKD  D+LLE  RDKA+++++ILIQK  R +  R+ FLK + AA+ IQ   R    RR +  M+ GF  LQA +R++    +    +  I   Q  CRG L R   + +  A+  IQ+  R   A + +K LK +  +  EA  L+  +E  FK +MS +KA +EAEK+H+ RL Q+  E   DA++++++  + +++   + + E+ RN+PV++S+M+D++FG +   +  S+P     AP  F DLE  R     +   + G      L    +ED+SE+ F KFAATYFQ      + R+PL++PLL+H +   Q++ALAVWI ILRFM DLPEP  + + ++ +  +P+MTKIY++LG++  K++ L+A +   + T    Y+  S+   R  +VSLTLKKKSK T+EV   L+D E+ L     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQI KQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF+NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ L+ KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDA+SQCEQ+AKE+G  E  A WRLFFRKEIFTPWH+  +D VAT+LIY Q++RG+KFGEYRCD ++D+ +L + Q  +D   +L  E L      Y+P   I  +K  +K+   ++    K +    R D   S+K+KE +V FAR KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ LELSFPEI AVSSSR           T +++               ++ GQS +++T+KG  YTF   N+EDIRDL+V FLEGL++RS Y + +Q    P   DS FLS +KGDL++L+ +D    I  S W +G N RTK  GDFP +IVY++P +  PS  ++AL +   D+          N +  + + K +TLEEFS  YFR P   + S  M    +    LW ++R+ +K  LLKK+L  +++ Q+A   F  IL   YMGD PSK   S  E+ + IF+  LK E LKDE+YCQ++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     LA +C  RLQ+ L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD CQ+I +++ LK  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP KDG +    YQVFFMKKLWT TVPG D +AD +FHY QE+ KYL GYHK   +D + L ALI R   + D S   +  + L  L+P D++ +    E ++ ++A ++     +  ++K+AFLK+I++WPTFGSAFFEVKQ+T  + PE +LIAINK+GV LI  KTK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLT++ K
Sbjct:   14 GDYVWLDLKTGREFD--VPVGAVVKLCDSGQIQVLDDEGNEHWISPQNASHIKPMHPTSIHGVEDMIRLGDLNEAGILRNLLIRYREHLIYTYTGSILVAVNPYQLLPIYTPDQIRLYTNRKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKKGAIEGAKIEQYLLEKSRVCRQAQDERNYHIFYCMLKGMSPEQKKKLSLGQASDYNYLCMGKCTTCDGRDDSKEYANIRSAMKVLMFTDTENWEISRLLAAILHMGNLRYEARMYDNLDACEVVYSTSLTTAATLLEVGPQELMNCLTSRTIITRGETVSTPLSMEQALDVRDAFVKGIYGRLFVWIVDKINAAIYRP-LSNEPKAARR--------SIGLLDIFGFENFTVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLENINWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDTTMLNKLNVQHKLNTFYIPPKNNYETQFGINHFAGIVYYETKGFLEKNRDTLHGDIIQLVHSAKNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMMETIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQGDLRGTCERIAESVLGKDDDWQIGKTKIFLKDHHDMLLEIERDKAITDKVILIQKVVRGFKDRSNFLKIRKAALLIQRCWRGHNCRRNYTAMRIGFLRLQALYRSRKLHTQYHVARMRISYFQARCRGYLVRKAFRHRLWAVYTIQAHARGMIARRLYKRLKGEYHRRLEAEKLRLAEEERFKKEMSAKKAKQEAEKKHQERLAQLARE---DAEREVREKEEARRKKELLEKMEKARNEPVNDSDMVDKMFGFLG--TTSSLPGQEGQAPTGFEDLE--RPQGEMEEEDLDGALP---LPEEEEEDLSEYKFAKFAATYFQGTTTNTYIRRPLKQPLLYHEDEGDQLAALAVWITILRFMGDLPEPKYHTAMSNGSEKIPVMTKIYETLGKKTYKRE-LQALQGEGESTQIDGYKKNSV---RHKLVSLTLKKKSKITEEVTKRLHDGESTLQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTQNPSKSSHARGWILMSLCVGCFAPSEKFVKYLRNFISGGPPGYAPYCEERLRRTFANGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAKELCNSLADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHDPTEDNVATNLIYQQIVRGVKFGEYRCDKEEDLAELASQQYYVDYGSELIMERLLNLIPSYIPDREITPSKNVEKWAQFIIAAHKKGIYAQKRSD---SQKVKENVVDFARFKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEITAVSSSRKCLHWLNQSAGTHSYIYIFFFFLLSWDKRGGKMQGQSFTMATIKGDEYTFTSNNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPVGEDSGFLSFQKGDLILLD-HDTGETIMNSGWAHGYNERTKHKGDFPTEIVYVMPTVTKPSGEVVALVTMTPDQKQDVVRAVQLNPSEQEEKMKPYTLEEFSYDYFRPPPKHTLSRVMITKNRGKDKLWSYTREPIKQALLKKVLMSDEMSQEACMAFIDILSQSYMGDYPSKRMRSVNELTDQIFEGALKGEPLKDEIYCQVLKQLTDNHIKYSEEKGWELLWLITGLFPPSNVLLPHIQRFIQSRKQHALATDCMHRLQRALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQDIANRLLLKSAEGFSLFVKISDKVISVPEGDFFFDFVRHLTDWIKKARPSKDGIVPSLTYQVFFMKKLWTTTVPGKDSMADSIFHYYQELPKYLRGYHKCTREDVLQLAALIYRVKFEDDKSYFPNIPKMLKELVPQDLIRQLNPDEWKRSIIAYFNKHAGKTREESKVAFLKLIYKWPTFGSAFFEVKQTTEPHFPEILLIAINKHGVSLIDPKTKDILATHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTSMNK 2207          
BLAST of Dach-1 vs. Ensembl Mouse
Match: Myo7a (myosin VIIA [Source:MGI Symbol;Acc:MGI:104510])

HSP 1 Score: 2154.79 bits (5582), Expect = 0.000e+0
Identity = 1128/2211 (51.02%), Postives = 1510/2211 (68.29%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPK-GYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNAL-NDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAE-QMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSL-LALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            MV+ QKGD+VW++ KS  +    VPIGA +K     QI V+DD+ +E  + P   T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYTYTG ILVAVNPY +L IY+P+ I+ Y N KIG++ PHIFAIADN Y NM+R +RDQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++ PILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q  DERNYHVFYCMLEG+  E + + GL  +  Y YL  G  I   G  D  ++  + SAMKVL FT+ E  EI +LLAA LH+GN+ ++A+   N+D+CEV        A+ LL+++  DL   LT++ +ITR + V T +S  Q +++RDA VKGIYGRLFVWIVEKIN AIY+P   +V         NS+  SIG+LDIFGFENF  NSFEQLCIN+ANE+LQQFFVRH+FK+EQEEY  E IDW HI FTDNQE LD+I  +  N+++LIDEES+FPKGTD ++L+KL +    +  ++  K      FGI HFAGVV+Y+  GFLEKNRD  + D+++L+ +++++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNEFKK + FDR LC+RQLRYSGMMETIRIR AGYPIR+ F +F++RYR+L+PG+  +++  D R T + + + +L     +QIGKTK+FLKD  D+LLE  RDKA+++R+IL+QK  R +  R+ FL+ KSAA  IQ   R    R+ +  ++ GF  LQA  R++   K+ +  +  I   Q  CR  L R   + +  A+I +Q+  R   A +  + L+ +  +  EA  ++  +E   + +MS +KA EEAE++H+ RL Q+  E   DA+++LK+  + +++   + + E+ R++P++ S+M+D++FG +   +  S+P     AP  F DLE  R   +  DV +     +PD      +ED+SE+ F KFAATYFQ      ++R+PL++PLL+H +   Q++ALAVWI ILRFM DLPEP  + + +  +  +P+MTKIY++LG++  K+++     E E Q+  G    ++     R  +V LTLKKKSK T+EV   LND E+ +     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQI KQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ L+ KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDAISQCEQ+AKE+G  E  A WRLFFRKE+FTPWHN  +D VAT+LIY QV+RG+KFGEYRC+ +DD+ +L + Q  +D   ++  E L      Y+P   I   K  +K+    +    K +    R D   S+K+KE++V +AR KWP+LFSRFYEA KFSGP L  ++VI  +NWTG+Y VD  E++ LELSFPEI+AVSSSR         +++   S +L+T+KG  YTF  +N+EDIRDL+V FLEGL++RS Y + +Q    P   +S FLS  KGDL+IL+ +D    +  S W  G N RTK+ GDFP D VY++P +  P + I+AL +   D+               + R K +TLEEFS  YFR P   + S  M    +    LW H+R+ LK  LLKK+L  E+L Q+A   F A+L YMGD PSK   S  E+ + IF+  LK E LKDE Y Q++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     LA++C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD CQNI S++ LK  +GF+LFVK  DK IS+PE DFFFDF+R L+DW+KK RP+KDG +    YQVFFMKKLWT TVPG D +AD +FHY QE+ KYL GYHK   ++ + LGALI R   ++D S   S  + L  L+P D++ +    + ++ ++A ++     S  +AK+AFLK+IF+WPTFGSAFFEVKQ+T  N PE +LIAINK GV LI  +TK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLT ++K
Sbjct:    1 MVILQKGDYVWMDLKSGQEFD--VPIGAVVKLCDSGQIQVVDDEDNEHWISPQNATHIKPMHPTSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQYTNKKIGEMPPHIFAIADNCYFNMKRNNRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQAPDERNYHVFYCMLEGMNEEEKKKLGLGQAADYNYLAMGNCITCEGRVDSQEYANIRSAMKVLMFTDTENWEISKLLAAILHMGNLQYEARTFENLDACEVLFSPSLATAASLLEVNPPDLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVEKINAAIYKPPPLEV--------KNSR-RSIGLLDIFGFENFTVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLESIDWLHIEFTDNQEALDMIANRPMNVISLIDEESKFPKGTDATMLHKLNSQHKLNANYVPPKNSHETQFGINHFAGVVYYESQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSGMMETIRIRHAGYPIRYSFVEFVERYRVLLPGVKPAYKQGDLRGTCQRMAEAVLGTHDDWQIGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLRLKSAATLIQRHWRGHHCRKNYELIRLGFLRLQALHRSRKLHKQYRLARQRIIEFQARCRAYLVRKAFRHRLWAVITVQAYARGMIARRLHRRLRVEYQRRLEAERMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLARE---DAERELKEKEEARRKKELLEQMEKARHEPINHSDMVDKMFGFLG--TSGSLPGQEGQAPSGFEDLERGRREMVEEDVDAAL--PLPDE----DEEDLSEYKFAKFAATYFQGTTTHSYTRRPLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRELQALQGEGETQLPEGQKKTSV-----RHKLVHLTLKKKSKLTEEVTKRLNDGESTVQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTARELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHNPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYFVDYGSEMILERLLSLVPTYIPDREITPLKNLEKWAQLAIAAHKKGIYAQRRTD---SQKVKEDVVNYARFKWPLLFSRFYEAYKFSGPPLPKSDVIVAVNWTGVYFVDEQEQVLLELSFPEIMAVSSSR--------GTKMMAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEESGFLSFAKGDLIILD-HDTGEQVMNSGWANGINERTKQRGDFPTDCVYVMPTVTLPPREIVALVTMTPDQRQDVVRLLQLRTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGKDRLWSHTREPLKQALLKKILGSEELSQEACMAFVAVLKYMGDYPSKRMRSVNELTDQIFEWALKAEPLKDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQNIASRLLLKSSEGFSLFVKIADKVISVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPRTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSK 2169          
BLAST of Dach-1 vs. Ensembl Mouse
Match: Myo7a (myosin VIIA [Source:MGI Symbol;Acc:MGI:104510])

HSP 1 Score: 2145.55 bits (5558), Expect = 0.000e+0
Identity = 1129/2241 (50.38%), Postives = 1512/2241 (67.47%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKG-YQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALN-DVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAE-QMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFV------------------------------SSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSL-LALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            MV+ QKGD+VW++ KS  +    VPIGA +K     QI V+DD+ +E  + P   T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYTYTG ILVAVNPY +L IY+P+ I+ Y N KIG++ PHIFAIADN Y NM+R +RDQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++ PILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q  DERNYHVFYCMLEG+  E + + GL  +  Y YL  G  I   G  D  ++  + SAMKVL FT+ E  EI +LLAA LH+GN+ ++A+   N+D+CEV        A+ LL+++  DL   LT++ +ITR + V T +S  Q +++RDA VKGIYGRLFVWIVEKIN AIY+P   +V         NS+  SIG+LDIFGFENF  NSFEQLCIN+ANE+LQQFFVRH+FK+EQEEY  E IDW HI FTDNQE LD+I  +  N+++LIDEES+FPKGTD ++L+KL +    +  ++  K      FGI HFAGVV+Y+  GFLEKNRD  + D+++L+ +++++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNEFKK + FDR LC+RQLRYSGMMETIRIR AGYPIR+ F +F++RYR+L+PG+  +++  D R T + + + +L     +QIGKTK+FLKD  D+LLE  RDKA+++R+IL+QK  R +  R+ FL+ KSAA  IQ   R    R+ +  ++ GF  LQA  R++   K+ +  +  I   Q  CR  L R   + +  A+I +Q+  R   A +  + L+ +  +  EA  ++  +E   + +MS +KA EEAE++H+ RL Q+  E   DA+++LK+  + +++   + + E+ R++P++ S+M+D++FG +   +  S+P     AP  F DLE  R   +  DV +     +PD      +ED+SE+ F KFAATYFQ      ++R+PL++PLL+H +   Q++ALAVWI ILRFM DLPEP  + + +  +  +P+MTKIY++LG++  K+++     E E Q+  G    ++     R  +V LTLKKKSK T+EV   LND E+ +     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQI KQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ L+ KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDAISQCEQ+AKE+G  E  A WRLFFRKE+FTPWHN  +D VAT+LIY QV+RG+KFGEYRC+ +DD+ +L + Q  +D   ++  E L      Y+P   I   K  +K+    +    K +    R DS   +K+KE++V +AR KWP+LFSRFYEA KFSGP L  ++VI  +NWTG+Y VD  E++ LELSFPEI+AVSSSR    +                              S   +++   S +L+T+KG  YTF  +N+EDIRDL+V FLEGL++RS Y + +Q    P   +S FLS  KGDL+IL+ +D    +  S W  G N RTK+ GDFP D VY++P +  P + I+AL +   D+               + R K +TLEEFS  YFR P   + S  M    +    LW H+R+ LK  LLKK+L  E+L Q+A   F A+L YMGD PSK   S  E+ + IF+  LK E LKDE Y Q++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     LA++C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD CQNI S++ LK  +GF+LFVK  DK IS+PE DFFFDF+R L+DW+KK RP+KDG +    YQVFFMKKLWT TVPG D +AD +FHY QE+ KYL GYHK   ++ + LGALI R   ++D S   S  + L  L+P D++ +    + ++ ++A ++     S  +AK+AFLK+IF+WPTFGSAFFEVKQ+T  N PE +LIAINK GV LI  +TK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLT ++K
Sbjct:    1 MVILQKGDYVWMDLKSGQEFD--VPIGAVVKLCDSGQIQVVDDEDNEHWISPQNATHIKPMHPTSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQYTNKKIGEMPPHIFAIADNCYFNMKRNNRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQAPDERNYHVFYCMLEGMNEEEKKKLGLGQAADYNYLAMGNCITCEGRVDSQEYANIRSAMKVLMFTDTENWEISKLLAAILHMGNLQYEARTFENLDACEVLFSPSLATAASLLEVNPPDLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVEKINAAIYKPPPLEV--------KNSR-RSIGLLDIFGFENFTVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLESIDWLHIEFTDNQEALDMIANRPMNVISLIDEESKFPKGTDATMLHKLNSQHKLNANYVPPKNSHETQFGINHFAGVVYYESQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSGMMETIRIRHAGYPIRYSFVEFVERYRVLLPGVKPAYKQGDLRGTCQRMAEAVLGTHDDWQIGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLRLKSAATLIQRHWRGHHCRKNYELIRLGFLRLQALHRSRKLHKQYRLARQRIIEFQARCRAYLVRKAFRHRLWAVITVQAYARGMIARRLHRRLRVEYQRRLEAERMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLARE---DAERELKEKEEARRKKELLEQMEKARHEPINHSDMVDKMFGFLG--TSGSLPGQEGQAPSGFEDLERGRREMVEEDVDAAL--PLPDED----EEDLSEYKFAKFAATYFQGTTTHSYTRRPLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRELQALQGEGETQLPEGQKKTSV-----RHKLVHLTLKKKSKLTEEVTKRLNDGESTVQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTARELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHNPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYFVDYGSEMILERLLSLVPTYIPDREITPLKNLEKWAQLAIAAHKKGIYAQRRTDS---QKVKEDVVNYARFKWPLLFSRFYEAYKFSGPPLPKSDVIVAVNWTGVYFVDEQEQVLLELSFPEIMAVSSSRECRVLLSLGCSDLGCATCQSGRAGLTPAGPCSPCWSCRGTKMMAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEESGFLSFAKGDLIILD-HDTGEQVMNSGWANGINERTKQRGDFPTDCVYVMPTVTLPPREIVALVTMTPDQRQDVVRLLQLRTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGKDRLWSHTREPLKQALLKKILGSEELSQEACMAFVAVLKYMGDYPSKRMRSVNELTDQIFEWALKAEPLKDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQNIASRLLLKSSEGFSLFVKIADKVISVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPRTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSK 2207          
BLAST of Dach-1 vs. Ensembl Mouse
Match: Myo7a (myosin VIIA [Source:MGI Symbol;Acc:MGI:104510])

HSP 1 Score: 2139.77 bits (5543), Expect = 0.000e+0
Identity = 1118/2188 (51.10%), Postives = 1495/2188 (68.33%), Query Frame = 3
Query:  228 VPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPK-GYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNAL-NDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAE-QMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSL-LALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            VPIGA +K     QI V+DD+ +E  + P   T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYTYTG ILVAVNPY +L IY+P+ I+ Y N KIG++ PHIFAIADN Y NM+R +RDQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++ PILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q  DERNYHVFYCMLEG+  E + + GL  +  Y YL  G  I   G  D  ++  + SAMKVL FT+ E  EI +LLAA LH+GN+ ++A+   N+D+CEV        A+ LL+++  DL   LT++ +ITR + V T +S  Q +++RDA VKGIYGRLFVWIVEKIN AIY+P   +V         NS+  SIG+LDIFGFENF  NSFEQLCIN+ANE+LQQFFVRH+FK+EQEEY  E IDW HI FTDNQE LD+I  +  N+++LIDEES+FPKGTD ++L+KL +    +  ++  K      FGI HFAGVV+Y+  GFLEKNRD  + D+++L+ +++++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNEFKK + FDR LC+RQLRYSGMMETIRIR AGYPIR+ F +F++RYR+L+PG+  +++  D R T + + + +L     +QIGKTK+FLKD  D+LLE  RDKA+++R+IL+QK  R +  R+ FL+ KSAA  IQ   R    R+ +  ++ GF  LQA  R++   K+ +  +  I   Q  CR  L R   + +  A+I +Q+  R   A +  + L+ +  +  EA  ++  +E   + +MS +KA EEAE++H+ RL Q+  E   DA+++LK+  + +++   + + E+ R++P++ S+M+D++FG +   +  S+P     AP  F DLE  R   +  DV +     +PD      +ED+SE+ F KFAATYFQ      ++R+PL++PLL+H +   Q++ALAVWI ILRFM DLPEP  + + +  +  +P+MTKIY++LG++  K+++     E E Q+  G    ++     R  +V LTLKKKSK T+EV   LND E+ +     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQI KQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ L+ KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDAISQCEQ+AKE+G  E  A WRLFFRKE+FTPWHN  +D VAT+LIY QV+RG+KFGEYRC+ +DD+ +L + Q  +D   ++  E L      Y+P   I   K  +K+    +    K +    R D   S+K+KE++V +AR KWP+LFSRFYEA KFSGP L  ++VI  +NWTG+Y VD  E++ LELSFPEI+AVSSSR         +++   S +L+T+KG  YTF  +N+EDIRDL+V FLEGL++RS Y + +Q    P   +S FLS  KGDL+IL+ +D    +  S W  G N RTK+ GDFP D VY++P +  P + I+AL +   D+               + R K +TLEEFS  YFR P   + S  M    +    LW H+R+ LK  LLKK+L  E+L Q+A   F A+L YMGD PSK   S  E+ + IF+  LK E LKDE Y Q++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     LA++C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD CQNI S++ LK  +GF+LFVK  DK IS+PE DFFFDF+R L+DW+KK RP+KDG +    YQVFFMKKLWT TVPG D +AD +FHY QE+ KYL GYHK   ++ + LGALI R   ++D S   S  + L  L+P D++ +    + ++ ++A ++     S  +AK+AFLK+IF+WPTFGSAFFEVKQ+T  N PE +LIAINK GV LI  +TK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLT ++K
Sbjct:   11 VPIGAVVKLCDSGQIQVVDDEDNEHWISPQNATHIKPMHPTSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQYTNKKIGEMPPHIFAIADNCYFNMKRNNRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQAPDERNYHVFYCMLEGMNEEEKKKLGLGQAADYNYLAMGNCITCEGRVDSQEYANIRSAMKVLMFTDTENWEISKLLAAILHMGNLQYEARTFENLDACEVLFSPSLATAASLLEVNPPDLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVEKINAAIYKPPPLEV--------KNSR-RSIGLLDIFGFENFTVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLESIDWLHIEFTDNQEALDMIANRPMNVISLIDEESKFPKGTDATMLHKLNSQHKLNANYVPPKNSHETQFGINHFAGVVYYESQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSGMMETIRIRHAGYPIRYSFVEFVERYRVLLPGVKPAYKQGDLRGTCQRMAEAVLGTHDDWQIGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLRLKSAATLIQRHWRGHHCRKNYELIRLGFLRLQALHRSRKLHKQYRLARQRIIEFQARCRAYLVRKAFRHRLWAVITVQAYARGMIARRLHRRLRVEYQRRLEAERMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLARE---DAERELKEKEEARRKKELLEQMEKARHEPINHSDMVDKMFGFLG--TSGSLPGQEGQAPSGFEDLERGRREMVEEDVDAAL--PLPDE----DEEDLSEYKFAKFAATYFQGTTTHSYTRRPLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRELQALQGEGETQLPEGQKKTSV-----RHKLVHLTLKKKSKLTEEVTKRLNDGESTVQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTARELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHNPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYFVDYGSEMILERLLSLVPTYIPDREITPLKNLEKWAQLAIAAHKKGIYAQRRTD---SQKVKEDVVNYARFKWPLLFSRFYEAYKFSGPPLPKSDVIVAVNWTGVYFVDEQEQVLLELSFPEIMAVSSSR--------GTKMMAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEESGFLSFAKGDLIILD-HDTGEQVMNSGWANGINERTKQRGDFPTDCVYVMPTVTLPPREIVALVTMTPDQRQDVVRLLQLRTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGKDRLWSHTREPLKQALLKKILGSEELSQEACMAFVAVLKYMGDYPSKRMRSVNELTDQIFEWALKAEPLKDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQNIASRLLLKSSEGFSLFVKIADKVISVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPRTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSK 2158          
BLAST of Dach-1 vs. Ensembl Mouse
Match: Myo7a (myosin VIIA [Source:MGI Symbol;Acc:MGI:104510])

HSP 1 Score: 2133.99 bits (5528), Expect = 0.000e+0
Identity = 1118/2194 (50.96%), Postives = 1495/2194 (68.14%), Query Frame = 3
Query:  228 VPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYT------YTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPK-GYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNAL-NDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAE-QMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSL-LALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            VPIGA +K     QI V+DD+ +E  + P   T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYT      YTG ILVAVNPY +L IY+P+ I+ Y N KIG++ PHIFAIADN Y NM+R +RDQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++ PILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q  DERNYHVFYCMLEG+  E + + GL  +  Y YL  G  I   G  D  ++  + SAMKVL FT+ E  EI +LLAA LH+GN+ ++A+   N+D+CEV        A+ LL+++  DL   LT++ +ITR + V T +S  Q +++RDA VKGIYGRLFVWIVEKIN AIY+P   +V         NS+  SIG+LDIFGFENF  NSFEQLCIN+ANE+LQQFFVRH+FK+EQEEY  E IDW HI FTDNQE LD+I  +  N+++LIDEES+FPKGTD ++L+KL +    +  ++  K      FGI HFAGVV+Y+  GFLEKNRD  + D+++L+ +++++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNEFKK + FDR LC+RQLRYSGMMETIRIR AGYPIR+ F +F++RYR+L+PG+  +++  D R T + + + +L     +QIGKTK+FLKD  D+LLE  RDKA+++R+IL+QK  R +  R+ FL+ KSAA  IQ   R    R+ +  ++ GF  LQA  R++   K+ +  +  I   Q  CR  L R   + +  A+I +Q+  R   A +  + L+ +  +  EA  ++  +E   + +MS +KA EEAE++H+ RL Q+  E   DA+++LK+  + +++   + + E+ R++P++ S+M+D++FG +   +  S+P     AP  F DLE  R   +  DV +     +PD      +ED+SE+ F KFAATYFQ      ++R+PL++PLL+H +   Q++ALAVWI ILRFM DLPEP  + + +  +  +P+MTKIY++LG++  K+++     E E Q+  G    ++     R  +V LTLKKKSK T+EV   LND E+ +     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQI KQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ L+ KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDAISQCEQ+AKE+G  E  A WRLFFRKE+FTPWHN  +D VAT+LIY QV+RG+KFGEYRC+ +DD+ +L + Q  +D   ++  E L      Y+P   I   K  +K+    +    K +    R D   S+K+KE++V +AR KWP+LFSRFYEA KFSGP L  ++VI  +NWTG+Y VD  E++ LELSFPEI+AVSSSR         +++   S +L+T+KG  YTF  +N+EDIRDL+V FLEGL++RS Y + +Q    P   +S FLS  KGDL+IL+ +D    +  S W  G N RTK+ GDFP D VY++P +  P + I+AL +   D+               + R K +TLEEFS  YFR P   + S  M    +    LW H+R+ LK  LLKK+L  E+L Q+A   F A+L YMGD PSK   S  E+ + IF+  LK E LKDE Y Q++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     LA++C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD CQNI S++ LK  +GF+LFVK  DK IS+PE DFFFDF+R L+DW+KK RP+KDG +    YQVFFMKKLWT TVPG D +AD +FHY QE+ KYL GYHK   ++ + LGALI R   ++D S   S  + L  L+P D++ +    + ++ ++A ++     S  +AK+AFLK+IF+WPTFGSAFFEVKQ+T  N PE +LIAINK GV LI  +TK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLT ++K
Sbjct:   11 VPIGAVVKLCDSGQIQVVDDEDNEHWISPQNATHIKPMHPTSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTSCGGRTYTGSILVAVNPYQLLSIYSPEHIRQYTNKKIGEMPPHIFAIADNCYFNMKRNNRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQAPDERNYHVFYCMLEGMNEEEKKKLGLGQAADYNYLAMGNCITCEGRVDSQEYANIRSAMKVLMFTDTENWEISKLLAAILHMGNLQYEARTFENLDACEVLFSPSLATAASLLEVNPPDLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVEKINAAIYKPPPLEV--------KNSR-RSIGLLDIFGFENFTVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLESIDWLHIEFTDNQEALDMIANRPMNVISLIDEESKFPKGTDATMLHKLNSQHKLNANYVPPKNSHETQFGINHFAGVVYYESQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSGMMETIRIRHAGYPIRYSFVEFVERYRVLLPGVKPAYKQGDLRGTCQRMAEAVLGTHDDWQIGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLRLKSAATLIQRHWRGHHCRKNYELIRLGFLRLQALHRSRKLHKQYRLARQRIIEFQARCRAYLVRKAFRHRLWAVITVQAYARGMIARRLHRRLRVEYQRRLEAERMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLARE---DAERELKEKEEARRKKELLEQMEKARHEPINHSDMVDKMFGFLG--TSGSLPGQEGQAPSGFEDLERGRREMVEEDVDAAL--PLPDE----DEEDLSEYKFAKFAATYFQGTTTHSYTRRPLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRELQALQGEGETQLPEGQKKTSV-----RHKLVHLTLKKKSKLTEEVTKRLNDGESTVQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTARELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHNPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYFVDYGSEMILERLLSLVPTYIPDREITPLKNLEKWAQLAIAAHKKGIYAQRRTD---SQKVKEDVVNYARFKWPLLFSRFYEAYKFSGPPLPKSDVIVAVNWTGVYFVDEQEQVLLELSFPEIMAVSSSR--------GTKMMAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEESGFLSFAKGDLIILD-HDTGEQVMNSGWANGINERTKQRGDFPTDCVYVMPTVTLPPREIVALVTMTPDQRQDVVRLLQLRTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGKDRLWSHTREPLKQALLKKILGSEELSQEACMAFVAVLKYMGDYPSKRMRSVNELTDQIFEWALKAEPLKDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQNIASRLLLKSSEGFSLFVKIADKVISVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPRTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSK 2164          
BLAST of Dach-1 vs. Ensembl Mouse
Match: Myo7a (myosin VIIA [Source:MGI Symbol;Acc:MGI:104510])

HSP 1 Score: 2131.68 bits (5522), Expect = 0.000e+0
Identity = 1116/2188 (51.01%), Postives = 1493/2188 (68.24%), Query Frame = 3
Query:  228 VPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPK-GYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNAL-NDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAE-QMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSL-LALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            VPIGA +K     QI V+DD+ +E  + P   T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYTYTG ILVAVNPY +L IY+P+ I+ Y N KIG++ PHIFAIADN Y NM+R +RDQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++ PILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q  DERNYHVFYCMLEG+  E + + GL  +  Y YL  G  I   G  D  ++  + SAMKVL FT+ E  EI +LLAA LH+GN+ ++A+   N+D+CEV        A+ LL+++  DL   LT++ +ITR + V T +S  Q +++RDA VKGIYGRLFVWIVEKIN AIY+P   +V         NS+  SIG+LDIFGFENF  NSFEQLCIN+ANE+LQQFFVRH+FK+EQEEY  E IDW HI FTDNQE LD+I  +  N+++LIDEES+FPKGTD ++L+KL +    +  ++  K      FGI HFAGVV+Y+  GFLEKNRD  + D+++L+ +++++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNEFKK + FDR LC+RQLRYSGMMETIRIR AGYPIR+ F +F++RYR+L+PG+  +++  D R T + + + +L     +QIGKTK+FLKD  D+LLE  RDKA+++R+IL+QK  R +  R+ FL+ KSAA  IQ   R    R+ +  ++ GF  LQA  R++   K+ +  +  I   Q  CR  L R   + +  A+I +Q+  R   A +  + L+ +  +  EA  ++  +E   + +MS +KA EEAE++H+ RL Q+  E   DA+++LK+  + +++   + + E+ R++P++ S+M+D++FG +   +  S+P     AP  F DLE  R   +  DV +     +PD      +ED+SE+ F KFAATYFQ      ++R+PL++PLL+H +   Q++ALAVWI ILRFM DLPEP  + + +  +  +P+MTKIY++LG++  K+++     E E Q+  G    ++     R  +V LTLKKKSK T+EV   LND E+ +     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQI KQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ L+ KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDAISQCEQ+AKE+G  E  A WRLFFRKE+FTPWHN  +D VAT+LIY QV+RG+KFGEYRC+ +DD+ +L + Q  +D   ++  E L      Y+P   I   K  +K+    +    K +    R D   S+K+KE++V +AR KWP+LFSRFYEA KFSGP L  ++VI  +NWTG+Y VD  E++ LELSFPEI+AVSSSR         +++   S +L+T+KG  YTF  +N+EDIRDL+V FLEGL++RS Y + +Q    P   +S FLS  KGDL+IL+ +D    +  S W  G N RTK+ GDFP D VY++P +  P + I+AL +   D+               + R K +TLEEFS  YFR P   + S  M    +    LW H+R+ LK  LLKK+L  E+L Q+A   F A+L YMGD PSK   S  E+ + IF+  LK E LKDE Y Q++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     LA++C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD CQNI S++ LK  +GF+LFVK  DK IS+PE DFFFDF+R L+DW+KK RP+KDG +    YQVFFMKKLWT TVPG D +AD +FHY QE+ KYL GYHK   ++ + LGALI R   ++D S   S  + L  L+P D++ +    + ++ ++A ++     S  +AK+AFLK+IF+WPTFGSAFFE  Q+T  N PE +LIAINK GV LI  +TK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLT ++K
Sbjct:   11 VPIGAVVKLCDSGQIQVVDDEDNEHWISPQNATHIKPMHPTSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQYTNKKIGEMPPHIFAIADNCYFNMKRNNRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQAPDERNYHVFYCMLEGMNEEEKKKLGLGQAADYNYLAMGNCITCEGRVDSQEYANIRSAMKVLMFTDTENWEISKLLAAILHMGNLQYEARTFENLDACEVLFSPSLATAASLLEVNPPDLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVEKINAAIYKPPPLEV--------KNSR-RSIGLLDIFGFENFTVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLESIDWLHIEFTDNQEALDMIANRPMNVISLIDEESKFPKGTDATMLHKLNSQHKLNANYVPPKNSHETQFGINHFAGVVYYESQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSGMMETIRIRHAGYPIRYSFVEFVERYRVLLPGVKPAYKQGDLRGTCQRMAEAVLGTHDDWQIGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLRLKSAATLIQRHWRGHHCRKNYELIRLGFLRLQALHRSRKLHKQYRLARQRIIEFQARCRAYLVRKAFRHRLWAVITVQAYARGMIARRLHRRLRVEYQRRLEAERMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLARE---DAERELKEKEEARRKKELLEQMEKARHEPINHSDMVDKMFGFLG--TSGSLPGQEGQAPSGFEDLERGRREMVEEDVDAAL--PLPDE----DEEDLSEYKFAKFAATYFQGTTTHSYTRRPLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRELQALQGEGETQLPEGQKKTSV-----RHKLVHLTLKKKSKLTEEVTKRLNDGESTVQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTARELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHNPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYFVDYGSEMILERLLSLVPTYIPDREITPLKNLEKWAQLAIAAHKKGIYAQRRTD---SQKVKEDVVNYARFKWPLLFSRFYEAYKFSGPPLPKSDVIVAVNWTGVYFVDEQEQVLLELSFPEIMAVSSSR--------GTKMMAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEESGFLSFAKGDLIILD-HDTGEQVMNSGWANGINERTKQRGDFPTDCVYVMPTVTLPPREIVALVTMTPDQRQDVVRLLQLRTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGKDRLWSHTREPLKQALLKKILGSEELSQEACMAFVAVLKYMGDYPSKRMRSVNELTDQIFEWALKAEPLKDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQNIASRLLLKSSEGFSLFVKIADKVISVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTFGSAFFE--QTTEPNFPEILLIAINKYGVSLIDPRTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSK 2156          
BLAST of Dach-1 vs. UniProt/SwissProt
Match: sp|Q17LW0|MYO7A_AEDAE (Myosin-VIIa OS=Aedes aegypti OX=7159 GN=ck PE=3 SV=1)

HSP 1 Score: 2155.18 bits (5583), Expect = 0.000e+0
Identity = 1131/2208 (51.22%), Postives = 1507/2208 (68.25%), Query Frame = 3
Query:  177 GDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAP--------RAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENL---SMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTI--IGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP--DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS--DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSL--GKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYS-STEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDG-QLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSS 6734
            GD++WIE  S  +    V IGA++      +I V DDDG+E  L P  +I+ MH SS+QGV+DMISLGDL+EAGILRNLLIRY  N IYTYTG ILVAVNPY +LPIYT  +IK YK  KIG+L PHIFAI DN+Y NMRR  +DQ I+ISGESGAGKTESTKLILQ+LAA+SG+HSWIEQQ+L++NPILEAFGNAKT+RNDNSSRFGKYIDI+F  +G IEGA+I+Q+LLEKSRIVSQ  +ERNYH+FYC+L GL  + + +  L  +  Y YL  GG I   G  D  +F  + SAMKVL F++ E  EI +LLAA LH GNI ++A +  N+D+ E+         + LL++  +    ALT K +    + VV+ +S  Q +++RDA VKGIYGRLFV IV+KIN+AIY+P            KS+++ ++IGVLDIFGFENF +NSFEQ CIN+ANENLQQFFVRHIFK+EQEEY  E I+WQHI F DNQ+ LDLI +K  NI+ALIDEES+FPKGTD ++L KL  T   H  ++K K+DI   FG+ HFAGVV Y   GFLEKNRD F+ADL++LI ++ ++FL+++F +D  MG +TRKR PTL  QF+KSLDSLMK L   +PFF+RCIKPNE KK + FDR+LC RQLRYSGMMETIRIR+AGYPIRH+F DF++RYR L+ GIP + R  D R  T  +C ++L    YQ+G TK+FLKDA D+ LE  RD+ L+ +I+++Q++ R + +R +FL+ + AA+ IQ F +    R+++ KMK G+  LQA  R++V S + + L+G I  +Q   RG L R     K  A+IKIQS +R+  A+ +++ LK +  +  EAL L++ +E   K+Q ++       +     RLN+I  + +    ++ +     K  I +A R+ ++PVD+S++++ +F  +        P+S S AP          F DL +++ N  + +G       P + ++  +ED+SEF F KFAATYFQ +   ++SRKPL+ PLL       Q++A A+WI ILRF  DLPEP   +  T   ++  +M+K+  +LGR F +    K  +EA+ M  G+  E       R+ R  +VSLTLK+K+K  ++V   L D E      +  S LE RPTSNLEKLHFIIG+GIL  ELRDEIYCQICKQL +NP   S +RG ILL+LC+GCFAP+EKFV  LR+FI+      A +   RL+RTF+NGTRNQPPSWLEL+A K K+PI+L +  M+GNT+T+ ADSA+TA+ELC+ LS KI LKDQFGFSL+IA+ DKVSS+GSGGDHVMDAISQCEQ+AKE+G  E  A WRLFFRKEIF PWHN  +D VAT+LIY QV+RG+KFGEYRCD ++D+  + A Q  I+   D+S + L+  LP  I    +T  +K                   KD  ++ K+KE++V++A+ KWP+LFSRFYEA + SGP+L  N+VI  +NWTG+Y+VD  E++ LELSFPEI AVSS +        T+++  Q+ SLSTV+   +TF   N+EDIRDL+V+FLEGLK+RS + I +Q +  P   +SFLS  KGDL+ILE       +  S W  G   RT+E GDFPA+IVY+LP +  P  +ILALFS  D   G       +N   ++R   HTL ++S  +FR P   + S  +S    K+    LW++SR+ LK PLLKKLL KE+L ++A   F AI+ YMGD PSK      EI + IFD  LKHEIL+DE+YCQL+ Q+T N N  SE+ GWEL+WL+TG+   +  L +EL    R+    ++ +   RLQKT++ GQR+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+T+ KD CQNI  ++ L+  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP +DG   +F YQVFFMKKLWTNTVPG D+ AD++FHY QE+ K L GYHK   ++A+ L AL+ R    +   +LQ+  + L  L+P D++      + ++ ++A Y+    MS  DAK+ FLKI+++WPTFGSAFFEVKQ+T  N PE +LIAINK+GV LIH  +K+ L  +P++ ISNWSSGNTYF+MTIGNL+ G KLLCET LGYKMDDLLTSYISLMLT + K  +
Sbjct:    2 GDYIWIEPVSGREFD--VAIGARVISAEGRRIQVRDDDGNELWLTPERRIKAMHASSVQGVEDMISLGDLHEAGILRNLLIRYNDNLIYTYTGSILVAVNPYQILPIYTADQIKLYKERKIGELPPHIFAIGDNSYANMRRYGQDQCIVISGESGAGKTESTKLILQYLAAISGKHSWIEQQILEANPILEAFGNAKTVRNDNSSRFGKYIDIHFNNSGVIEGAEIEQYLLEKSRIVSQNAEERNYHIFYCLLAGLSSDEKRKLNLGYASDYRYLTGGGCIKCDGRNDAAEFADIRSAMKVLCFSDHEIWEILKLLAALLHTGNITYRATVIDNLDATEIPEHINVERVANLLEVPFQPFIDALTRKTLFAHGETVVSTLSRDQSMDVRDAFVKGIYGRLFVLIVKKINSAIYKP------------KSSTR-SAIGVLDIFGFENFKHNSFEQFCINFANENLQQFFVRHIFKLEQEEYNHESINWQHIEFVDNQDALDLIAIKQLNIMALIDEESKFPKGTDQTMLAKLHKTHGTHRNYLKPKSDINTSFGLNHFAGVVFYDTRGFLEKNRDTFSADLLQLISSSTNRFLQMVFAEDIGMGAETRKRTPTLSTQFKKSLDSLMKTLSSCQPFFIRCIKPNELKKPMMFDRALCCRQLRYSGMMETIRIRRAGYPIRHKFKDFVERYRFLISGIPPAHRT-DCRLATSKICASVLGRSDYQLGHTKVFLKDAHDLFLEQERDRVLTRKILILQRSIRGWVYRRRFLRMRQAAVTIQKFWKGYAQRQRYKKMKIGYMRLQALIRSRVLSHRFRHLRGHIVRLQARIRGYLVRREYGLKMWAVIKIQSHVRRMIAMNRYQKLKLEYRRHHEALRLRRMEEEELKHQGNKRAKEIAEQHYRD-RLNEIERKEIEQELEERRRVEVKKNIINDAARKADEPVDDSKLVEAMFDFL--------PDSSSEAPTPHGGRETSVFNDLPVNQDNHEDIIG-------PIHTISEDEEDLSEFKFQKFAATYFQGNITHFYSRKPLKHPLLPLHTQGDQLAAQALWITILRFTGDLPEP---RYHTMDRDNTSVMSKVTATLGRNFIRS---KEFQEAQMM--GLDPEAFLKQKPRSIRHKLVSLTLKRKNKLGEDVRRRLQDEE--YTADSYQSWLESRPTSNLEKLHFIIGHGILRAELRDEIYCQICKQLTNNPSKSSHARGWILLSLCVGCFAPSEKFVNYLRSFIREGPPGYAPYCEERLKRTFNNGTRNQPPSWLELQATKSKKPIMLPITFMDGNTKTLLADSATTARELCNQLSDKIALKDQFGFSLYIALFDKVSSLGSGGDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIFAPWHNPIEDQVATNLIYQQVVRGVKFGEYRCDKEEDLAMIAAQQYYIEYNTDMSMDRLYTLLPNFIPDYCLTGIEKAIDRWAALVLQAYKKSYYLKDKAAALKVKEDVVSYAKYKWPLLFSRFYEAYRNSGPNLPKNDVIIAVNWTGVYVVDDQEQVLLELSFPEITAVSSQK--------TNKVFTQTFSLSTVRNEEFTFQSPNAEDIRDLVVYFLEGLKKRSKFVIALQDYKAPGEGTSFLSFLKGDLIILEDESTGESVLNSGWCIGCCERTQERGDFPAEIVYVLPSLTKPPPDILALFSVEDAHHGKRLNSIHSNGGTETREHPHTLADYSLDHFRPPPKRTMSKALSTLSSKRGGDELWRYSREPLKQPLLKKLLAKEELAEEACLAFIAIMKYMGDLPSKRPRIGNEITDHIFDGPLKHEILRDEIYCQLMKQLTDNRNRMSEERGWELMWLSTGLFACSQQLLKELTVFLRTRRHPISQDSLHRLQKTIRNGQRKYPPHQVEVEAIQHKTTQIFHKVYFPDDTDEAFEVDSSTRAKDFCQNISQRLNLRSSEGFSLFVKIADKVISVPEGDFFFDFVRHLTDWIKKARPTRDGTNPQFTYQVFFMKKLWTNTVPGKDKNADLIFHYHQELPKLLRGYHKCSKEEAVKLAALVYRVRFGESKQELQAIPQMLRELVPSDLIKLQTTNDWKRSIVAAYNQDAGMSPEDAKVTFLKIVYRWPTFGSAFFEVKQTTEPNYPEMLLIAINKHGVSLIHPSSKDILVTHPFTRISNWSSGNTYFHMTIGNLVRGSKLLCETSLGYKMDDLLTSYISLMLTNMNKQRT 2159          
BLAST of Dach-1 vs. UniProt/SwissProt
Match: sp|P97479|MYO7A_MOUSE (Unconventional myosin-VIIa OS=Mus musculus OX=10090 GN=Myo7a PE=1 SV=2)

HSP 1 Score: 2145.55 bits (5558), Expect = 0.000e+0
Identity = 1129/2241 (50.38%), Postives = 1512/2241 (67.47%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKG-YQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALN-DVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAE-QMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFV------------------------------SSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSL-LALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            MV+ QKGD+VW++ KS  +    VPIGA +K     QI V+DD+ +E  + P   T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYTYTG ILVAVNPY +L IY+P+ I+ Y N KIG++ PHIFAIADN Y NM+R +RDQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++ PILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q  DERNYHVFYCMLEG+  E + + GL  +  Y YL  G  I   G  D  ++  + SAMKVL FT+ E  EI +LLAA LH+GN+ ++A+   N+D+CEV        A+ LL+++  DL   LT++ +ITR + V T +S  Q +++RDA VKGIYGRLFVWIVEKIN AIY+P   +V         NS+  SIG+LDIFGFENF  NSFEQLCIN+ANE+LQQFFVRH+FK+EQEEY  E IDW HI FTDNQE LD+I  +  N+++LIDEES+FPKGTD ++L+KL +    +  ++  K      FGI HFAGVV+Y+  GFLEKNRD  + D+++L+ +++++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNEFKK + FDR LC+RQLRYSGMMETIRIR AGYPIR+ F +F++RYR+L+PG+  +++  D R T + + + +L     +QIGKTK+FLKD  D+LLE  RDKA+++R+IL+QK  R +  R+ FL+ KSAA  IQ   R    R+ +  ++ GF  LQA  R++   K+ +  +  I   Q  CR  L R   + +  A+I +Q+  R   A +  + L+ +  +  EA  ++  +E   + +MS +KA EEAE++H+ RL Q+  E   DA+++LK+  + +++   + + E+ R++P++ S+M+D++FG +   +  S+P     AP  F DLE  R   +  DV +     +PD      +ED+SE+ F KFAATYFQ      ++R+PL++PLL+H +   Q++ALAVWI ILRFM DLPEP  + + +  +  +P+MTKIY++LG++  K+++     E E Q+  G    ++     R  +V LTLKKKSK T+EV   LND E+ +     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQI KQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ L+ KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDAISQCEQ+AKE+G  E  A WRLFFRKE+FTPWHN  +D VAT+LIY QV+RG+KFGEYRC+ +DD+ +L + Q  +D   ++  E L      Y+P   I   K  +K+    +    K +    R DS   +K+KE++V +AR KWP+LFSRFYEA KFSGP L  ++VI  +NWTG+Y VD  E++ LELSFPEI+AVSSSR    +                              S   +++   S +L+T+KG  YTF  +N+EDIRDL+V FLEGL++RS Y + +Q    P   +S FLS  KGDL+IL+ +D    +  S W  G N RTK+ GDFP D VY++P +  P + I+AL +   D+               + R K +TLEEFS  YFR P   + S  M    +    LW H+R+ LK  LLKK+L  E+L Q+A   F A+L YMGD PSK   S  E+ + IF+  LK E LKDE Y Q++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     LA++C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD CQNI S++ LK  +GF+LFVK  DK IS+PE DFFFDF+R L+DW+KK RP+KDG +    YQVFFMKKLWT TVPG D +AD +FHY QE+ KYL GYHK   ++ + LGALI R   ++D S   S  + L  L+P D++ +    + ++ ++A ++     S  +AK+AFLK+IF+WPTFGSAFFEVKQ+T  N PE +LIAINK GV LI  +TK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLT ++K
Sbjct:    1 MVILQKGDYVWMDLKSGQEFD--VPIGAVVKLCDSGQIQVVDDEDNEHWISPQNATHIKPMHPTSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQYTNKKIGEMPPHIFAIADNCYFNMKRNNRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQAPDERNYHVFYCMLEGMNEEEKKKLGLGQAADYNYLAMGNCITCEGRVDSQEYANIRSAMKVLMFTDTENWEISKLLAAILHMGNLQYEARTFENLDACEVLFSPSLATAASLLEVNPPDLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVEKINAAIYKPPPLEV--------KNSR-RSIGLLDIFGFENFTVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLESIDWLHIEFTDNQEALDMIANRPMNVISLIDEESKFPKGTDATMLHKLNSQHKLNANYVPPKNSHETQFGINHFAGVVYYESQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSGMMETIRIRHAGYPIRYSFVEFVERYRVLLPGVKPAYKQGDLRGTCQRMAEAVLGTHDDWQIGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLRLKSAATLIQRHWRGHHCRKNYELIRLGFLRLQALHRSRKLHKQYRLARQRIIEFQARCRAYLVRKAFRHRLWAVITVQAYARGMIARRLHRRLRVEYQRRLEAERMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLARE---DAERELKEKEEARRKKELLEQMEKARHEPINHSDMVDKMFGFLG--TSGSLPGQEGQAPSGFEDLERGRREMVEEDVDAAL--PLPDED----EEDLSEYKFAKFAATYFQGTTTHSYTRRPLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRELQALQGEGETQLPEGQKKTSV-----RHKLVHLTLKKKSKLTEEVTKRLNDGESTVQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTARELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHNPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYFVDYGSEMILERLLSLVPTYIPDREITPLKNLEKWAQLAIAAHKKGIYAQRRTDS---QKVKEDVVNYARFKWPLLFSRFYEAYKFSGPPLPKSDVIVAVNWTGVYFVDEQEQVLLELSFPEIMAVSSSRECRVLLSLGCSDLGCATCQSGRAGLTPAGPCSPCWSCRGTKMMAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEESGFLSFAKGDLIILD-HDTGEQVMNSGWANGINERTKQRGDFPTDCVYVMPTVTLPPREIVALVTMTPDQRQDVVRLLQLRTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGKDRLWSHTREPLKQALLKKILGSEELSQEACMAFVAVLKYMGDYPSKRMRSVNELTDQIFEWALKAEPLKDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQNIASRLLLKSSEGFSLFVKIADKVISVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPRTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSK 2207          
BLAST of Dach-1 vs. UniProt/SwissProt
Match: sp|Q29P71|MYO7A_DROPS (Myosin-VIIa OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=ck PE=3 SV=1)

HSP 1 Score: 2139 bits (5541), Expect = 0.000e+0
Identity = 1130/2213 (51.06%), Postives = 1508/2213 (68.14%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNIL----DEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMT-NGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTI-----IGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPD--SSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKN-YSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDG-QLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSS 6734
            MV+  +GD++WIE  S  +    V IGA++      +I V DDDG E  L P  +I+ MH SS+QGV+DMISLGDL+EAGILRNLLIRYK N IYTYTG ILVAVNPY +LPIYT  +IK YK  KIG+L PHIFAI DNAY +M+R  +DQ I+ISGESGAGKTESTKLILQ+LAA+SG+HSWIEQQ+L++NPILEAFGNAKTIRNDNSSRFGKYIDI+F  NG IEGAKI+Q+LLEKSRIVSQ   ERNYHVFYC+L GL  E +SR  L A+  Y YL  G  I   G  D  +F  + SAMKVL F++ E  EI +LLAA LH GNI +KA +  N+D+ E+         + LL L  + L  ALT + +    + VV+ +S  Q +++RDA VKGIYGRLFV IV KINTAI++P            ++ S+  +IGVLDIFGFENFD NSFEQ CINYANENLQQFFV+HIFK+EQEEY  E I+WQHI F DNQ+ LDLI +K  NI+ALIDEE+RFPKGTD ++L KL  T   H  ++K K+DI   FG+ HFAGVV Y   GFL+KNRD F+ DL+ L+  + ++FL+ +F +D +MG +TRKR PTL  QFRKSLD+LMK L   +PFF+RCIKPNE KK + FDR LC RQLRYSGMMETIRIR+AGYPIRH F +F++RYR L+PG+P + R  D +  T  +C  +L    YQ+G TK+FLKDA D+ LE  RD+ L+ +I+++Q++ R + +R +FL+ ++AAI +Q F +    R+++  M+ G+  LQA  R++V S + + L+G I  +Q H RG L R     K  A+IKIQS +R+  A+++++ L+ +  +  E L L+K +E    ++ ++       +     RL+++    +A    QL+D   ++ +   I +A R++ +PVD+ ++++ +F  +        P+S S AP      E S      D+         D +  +     +ED+SEF F KFAATYFQ + +  +++K L+ PLL       Q++A A+WI ILRF  D+PEP  +     + ++  +M+K+  +LGR F +    K  +EA+ M  +   +     R+ R  +VSLTLK+K+K  ++V   L D E      +  S L+ RPTSNLEKLHFIIG+GIL  ELRDEIYCQICKQL +NP   S +RG ILL+LC+GCFAP+EKFV  LR FI+      A +   RL+RTF+NGTRNQPPSWLEL+A K K+PI+L +  M+GNT+T+ ADSA+TA+ELC+ LS KI LKDQFGFSL+IA+ DKVSS+GSGGDHVMDAISQCEQ+AKE+G  E  A WRLFFRKEIF PWH    D VAT+LIY QV+RG+KFGEYRCD ++D+  + A Q  I+   D+S E L   LP  I      G+ K  ++ W AL+ +A K       KD I++ K+KE+IV++A+ KWP+LFSRFYEA + SGP+L  N+VI  +NWTG+Y+VD  E++ LELSFPEI AVSS +        T+++  Q+ SLSTV+G  +TF   N+EDIRDL+V+FL+GLK+RS Y I +Q +  P   +SFLS  KGDL+ILE       +  + W  G   R++E GDFPA+ VY+LP ++ P Q+ILALF+       G      SN    + R + HTL E++  +FR P   + S T++L  + +  LW++SR  +KLPLL+KL +KE+L ++A   F+AIL YMGD PSK      EI + IFD  LKHEIL+DE+YCQL+ Q+T N N  SE+ GWEL+WLATG+   +  L +EL    R+    ++ +   RLQKT++ GQR+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+T+ KD C NI  ++ L+  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP++DG   +F YQVFFMKKLWTNTVPG D+ AD++FHY QE+ K L GYHK   ++A  L AL+ R    ++ ++LQ+  + L  LIP D++      E ++ ++A Y+    M+  DAK+AFLKI+++WPTFGSAFFEVKQ+T  N PE +LIAINK+GV LIH  TK+ L  +P++ ISNWSSGNTYF+MTIGNL+ G KLLCET LGYKMDDLLTSYISLMLT + K+ +
Sbjct:    1 MVIVTRGDYIWIEPASGREFD--VAIGARVISAEGRRIQVRDDDGDEVWLAPERRIKAMHASSVQGVEDMISLGDLHEAGILRNLLIRYKENLIYTYTGSILVAVNPYQILPIYTGDQIKLYKERKIGELPPHIFAIGDNAYAHMKRYLQDQCIVISGESGAGKTESTKLILQYLAAISGKHSWIEQQILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFSANGVIEGAKIEQYLLEKSRIVSQNHSERNYHVFYCILAGLSSEEKSRLDLGAAADYKYLTGGNSITCEGRDDAAEFSDIRSAMKVLLFSDQEIWEIIKLLAALLHCGNIKYKATVVDNLDATEIPEHINVERVAGLLGLPIQPLIDALTRRTLFAHGETVVSTLSRDQSVDVRDAFVKGIYGRLFVHIVRKINTAIFKP------------RATSR-NAIGVLDIFGFENFDQNSFEQFCINYANENLQQFFVQHIFKLEQEEYNHEAINWQHIEFVDNQDALDLIAIKQLNIMALIDEEARFPKGTDTTMLAKLHKTHGSHKNYLKPKSDINTSFGLNHFAGVVFYDTRGFLDKNRDTFSPDLLHLVSQSGNKFLRQIFAQDIEMGAETRKRTPTLSTQFRKSLDALMKTLSSCQPFFIRCIKPNELKKPMMFDRGLCCRQLRYSGMMETIRIRRAGYPIRHGFREFVERYRFLIPGVPPAHRT-DCQVATSRICAMVLGKSDYQLGHTKVFLKDAHDLFLEQERDRVLTRKILILQRSIRGWVYRRRFLRLRAAAISVQRFWKGYAQRKRYRNMRVGYMRLQALIRSRVLSHRFRHLRGHIVGLQAHARGYLVRREYGHKMWAVIKIQSHVRRMIAVRRYRKLRLEHKQFAEVLHLRKMEEQELMHRGNKHAREIAEQHYRD-RLHELERREIA---TQLEDRRRVEVKMNIINDAARKQEEPVDDGKLVEAMFDFL--------PDSSSDAPTPHGGRETS---VFMDLPQGQAANQEDIIAQLHVSEDEEDLSEFKFQKFAATYFQGNVNHQYAKKALKHPLLPLHTQGDQLAAQALWITILRFTGDMPEPKYHT--MDRMDTTSVMSKVTATLGRNFIRS---KEFQEAQLMGLDPDAFLKQKPRSIRHKLVSLTLKRKNKLGEDVRRRLQDDE--YTADSYQSWLQSRPTSNLEKLHFIIGHGILRAELRDEIYCQICKQLTNNPLKSSHARGWILLSLCVGCFAPSEKFVNYLRAFIREGPPGYAPYCEERLKRTFNNGTRNQPPSWLELQATKSKKPIMLPITFMDGNTKTLLADSATTARELCNQLSDKITLKDQFGFSLYIALFDKVSSLGSGGDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIFAPWHEPTHDQVATNLIYQQVVRGVKFGEYRCDKEEDLAMIAAQQYFIEYGTDMSMERLFTLLPNFIPDFCLSGVDKAIER-WAALVLQAYKKSYYV--KDKIAALKIKEDIVSYAKYKWPLLFSRFYEAYRNSGPNLPKNDVIIAVNWTGVYVVDDQEQVLLELSFPEITAVSSQK--------TTKVFTQTFSLSTVRGEEFTFQSPNAEDIRDLVVYFLDGLKKRSKYVIALQDYRAPSDGTSFLSFFKGDLIILEDESCGESVLNNGWCIGRCDRSQERGDFPAETVYVLPTLSKPPQDILALFNIEDAAHHGRRLSMASNGGTVEPRDRPHTLMEYALDHFRLPPKRTMSKTLTLSSKRSEELWRYSRDPIKLPLLRKLQSKEELAEEACFAFAAILKYMGDLPSKRPRMGNEITDHIFDGPLKHEILRDEIYCQLMKQLTDNRNRMSEERGWELMWLATGLFACSQGLLKELSLFLRTRRHPISQDSMHRLQKTIRHGQRKYPPHQVEVEAIQHKTTQIFHKVYFPDDTDEAFEVDSSTRAKDFCNNISQRLSLRTSEGFSLFVKIADKVISVPEGDFFFDFVRHLTDWIKKARPIRDGANPQFTYQVFFMKKLWTNTVPGKDRNADLIFHYHQELPKLLRGYHKCSREEAAKLAALVFRVRFGENKTELQAIPQMLRELIPSDIMKMQSTNEWKRSIVASYNQDGGMTSEDAKVAFLKIVYRWPTFGSAFFEVKQTTEPNYPEMLLIAINKHGVSLIHPVTKDILVTHPFTRISNWSSGNTYFHMTIGNLVRGSKLLCETSLGYKMDDLLTSYISLMLTNMNKNRT 2164          
BLAST of Dach-1 vs. UniProt/SwissProt
Match: sp|Q13402|MYO7A_HUMAN (Unconventional myosin-VIIa OS=Homo sapiens OX=9606 GN=MYO7A PE=1 SV=2)

HSP 1 Score: 2130.52 bits (5519), Expect = 0.000e+0
Identity = 1123/2240 (50.13%), Postives = 1508/2240 (67.32%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPK-GYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAE-QMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNF------------------------------VSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSL-LALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            MV+ Q+GD VW++ +   +    VPIGA +K     Q+ V+DD+ +E  + P   T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYTYTG ILVAVNPY +L IY+P+ I+ Y N KIG++ PHIFAIADN Y NM+R SRDQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++ PILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q  DERNYHVFYCMLEG+  + + + GL  +  Y YL  G  I   G  D  ++  + SAMKVL FT+ E  EI +LLAA LHLGN+ ++A+   N+D+CEV        A+ LL+++  DL   LT++ +ITR + V T +S  Q +++RDA VKGIYGRLFVWIV+KIN AIY+P    V         NS+  SIG+LDIFGFENF  NSFEQLCIN+ANE+LQQFFVRH+FK+EQEEY  E IDW HI FTDNQ+ LD+I  K  NI++LIDEES+FPKGTD ++L+KL +    +  +I  K +    FGI HFAG+V+Y+  GFLEKNRD  + D+++L+ +++++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNEFKK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F++RYR+L+PG+  +++  D R T + + + +L     +QIGKTK+FLKD  D+LLE  RDKA+++R+IL+QK  R +  R+ FLK K+AA  IQ   R    R+ +  M+ GF  LQA  R++   ++ +  +  I   Q  CR  L R   + +  A++ +Q+  R   A +  + L+ + +   EA  ++  +E   + +MS +KA EEAE++H+ RL Q+  E   DA+++LK+    +++   + + ER R++PV+ S+M+D++FG +   +   +P     AP  F DLE  R   + +        +P  L +  +ED+SE+ F KFAATYFQ      ++R+PL++PLL+H +   Q++ALAVWI ILRFM DLPEP  + + +  +  +P+MTKIY++LG++  K+++     E E Q+  G    ++     R  +V LTLKKKSK T+EV   L+D E+ +     +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQI KQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ L+ KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDAISQCEQ+AKE+G  E  A WRLFFRKE+FTPWH+  +D VAT+LIY QV+RG+KFGEYRC+ +DD+ +L + Q  +D   ++  E L      Y+P   I   K  +K+    +    K +    R D   ++K+KE++V++AR KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ LELSFPEI+AVSSSR                                   S   ++    S +L+T+KG  YTF  +N+EDIRDL+V FLEGL++RS Y + +Q    P   +S FLS  KGDL+IL+ +D    +  S W  G N RTK+ GDFP D VY++P +  P + I+AL +   D+               + R K +TLEEFS  YFR P   + S  M    +    LW H+R+ LK  LLKKLL  E+L Q+A   F A+L YMGD PSK   S  E+ + IF+  LK E LKDE Y Q++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     LA++C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD CQNI +++ LK  +GF+LFVK  DK +S+PE DFFFDF+R L+DW+KK RP+KDG +    YQVFFMKKLWT TVPG D +AD +FHY QE+ KYL GYHK   ++ + LGALI R   ++D S   S  + L  L+P D++ +    + ++ ++A ++     S  +AK+AFLK+IF+WPTFGSAFFEVKQ+T  N PE +LIAINK GV LI  KTK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLT ++K
Sbjct:    1 MVILQQGDHVWMDLRLGQEFD--VPIGAVVKLCDSGQVQVVDDEDNEHWISPQNATHIKPMHPTSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQYTNKKIGEMPPHIFAIADNCYFNMKRNSRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQALDERNYHVFYCMLEGMSEDQKKKLGLGQASDYNYLAMGNCITCEGRVDSQEYANIRSAMKVLMFTDTENWEISKLLAAILHLGNLQYEARTFENLDACEVLFSPSLATAASLLEVNPPDLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYKPPSQDV--------KNSR-RSIGLLDIFGFENFAVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLESIDWLHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDTTMLHKLNSQHKLNANYIPPKNNHETQFGINHFAGIVYYETQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSGMMETIRIRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQGDLRGTCQRMAEAVLGTHDDWQIGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLKLKNAATLIQRHWRGHNCRKNYGLMRLGFLRLQALHRSRKLHQQYRLARQRIIQFQARCRAYLVRKAFRHRLWAVLTVQAYARGMIARRLHQRLRAEYLWRLEAEKMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLARE---DAERELKEKEAARRKKELLEQMERARHEPVNHSDMVDKMFGFLG--TSGGLPGQEGQAPSGFEDLERGRREMVEE---DLDAALP--LPDEDEEDLSEYKFAKFAATYFQGTTTHSYTRRPLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRELQALQGEGEAQLPEGQKKSSV-----RHKLVHLTLKKKSKLTEEVTKRLHDGESTVQG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAKELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHSPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYFVDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAHKKGIYAQRRTD---AQKVKEDVVSYARFKWPLLFSRFYEAYKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEIMAVSSSRECRVWLSLGCSDLGCAAPHSGWAGLTPAGPCSPCWSCRGAKTTAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEESGFLSFAKGDLIILD-HDTGEQVMNSGWANGINERTKQRGDFPTDSVYVMPTVTMPPREIVALVTMTPDQRQDVVRLLQLRTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGKDRLWSHTREPLKQALLKKLLGSEELSQEACLAFIAVLKYMGDYPSKRTRSVNELTDQIFEGPLKAEPLKDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQNIATRLLLKSSEGFSLFVKIADKVLSVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSK 2207          
BLAST of Dach-1 vs. UniProt/SwissProt
Match: sp|Q9V3Z6|MYO7A_DROME (Myosin-VIIa OS=Drosophila melanogaster OX=7227 GN=ck PE=1 SV=1)

HSP 1 Score: 2128.21 bits (5513), Expect = 0.000e+0
Identity = 1125/2212 (50.86%), Postives = 1503/2212 (67.95%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQR---IAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNIL----DEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMT-NGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTI-----IGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPD--SSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS--DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKN-YSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDG-QLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSS 6734
            MV+  +GD++WIE  S  +    V IGA++      +I V DDDG E  L P  +I+ MH SS+QGV+DMISLGDL+EAGILRNLLIRYK N IYTYTG ILVAVNPY +LPIYT  +IK YK  KIG+L PHIFAI DNAY +M+R  +DQ I+ISGESGAGKTESTKLILQ+LAA+SG+HSWIEQQ+L++NPILEAFGNAKTIRNDNSSRFGKYIDI+F  NG IEGAKI+Q+LLEKSRIVSQ   ERNYHVFYC+L GL  + +SR  L  +  Y YL  G  I   G  D  +F  + SAMKVL F++ E  EI +LLAA LH GNI +KA +  N+D+ E+         + LL L  + L  ALT + +    + VV+ +S  Q +++RDA VKGIYGR+FV IV KINTAI++P               +   +IGVLDIFGFENFD NSFEQ CINYANENLQQFFV+HIFK+EQEEY  E I+WQHI F DNQ+ LDLI +K  NI+ALIDEE+RFPKGTD ++L KL  T   H  ++K K+DI   FG+ HFAGVV Y   GFL+KNRD F+ DL+ L+  + ++FL+ +F +D +MG +TRKR PTL  QFRKSLD+LMK L   +PFF+RCIKPNE KK + FDR LC RQLRYSGMMETIRIR+AGYPIRH F +F++RYR L+PG+P + R  D +  T  +C  +L    YQ+G TK+FLKDA D+ LE  RD+ L+ +I+++Q++ R + +R +FL+ ++AAI +Q F +    R+++  M+ G+  LQA  R++V S + + L+G I  +Q H RG L R     K  A+IKIQS +R+  A+++++ L+ +  +  E L L+K +E    ++ ++       +       +++H     + Q+QL++   ++     I +A R++ +PVD+ ++++ +F  +        P+S S AP      E S     ND+         D +  I     +ED+SEF F KFAATYFQ + +  +++K L+ PLL       Q++A A+WI ILRF  D+PEP  +     + ++  +M+K+  +LGR F +    K  +EA+ M  +   +     R+ R  +VSLTLK+K+K  ++V   L D E      +  S L+ RPTSNLEKLHFIIG+GIL  ELRDEIYCQICKQL +NP   S +RG ILL+LC+GCFAP+EKFV  LR FI+      A +   RL+RTF+NGTRNQPPSWLEL+A K K+PI+L +  M+GNT+T+ ADSA+TA+ELC+ LS KI LKDQFGFSL+IA+ DKVSS+GSGGDHVMDAISQCEQ+AKE+G  E  A WRLFFRKEIF PWH    D VAT+LIY QV+RG+KFGEYRCD ++D+  + A Q  I+   D+S E L   LP  I      G+ K  ++ W AL+ +A K       KD I+  K+KE+IV++A+ KWP+LFSRFYEA + SGP+L  N+VI  +NWTG+Y+VD  E++ LELSFPEI AVSS +        T+++  Q+ SLSTV+G  +TF   N+EDIRDL+V+FL+GLK+RS Y I +Q +  P   +SFLS  KGDL+ILE       +  + W  G   R++E GDFPA+ VY+LP ++ P Q+ILALF+  +   G      SN    + R + HTL E++  +FR P   + S T++L  + +  LW++SR  +K PLL+KL +KE+  ++A   F+AIL YMGD PSK      EI + IFD  LKHEIL+DE+YCQL+ Q+T N N  SE+ GWEL+WLATG+   +  L +ELL   R+    ++ +   RLQKT++ GQR+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+T+ KD C NI  ++ L+  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP++DG   +F YQVFFMKKLWTNTVPG D+ AD++FHY QE+ K L GYHK   ++A  L AL+ R    ++  +LQ+  + L  LIP D++     +E ++ ++A Y+    M+  DAK+AFLKI+++WPTFGSAFFEVKQ+T  N PE +LIAINK+GV LIH  TK+ L  +P++ ISNWSSGNTYF+MTIGNL+ G KLLCET LGYKMDDLLTSYISLMLT + K+ +
Sbjct:    1 MVIVTRGDYIWIEPASGREFD--VAIGARVVSAEGRRIQVRDDDGDEVWLAPERRIKAMHASSVQGVEDMISLGDLHEAGILRNLLIRYKENLIYTYTGSILVAVNPYQILPIYTGDQIKLYKERKIGELPPHIFAIGDNAYAHMKRYRQDQCIVISGESGAGKTESTKLILQYLAAISGKHSWIEQQILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFSANGVIEGAKIEQYLLEKSRIVSQNHSERNYHVFYCILAGLSADEKSRLDLGMAADYKYLTGGNSITCEGRDDAAEFSDIRSAMKVLLFSDQEIWEIIKLLAALLHCGNIKYKATVVDNLDATEIPEHINVERVAGLLGLPIQPLIDALTRRTLFAHGETVVSTLSRDQSVDVRDAFVKGIYGRMFVHIVRKINTAIFKP-------------RGTSRNAIGVLDIFGFENFDQNSFEQFCINYANENLQQFFVQHIFKLEQEEYNHEAINWQHIEFVDNQDALDLIAIKQLNIMALIDEEARFPKGTDQTMLAKLHKTHGSHKNYLKPKSDINTSFGLNHFAGVVFYDTRGFLDKNRDTFSPDLLHLVSQSTNKFLRQIFAQDIEMGAETRKRTPTLSTQFRKSLDALMKTLSSCQPFFIRCIKPNELKKPMMFDRGLCCRQLRYSGMMETIRIRRAGYPIRHGFREFVERYRFLIPGVPPAHRT-DCQAATSRICAVVLGKSDYQLGHTKVFLKDAHDLFLEQERDRVLTRKILILQRSIRGWVYRRRFLRLRAAAITVQRFWKGYAQRKRYRNMRVGYMRLQALIRSRVLSHRFRHLRGHIVGLQAHARGYLVRREYGHKMWAVIKIQSHVRRMIAMRRYRKLRLEHKQFAEVLQLRKLEEQELLHRGNKHAREIAEQHYR----DRLHELERREIQEQLENRRRVEVNMNIINDAARKQEEPVDDGKLVEAMFDFL--------PDSSSDAPTPHGGRETS---VFNDLPHAQNVNQDDIIAPIHISEDEEDLSEFKFQKFAATYFQGNVNHQYAKKALKHPLLPLHTQGDQLAAQALWITILRFTGDMPEPKYHT--MDRMDTTSVMSKVTATLGRNFIRS---KEFQEAQLMGLDPDAFLKQKPRSIRHKLVSLTLKRKNKLGEDVRRRLQDDE--YTADSYQSWLQSRPTSNLEKLHFIIGHGILRAELRDEIYCQICKQLTNNPLKSSHARGWILLSLCVGCFAPSEKFVNYLRAFIREGPPGYAPYCEERLKRTFNNGTRNQPPSWLELQATKSKKPIMLPITFMDGNTKTLLADSATTARELCNQLSDKISLKDQFGFSLYIALFDKVSSLGSGGDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIFAPWHEPTHDQVATNLIYQQVVRGVKFGEYRCDKEEDLAMIAAQQYFIEYSTDMSMERLFTLLPNFIPDFCLSGVDKAIER-WAALVLQAYKKSYYV--KDKIAPLKIKEDIVSYAKYKWPLLFSRFYEAYRNSGPNLPKNDVIIAVNWTGVYVVDDQEQVLLELSFPEITAVSSQK--------TNKVFTQTFSLSTVRGEEFTFQSPNAEDIRDLVVYFLDGLKKRSKYVIALQDYRAPSDGTSFLSFFKGDLIILEDESCGESVLNNGWCIGRCDRSQERGDFPAETVYVLPTLSKPPQDILALFNIEEAHHGRRLSMASNGGAVEPRDRPHTLMEYALDHFRLPPKRTMSKTLTLSSKRSEELWRYSRDPIKAPLLRKLQSKEEFAEEACFAFAAILKYMGDLPSKRPRMGNEITDHIFDGPLKHEILRDEIYCQLMKQLTDNRNRMSEERGWELMWLATGLFACSQGLLKELLLFLRTRRHPISQDSMHRLQKTIRHGQRKYPPHQVEVEAIQHKTTQIFHKVYFPDDTDEAFEVDSSTRAKDFCNNISQRLSLRTSEGFSLFVKIADKVISVPEGDFFFDFVRHLTDWIKKARPIRDGANPQFTYQVFFMKKLWTNTVPGKDRNADLIFHYHQELPKLLRGYHKCSREEAAKLAALVFRVRFGENKQELQAIPQMLRELIPSDIMKIQSTSEWKRSIVASYNQDGGMTSEDAKVAFLKIVYRWPTFGSAFFEVKQTTEPNYPEMLLIAINKHGVSLIHPVTKDILVTHPFTRISNWSSGNTYFHMTIGNLVRGSKLLCETSLGYKMDDLLTSYISLMLTNMNKNRT 2163          
BLAST of Dach-1 vs. TrEMBL
Match: A0A481MTN9 (Dach-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 4381.25 bits (11362), Expect = 0.000e+0
Identity = 2184/2195 (99.50%), Postives = 2184/2195 (99.50%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQ--GGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPDSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKLIQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSSN 6737
            MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQ  GGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRKFCALKKFKDLKKKDMKLKEALSLKKKDENIFKNQMSEEKAHEEAEKRHKMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKKKYWLALLNKAVKNLNETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSR        TSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPDSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQLLKLPLLKKLLNKEDLCQQAVSCFSAILIYMGDQPSKNYSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKLIQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQLEFAYQVFFMKKLWTNTVPGLD VADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSSN
Sbjct:    1 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQAKGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRKFCALKKFKDLKKKDMKLKEALSLKKKDENIFKNQMSEEKAHEEAEKRHKMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKKKYWLALLNKAVKNLNETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSR--------TSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPDSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQLLKLPLLKKLLNKEDLCQQAVSCFSAILIYMGDQPSKNYSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKLIQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQLEFAYQVFFMKKLWTNTVPGLDHVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSSN 2187          
BLAST of Dach-1 vs. TrEMBL
Match: A0A1I8GD03 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 2337.38 bits (6056), Expect = 0.000e+0
Identity = 1214/2237 (54.27%), Postives = 1566/2237 (70.00%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKY--TSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELS-----RMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEP--LVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTN--GMPYENLS--MRTNRKNIVSLTLKKKSKFTDEVVNHLNDAE-NPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTI-----------IGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPD--SSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFG-------DSYGGGSNNNHNDSR-----GKQHTLEEFSKIYFRTPSSGSRSFTMSLG---KQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSK-NYSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQM-GKLIQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDG-QLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSS 6734
            MVV  +GD +WIE          VPIGA++K     QI VIDDDG EF L+PG KIRHMH S + GV+DMISL DLNE GILRNLLIRY +  IYTYTG ILVAVNPY VLPIYT ++IK Y++ KIG+L PHIFAI DNAYNNMRR  RDQ IIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQ+LDSNPI+EAFGNAKTIRNDNSSRFGKYIDI+F     IEGAKI+Q+LLEKSRIV+Q + ERNYH+FYCML G+  + RS   L  +  Y YL QGG + + G  D +++  + SAMKVL F++ +  +I  LLAA LHLGN+ + + +  N+D+ EV  D E   A++LL  +  +LR ALTTK I TR D V + +S+    +++DALVKGIYGRLFVWIV KIN AIY+             +S  KY   SIGVLDIFGFENF  NSFEQLCIN+ANENLQQFFVRHIFK+EQEEY +E I W+HI F DNQ+TLDLI VK  NIL+L+DEE++FPKGTD ++L+KL    S +  +++ +A + K FG+ HFAG V+Y   GFL+KNRD F+ADL++LIQ + ++FLK LF +DF MG +TRKRAPTL +QF+KSL++LMK L + +PFFVRCIKPNE KK L FDR LC+RQLRYSGMMETIRIR+AGYPIRH+F DF+DRYR+LV GIP+S  C++ RE    +CK +L  +  Q+GKTK+FLKDA D+ LE  RD+ L+ +II+IQK WR Y++R ++L  + A+ +IQ +VRM L RR++++ + GF  +QA  RA+  +   +  +  + N+QR+ RG L R     +  ++IK+QS IR+F A K + +L+ +  K  EA  LK++ E   K +   ++A  EAEK H+ RL Q+  ES     QQ ++    K+ I  AERR+ +PVD+S+M++EIFG ID             AP+AFRDLE S        A     S  G  +P   V   DED+SE+ F K+AATYFQ +     +R+ L++PL    N   QI+ALAVWI ILRFM DLPEP   V  SR S     P+MTKIY +LGR+FN++++ +AA+ A ++    G+     S   R+ RK +VSLTLKKKSK TD VVN L + E NP +    + LLE+RPTSNLEKLHFIIGNGIL PELRDEIYCQICKQL+ NP   S++RG ILL+LC+GCFAP+EKFVR LRNFI+      A +   RLQRTF NGTRNQPPSWLEL+A K+K P+ L +  M+GNTET+ ADSA+TA+ELC  L++KI L D+FGFSL+IA+ DKVSS+GSGGDHVMDAISQCEQ+AKE+G  E  A WRLF+RKEIF PWH+  +D VAT+LIY QV+RGIKFGEYRC+ D+D+  + A +  ID   +L  + L   LP  I            G       YWL  +++A +       K+  +  ++KE+IV FA+ KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+++VD  E++ LELSFPEI AVS+SR        T R+HGQS +L+T+KG  YTF   N+EDIRDL+V FLEGLK RS Y I +Q + +P   SSFL+ +KGDLLILE + N   +  S W YGENYRT   GDFPA+ VY+LP++  PS  IL+LF+ +  G         +G G ++  N         +QHTLEE+S  +FR P   ++S  + +    ++ A  LW+HSR  LK PLL+KL  K+DL  QA+  F A L YMGD PSK + +  E+ + IF+P LKHE+LKDEVYCQL  Q+T N N  SE+ GWEL+WLATG   P+ NL +E+ +  R++ + +A +C  RLQKTL+ GQR+YPPH +E+ A+Q    +I HK+YFP++S +AFE+ S+T+ KD C N+ +K+GLK Y+GF+LFVK  DK IS+PEGDFFFDF+R L++W+KK +P +DG   +F+YQVFFMKKLW+ TVPG D+ ADI+FHY QE+ K L GYHK  + +A  L ALI R    ++ + LQ     L  L+P D++ +    E +++++AQY+ S  MS ++AK+ F K+I++WPTFGSAFFEVKQ+T  N PE +LIAINK+G         E L+ +P++ ISNWSSGNTYF+MT+GNLI G KLLCET LGYKMDDLLTSYISLMLTT+ K  +
Sbjct:    1 MVVLHEGDHIWIEPDKPGPFD--VPIGARVKYSASGQIQVIDDDGKEFWLRPGMKIRHMHASVVNGVEDMISLTDLNEGGILRNLLIRYNQKLIYTYTGSILVAVNPYQVLPIYTAEQIKAYRDKKIGELPPHIFAIGDNAYNNMRRYQRDQCIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQILDSNPIMEAFGNAKTIRNDNSSRFGKYIDIHFNAKWCIEGAKIEQYLLEKSRIVTQAQGERNYHIFYCMLAGMTPQERSALELGQASEYHYLVQGGDVCVDGRDDAMEYAGIKSAMKVLNFSDGDSLDIHGLLAAILHLGNVRYASTVVDNIDASEVVGDRELARAARLLGCNPVNLRDALTTKTIFTRGDTVTSPMSVDYATDVKDALVKGIYGRLFVWIVIKINAAIYK------------GRSAEKYYQNSIGVLDIFGFENFGVNSFEQLCINFANENLQQFFVRHIFKLEQEEYNSEGISWKHIEFIDNQDTLDLIAVKPMNILSLVDEEAKFPKGTDDTMLHKLHQNHSSNSLYLQPRAAVTKAFGLRHFAGDVYYSAQGFLDKNRDTFSADLVKLIQESSNKFLKSLFARDFAMGVETRKRAPTLSLQFKKSLEALMKTLTQCQPFFVRCIKPNELKKPLTFDRELCVRQLRYSGMMETIRIRRAGYPIRHQFADFVDRYRVLVDGIPTSKVCRNLREACATICKQVLSGQDVQLGKTKVFLKDAHDVFLEQERDRQLTKKIIVIQKRWRGYFYRKRYLAMRRASCRIQAWVRMFLARRRYLRQRTGFLRMQAVLRARQLNAAFQRSRVLVVNLQRYARGYLARRRCHGRLASVIKLQSNIRRFIAQKNYANLRLRHGKRVEAEKLKREMEERLKREKGSKEAKIEAEKAHRERLAQLDRESQEADLQQRQEAVKKKEAIELAERRKYEPVDDSKMVEEIFGFID------TEQEDGAAPQAFRDLEESRRRAIERAAAAAASSPTGAELP--AVPGADEDISEYRFAKYAATYFQGNATHTHTRRALKQPLTALKNEGDQIAALAVWITILRFMSDLPEPRLTVGDSRDSH---TPVMTKIYSTLGRRFNQKEVEEAAKLAGELEKDPGLSSSQRSGGKRSIRKKLVSLTLKKKSKLTDGVVNRLREGEFNPGS----NELLEDRPTSNLEKLHFIIGNGILRPELRDEIYCQICKQLSQNPNKVSLARGWILLSLCVGCFAPSEKFVRYLRNFIREGPPGYAPYCENRLQRTFVNGTRNQPPSWLELQATKNKRPLSLPITFMDGNTETLMADSATTAEELCQGLAEKIGLTDRFGFSLYIALFDKVSSLGSGGDHVMDAISQCEQYAKEQGTQERNAPWRLFYRKEIFAPWHDPAEDPVATNLIYQQVVRGIKFGEYRCEKDEDLAMIAAQEYYIDTGPELMQDRLQSLLPSYIPDSSLSGGGAGPGGRSGGSNYWLQAVSQAFRKAYFL--KERSAPLRIKEDIVNFAKFKWPLLFSRFYEAYKFSGPSLPKNDVIIAVNWTGVFVVDDMEQVLLELSFPEITAVSASR--------TGRIHGQSFTLATLKGDEYTFTSPNAEDIRDLVVTFLEGLKRRSIYVIALQDYEQPSSGSSFLNFQKGDLLILEQS-NGETVMNSGWCYGENYRTGLKGDFPAECVYVLPLLTRPSPQILSLFTQQPGGPDLAVQAGQFGAGPDSGANGGAMAPDGARQHTLEEYSIDHFRPPPKRTQSRALGMNTARRRQADQLWRHSRDPLKQPLLRKLQGKDDLSTQAIITFLATLKYMGDHPSKRSRAGNELTDQIFEPPLKHELLKDEVYCQLCKQLTDNLNAFSEERGWELMWLATGCFAPSPNLLKEVTQFLRTSRNTVAPDCLARLQKTLRNGQRKYPPHQVEVEAIQHKTTIIYHKVYFPDDSDEAFEVDSSTRAKDFCANVANKLGLKSYEGFSLFVKIADKVISVPEGDFFFDFVRHLTEWIKKAKPSRDGVTPQFSYQVFFMKKLWSTTVPGRDRNADIIFHYHQELPKLLRGYHKCTVDEAAELAALIYRVKFGENKNNLQHIPRFLKELLPADLIKQLSAEEWKRRIVAQYNNSIGMSSDEAKVTFTKLIYKWPTFGSAFFEVKQTTEPNYPETLLIAINKHG---------EILEIHPFTKISNWSSGNTYFHMTVGNLIRGSKLLCETSLGYKMDDLLTSYISLMLTTMNKQRT 2188          
BLAST of Dach-1 vs. TrEMBL
Match: A0A2R2MNA5 (myosin-VIIa OS=Lingula unguis OX=7574 GN=LOC106174726 PE=3 SV=1)

HSP 1 Score: 2239.92 bits (5803), Expect = 0.000e+0
Identity = 1169/2210 (52.90%), Postives = 1551/2210 (70.18%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYE----NLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKK--KYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP----DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYG--GGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLG---KQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSK-NYSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSS 6734
            MV+  KGD +W++    TK    V +GA ++     +I V+DDDG E  +K G K+RHMH +S++GV+DMI+LGDL+E  ILRNL  RY++N IYTYTG ILVAVNPY VLPIY  ++IK Y++ KIG+L PHIFAI DNAY++M R   DQ +IISGESGAGKTESTKLILQFLAAVSGQHSWIEQQ+L++NPI+EAFGNAKTIRNDNSSRFGKYIDI+F   G+IEGAKI+Q+LLEKSRIV+Q  DERNYH+FYCML G+  +  +   L+ + HY YL QGG I   G  D  DF  + SAMKVL F + E  +I ++LAA LHLGN+ ++     NMD+ E+   +    A+K+L +  ++L  ALTT+ I  + + V++++++   +++RDA VKGIYGR+FV+IVEKIN AIY+  L +            + TSIGVLDIFGFE FD NSFEQLCIN+ANENLQQFFVRHIFK+EQEEY  E I+WQHI F DNQE LDL+ VK  +ILAL+DEES+FPKG+D SLL KL     K+  +++ +A++  +FG+ HFAGVV Y I+GFLEKNRD F+ DL+ LI+T++ +FLK LF KD  MG DTRKR+PTLG QF++SL+ LMK L   +PFFVRCIKPNEFKK + FDR LC+RQLRYSGMMETIRIR+AGYPIRH F +F+DRYR LVPGI    +  D +  +  +C+ IL    YQ+GK K+FLKDAQD+ LE  R+  L  +I++IQK  R ++ R +FLK KS ++ IQ   R    R++++ M+ G+  LQA +R+++ + +   L+  + + QR+CRG L R    ++  A++ IQ+ +RK  A +K++ LK +  K  EA  ++K +E   + QM+ +KA +EAE+ HK RL++I  E   + + + ++    K  I EAERR+N+PVD+S+M+D++FG ID  +  S      +AP  F+D E SR  A+ + G    + +P        ED+SE+ F KFAATYFQ +    + R+ L+  LL   N   Q++ALAVWI ILRFM DLPEP  + S     ++ P+MTKIY +LGR+FNK+D+    E+A++M   +  E     +  R+ RK +VSLTLKKKSK T+EV N L D E      + ++LL++RPTSNLEKLHFIIG+GIL PELRDEIY QICKQL+ NP   S +RG ILL+LC+GCFAP++KFV+ LR FI       A +   RL+RT  NGTRNQPPSWLEL+A K K+P++L +  M+GNT+T+ ADSA+TA+ELC  L++KI L+DQFGFSL+IA+ DKVSS+GSGGDHVMDAISQCEQ+AKE+G  E  A WRLFFRKEIF PWH+  DD +AT+LIY QV+RGIKFGEYRC+ D+D+  + A Q  ID   D+  E LH  LP  I   + + K   YW+  +    +N     ++D +   K+KE+IV +A+ KWP+LFSRFYEA KF+GPSL  N+VI  +NWTG+Y+VD  E++ LELSFPEI AVSSSR        T ++HGQS +L+TVKG  +TF   N+EDIRDL+V FLEGLK+RS Y I +Q +S P     SSFLS +KGDL++L+  DN   + +S W  G   RT + GDFPA+ VY+LP I  P Q+I+ LF+ ++   S         + +DS  K HTL E+S  +FR P   + S T+SL    ++    LW++S++ LK PLLKKLL KE+L  ++++CF +IL YMGD PSK    S E  + IF+P LKHEIL+DE+YCQ+I Q+T N N  SE+ GWEL+WLATG   P++NL +E+    RS  S  A +C  RLQKTL+ GQR+YPPH +E+ A+Q     I HK+YFP++S +AFE+ S+T+ KD CQNI +++ LK  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP +DG   +F YQVFFMKKLWTNTVPG D+ AD +FHY QE+ K L GYHK    DA  LGA+I R     D + L +    L  L+P D++ +    + ++ ++  Y+    MS +++K+AFLK I++WPTFGSAFFEVKQ+T  N P+ +LIAINK+GV LIH ++K+ L  +P++ ISNWSSGNTYF+MTIGNL+ G KLLCET LGYKMDDLLTSYISLMLTT+ +  +
Sbjct:    1 MVILAKGDHIWLDPDPKTKGEFEVAVGAVVRISDSGKICVVDDDGKEHWIKAGQKVRHMHATSVEGVEDMIALGDLHEEAILRNLFTRYQQNMIYTYTGSILVAVNPYQVLPIYHSEQIKAYRDRKIGELPPHIFAIGDNAYHSMMRYRHDQCVIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQILEANPIMEAFGNAKTIRNDNSSRFGKYIDIHFNSKGSIEGAKIEQYLLEKSRIVNQAHDERNYHIFYCMLAGMTKQQMAELELKDATHYYYLVQGGDIHCEGHDDAKDFADIRSAMKVLMFEDSEIFDILKILAALLHLGNLKYQEAQINNMDASEIMDLNCAKRAAKMLGVAPQNLVDALTTRTIFAQGESVISSMNVQNSLDVRDAFVKGIYGRMFVFIVEKINAAIYKKNLDR-----------HERTSIGVLDIFGFELFDKNSFEQLCINFANENLQQFFVRHIFKLEQEEYNMEGINWQHIEFVDNQEILDLLAVKPMSILALVDEESKFPKGSDRSLLEKLHRQHGKNVHYLRPRAEVNPMFGLNHFAGVVFYSINGFLEKNRDTFSPDLIHLIETSQFKFLKNLFYKDMHMGPDTRKRSPTLGSQFKRSLELLMKTLGACQPFFVRCIKPNEFKKPMLFDRELCVRQLRYSGMMETIRIRRAGYPIRHTFANFVDRYRFLVPGILPPHKNPDCKAASMKICQVILGKVDYQLGKRKVFLKDAQDVKLEQERELVLGQKILIIQKCIRGWHCRRRFLKMKSGSVIIQKIWRGYAQRKRYLAMRNGYMRLQALYRSRILTARFSALRAMMISFQRYCRGHLARKRYNKRLWAVVTIQAGVRKIIARRKYRRLKMERQKRLEAERIRKMEEEKLRKQMNAKKAKQEAERLHKERLSRIEMEVHEEERHEREEKEKKKFMIEEAERRKNEPVDDSKMVDQMFGFIDAQTDSS---GEGNAPEGFKDFEESRRRAIAENGWDI-SDLPH--AEFEQEDLSEYKFAKFAATYFQGNATHTYIRRALKLSLLQLKNEGDQLAALAVWITILRFMGDLPEPKYHTSLADSRDTTPVMTKIYSTLGRKFNKKDL----EDAQRMGVELEKEPIPTKVGKRSMRKKLVSLTLKKKSKITEEVANRLRDGE---YQGSGNALLDDRPTSNLEKLHFIIGHGILRPELRDEIYSQICKQLSQNPSKSSHARGWILLSLCVGCFAPSDKFVKYLRCFINDGPPGYAPYCEERLKRTLVNGTRNQPPSWLELQATKSKKPLMLPITFMDGNTKTLLADSATTAKELCIQLAEKIALRDQFGFSLYIALFDKVSSLGSGGDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIFAPWHDPSDDSIATNLIYQQVVRGIKFGEYRCEKDEDLAMIAAQQYYIDYGTDMVPERLHSLLPSYIPDSSLQHKTINYWMNGVINCHRNSY--FKRDQVPGLKVKEDIVNYAKYKWPLLFSRFYEAYKFAGPSLPKNDVIIAVNWTGVYVVDDQEQVLLELSFPEITAVSSSR--------TGKMHGQSFTLATVKGDEFTFTSPNAEDIRDLVVTFLEGLKKRSKYVIAIQDYSSPGRCEGSSFLSFQKGDLIVLD-QDNGETVMSSGWCVGICARTGQKGDFPAECVYVLPTITKPPQDIVNLFAMQADEQSQRLIHSDAVSSDDSSEKPHTLMEYSFDHFRPPPKRTLSKTLSLSSAKRRRQEELWRYSKEPLKQPLLKKLLGKEELSMESINCFLSILKYMGDHPSKRTRGSNETTDQIFEPPLKHEILRDEIYCQVIKQLTENRNRVSEERGWELMWLATGCFAPSTNLLKEVTLFLRSKKSPFAADCLNRLQKTLRNGQRKYPPHQVEVEAIQHKTTQIFHKVYFPDDSDEAFEVDSSTRAKDFCQNIANRLSLKSAEGFSLFVKIADKVISVPEGDFFFDFVRHLTDWIKKARPTRDGATPQFTYQVFFMKKLWTNTVPGKDRNADTIFHYHQELPKLLRGYHKCNTDDAAQLGAIIFRVKYGDDKTLLANIPRMLKELVPGDLVRQQSPDDWKRAIVGYYNRDAGMSPDESKVAFLKYIYKWPTFGSAFFEVKQTTEPNYPDILLIAINKHGVNLIHPQSKDILATHPFTKISNWSSGNTYFHMTIGNLVRGSKLLCETSLGYKMDDLLTSYISLMLTTMNRQRT 2175          
BLAST of Dach-1 vs. TrEMBL
Match: R7U082 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_226057 PE=3 SV=1)

HSP 1 Score: 2238.77 bits (5800), Expect = 0.000e+0
Identity = 1155/2208 (52.31%), Postives = 1536/2208 (69.57%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGI--PSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAE-RRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMT-NGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKKK---YWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPD--SSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLG---KQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSK-NYSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSAS-SLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSS 6734
            MV+ +KGD+VWIE +   +    V +GA +K      I ++DDD  E  +K G++++ MH +S++GV+DMI LGDLNEAGILRNL IRY  N IYT+TG ILVAVNPY VLPIYT ++I+ YK+ KIG + PHIF+I DN+Y+NMRR  +DQ IIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQ+L++NP++EAFGNAKT RNDNSSRFGKYIDI+F   G+IEGAKI+Q+LLEKSRIV+QM DERNYHVFYCML GL  E +    ++ +  Y YL QGG     G  D+ +F  + SAMKVL ++++E  ++ ++LAA LHLGNI +KA +  N+D+ EV        A+KLL++ +  L  ALT K I TR + VVT ++    +++RDA VKG+YGR+F+ IV+KIN AI++P  S          +     SIGVLDIFGFENF  NSFEQ+CINYANENLQQFFVRHIFK+EQEEY  E I W HI F DNQE LD+I +K  NI+AL+DEES FP+G+D +LL+KL      +  +++ K+ +   FG+ HFAG+V Y   GFLEKNRD F+ DL++++Q+TK ++L  +F +DF MG +TRKR+PTLG QF+KSL+ LM+ L   +PFFVRC+KPNE K+ ++FDR LC RQLRYSGMMETIRIR+AGYPIRH F DFI+RYR+LV GI  P    CK    T   +CK++L    +Q+GKTK+FLKDAQD  LE  RD+ L+ +++ IQK  R +++R +F K KS+ + IQ + +    R ++  M++G+  LQA FR++  + +   L+G + N+QRHCRG + R   K++  ++I +QS +RK  A KK+   + +  K  EA  L+K++E   K QM+ +KA EEAE+ H+ RL +I  + + + + + ++    K++IA+AE RRR  PVD+S+M+DEIFG ID     S   S   AP AF+DLE  R  A+ D  +   ++MP  +    +ED+S++ F+KFAATYFQ +    + R+ L++ LL   N   Q++ALAVW+ ILRFM DLPEP  + + T   +  P+MTKIY +LGR+FNKQD+  A      +    +P    + R+ RK +VSLTLKKKSK T +V N L D +    T T ++LLE+RPTSNLEKLHFIIG+GIL P+LRDEIY QICKQL  NP   S +RG ILL+LC+GCFAP+EKFVR LR FI+      A +   RL+RTF+NGTRNQPPSWLEL+A K K+P++L +  M+GNT+T+ ADSA+TA+ELC  LS+KI L DQFGFSL+IA+ DKVSS+GSGGDHVMDAISQCEQ+AKE+G  E  A WRLFFRKEIF PWH+  +D VAT+LI+ QV+RGIKFGEYRC+ DDD+  + A Q  ID   DL  E L   L   I   + +  +   YW   +  A K       ++ +S  ++KE+IV +++ KWP+LFSRFYEA KF+GPSL  N+VI  +NWTG+Y+VD  E++ LELSFPEI AVSSSR        T ++HGQS +L+TVKG  +TF   N+EDIRDL+V FLEGLK+RS + I +Q +  P   SSFLS  KGDL+ L+  DN   + TS W YGE  RT   GDFPA+ VY+LP I+ PS +IL+              +  +  +   K HTLEE+S  +FR P   + S T+SL    ++    LW++++  ++ PLL+KLL KED+  +A +CF  IL YMGD PSK   S +++ + IF+P LKH+IL+DE+YCQ+I Q+T N N  SE+ GWEL+WL TG   P++NL +E+    RS S + +A++C  RLQKTL+ G R+YPPH +E+ A+Q     I HK+YFP++S +AFE+ S+T+ KD C NI  ++ LK  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP KDG   +F YQVFFMKKLWTNT+PG D+ AD +FHY QE+ K + GYHK   ++A+ L ALI R     D + L +  + L  L+P D++      E ++++ A Y         + KIAFLK++++WPTFGSAFFEVKQST    PE +LIAINK+GV LIH +TK+ L  +P++ ISNWSSGNTYF+MTIGNL+ G KLLCET LGYKMDDLLTSYISLMLTT+ K  +
Sbjct:    1 MVIVKKGDYVWIEPEVQGEFD--VAVGAVVKSADGTNICLVDDDKKEVWVKAGSRLKTMHPTSIEGVEDMIGLGDLNEAGILRNLFIRYFDNLIYTFTGSILVAVNPYQVLPIYTAEQIQAYKDKKIGQMPPHIFSIGDNSYHNMRRYEQDQCIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQILEANPVMEAFGNAKTTRNDNSSRFGKYIDIHFDKKGSIEGAKIEQYLLEKSRIVNQMPDERNYHVFYCMLAGLNAEEKKSLEIQTAQDYFYLIQGGSTTCDGRDDVKEFANIRSAMKVLMYSDEEIWDLMKILAAILHLGNITYKATMVENIDASEVVAKGCLQSAAKLLEVPANALNDALTKKTIFTRGESVVTMLNTDIAMDVRDAFVKGVYGRMFISIVDKINKAIFKPKPS----------AGHYRKSIGVLDIFGFENFTKNSFEQMCINYANENLQQFFVRHIFKLEQEEYNNEAISWSHIEFVDNQEALDMIAMKPMNIIALVDEESHFPRGSDATLLSKLHQKHGSNKNYLQPKSQMNMSFGLNHFAGIVFYDAKGFLEKNRDTFSVDLLQVVQSTKFKYLARIFREDFSMGTETRKRSPTLGAQFKKSLELLMRTLGACQPFFVRCVKPNETKQPMEFDRELCTRQLRYSGMMETIRIRRAGYPIRHTFSDFIERYRLLVSGIKPPHMEECKSASNT---ICKSVLGGADFQLGKTKVFLKDAQDAFLEQERDRVLTKKLVAIQKAVRGWHYRRKFRKMKSSCVAIQRYYKGYAERHRYENMRQGYMRLQALFRSRQLTHRFTALRGKMVNLQRHCRGFMDRQWYKRRLNSVIVLQSGVRKIIAQKKYTRARAEYRKRLEADRLRKEEEEKLKRQMNSKKAKEEAERLHRERLARIEQDVIEEEEAREQEAIYKKKQIADAEKRRREGPVDDSQMVDEIFGFID-----SQTESEQTAPSAFKDLEAQRQAAIRDGTADMDSSMPLPMPED-EEDISQYKFSKFAATYFQGNATHTYIRRVLKQSLLPLKNDGDQLAALAVWVTILRFMGDLPEPKYHTAMTDTRDKTPVMTKIYSTLGRKFNKQDLADAQRMGTDLEREPLPVNKKNARSMRKKLVSLTLKKKSKITTDVANKLKDGD---YTGTGNALLEDRPTSNLEKLHFIIGHGILRPDLRDEIYSQICKQLTQNPNKTSHARGWILLSLCVGCFAPSEKFVRYLRCFIKEGPPGYAPYCEERLRRTFANGTRNQPPSWLELQATKSKKPLMLPITFMDGNTKTLLADSATTAKELCQQLSEKIGLGDQFGFSLYIALFDKVSSLGSGGDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIFAPWHDPAEDNVATNLIFQQVVRGIKFGEYRCEKDDDLAMIAAQQYYIDYGPDLRIERLQSLLASYIPDQSLQANRALNYWTQGVVTAFKKSYFV--REQVSPLRVKEDIVNYSKYKWPLLFSRFYEAYKFAGPSLPKNDVIIAVNWTGVYVVDDQEQVLLELSFPEITAVSSSR--------TGKMHGQSFTLATVKGDEFTFTSPNAEDIRDLVVTFLEGLKKRSKFVIALQDYRAPSDGSSFLSFNKGDLITLD-QDNGEVVMTSGWCYGECSRTGRRGDFPAECVYVLPTISKPSPDILSAV------------TETSTTEPTEKPHTLEEYSYDHFRPPPKRTLSKTLSLSSARRRRQDELWRYTKDSIRQPLLRKLLGKEDMSHEACTCFLTILKYMGDHPSKRGRSGSDLTDQIFEPPLKHDILRDEIYCQIIKQLTDNRNRMSEERGWELMWLCTGAYAPSTNLLKEVTLFLRSRSRNQVAIDCLNRLQKTLRHGARKYPPHQVEVEAIQHKTTQIFHKVYFPDDSDEAFEVDSSTRAKDFCSNIAGRLNLKSSEGFSLFVKIADKVISVPEGDFFFDFVRHLTDWIKKARPAKDGMTPQFTYQVFFMKKLWTNTIPGKDKNADTIFHYHQELPKLIRGYHKCSPEEAVQLAALIFRVRYGDDKTNLPNIPKMLKDLVPADLIRAMNPDEWKKQISACYARDAGKKPEEGKIAFLKLLYKWPTFGSAFFEVKQSTETTFPEILLIAINKHGVNLIHPQTKDILATHPFTKISNWSSGNTYFHMTIGNLVRGSKLLCETSLGYKMDDLLTSYISLMLTTMNKQRT 2161          
BLAST of Dach-1 vs. TrEMBL
Match: A0A288XNW0 (Myosin VIIa OS=Leptochiton asellus OX=211853 PE=2 SV=1)

HSP 1 Score: 2234.53 bits (5789), Expect = 0.000e+0
Identity = 1163/2218 (52.43%), Postives = 1554/2218 (70.06%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKY--TSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSM------RTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHK----YLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPD----SSFLSCEKGDLLIL--ETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYGGGSNNNHNDSRGKQ----HTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGN-LWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYS-STEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKD-GQLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSS 6734
            MV+  KGD+VW+E +   +    V +GAK++     +I V+DDDG E  L      ++MH SS+ GV+DMI LGDLNEAGILRNL IRY  N IYTYTG ILVAVNPY +LPIYT ++I  Y++ KIG+L PHIFAIADN+Y +MRR  +DQ +IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQ+L++NPI+EAFGNAKTIRNDNSSRFGKYIDI+F   G+IEGAKI+Q+LLEKSRIV+Q  DERNYH+FYCM+ G+P E + +  L+A+  Y YL QGG I   G  D+ DF  + SAMKVL F E +  EI ++LAA LHLGNI + A    N+D+ E+   +E N A++LL++ + D+  ALTTK I T+ + VV+++S    +++RDA VKGIYGR+F+WIVEKIN+AIY+P            K++ ++  TSIGVLDIFGFENFD+NSFEQLCINYANENLQQFFV+HIFK+EQEEY  E I+W+HI F DNQ+ LDLI VK  NI+AL+DEES+FP+GTD+++L+KL     K+  +++ K+ +   FG+ HFAGVV Y  +GFLEKNRD F+ DL++LIQT++S++LK LF  D  MG DTRKRAPTLG QF+KSLD LMK L   +PFFVRCIKPNEFKK L FDR LC RQLRYSGMMETIRIR+AGYPIRH F DF+DRYRILV G+  S   ++ R  +  +C+ +L    +Q+GKTK+FLKDAQD+ LE  R++AL+ RI++IQK  R ++ R QFL+ K + + IQ+  R    R+++  M+ G+  LQA FR+++ +++   ++  I   Q+ CRG L R  ++++  AI+KIQS +R   A K+++ +K +  +  EA  L+K++E   K +M+ +KA EEAE+ H +RL  I  E + +A +  ++ +     I +A+ R++QPV++S+M+D+IFG ID       P +    P AF+DL    +      G+    ++P  L N   +D+SE+ F+KFAA YFQ      + R+ LR PLL   +   Q+++LAVWI ILRFM DLPEP  + S +   ++ P+MTKIY +LGR+FNK+D+  A +    +   +  +  ++      R+ RK +VSLTLKKKSK T+EV   L D   P    + ++LLE+RP SNLEKLHFIIGNGIL P+LRDEIYCQICKQL  NP   S +RG ILL+LC+GCFAP+EKFV+ LR FI       A +   RL+RTF+NGTRNQPPSWLEL+A K K+P++L +  M+GNT+T+ ADSA+TA+ELC  LS KI LKDQFGFSL+IA+ DKVSS+GSGGDHVMDAISQCEQ+AKE+G  E  A WRLFFRKEIF PWH+  +D +AT LIY QV+RG+ FGEYRC+ ++D+  + A Q  I+       E L      Y+P++ + M  +   YW     + V    + S    I + K+KE+IV++A+ +WP+LFSRFYEA KF+GPSL  N+VI  +NWTG+Y+VD  E++ LELSFPEI AVSSSR        T ++HGQS +L+TVKG  YTF   N+EDIRDL+V FLEGLK+RS + + +Q +S P+    SSFLS  KGDL+ L  +T +N   + TS W YG   RT++ GDFPA+ VY+LP I  P   IL LF     G+     S+    ++  +Q    HTLE++S  +FR P   + + T++  ++   N LW++S++ LK PLLKKL+ KE+L Q+A  CF AIL YMGD PSK    + E+ + IF+P L++EIL+DE+YCQ+I Q+T N    SE+ GWEL+WL TG   P++NL +E+    RS  + +A +C TRLQKTL+ G R+YPPH +E+ A+Q     I HK+YFP++S +AF++ S+T+ KD CQNI  K+ L   +GF+LFVK  DK IS+PEGDFFFDF+R L+DW++K +P +D G  +F YQVFFMKKLWTNTVPG D  AD++FHY QE+ K L GYH+   +DA  LGAL+ R     D + LQ+    L  LIP D++ +    + ++ ++A ++     ++ D K+ FLK+I+QWPTFGSAFFEVKQ+T  + PE +LIAINKNGV LIH ++K+ L  +P++ ISNWSSGNTYF+MTIGNL+ G KLLCET LGYKMDDLLTSYISLMLT + K  S
Sbjct:    1 MVILAKGDYVWLEPEKRGEFE--VALGAKVQFSDSGRIQVVDDDGKEHWLDQKKHFKNMHPSSIDGVEDMIGLGDLNEAGILRNLFIRYMDNMIYTYTGSILVAVNPYQILPIYTAEQITAYRDKKIGELPPHIFAIADNSYFSMRRYQQDQCVIISGESGAGKTESTKLILQFLAAISGQHSWIEQQILEANPIMEAFGNAKTIRNDNSSRFGKYIDIHFNQKGSIEGAKIEQYLLEKSRIVTQAHDERNYHIFYCMIAGMPDEDKKKLDLKAATEYYYLTQGGSIYAEGRDDVKDFSDIRSAMKVLMFAETDIWEIHKILAALLHLGNIRYNAIQVDNIDASEIQEVAEVNRAARLLEVRAGDMIDALTTKTIFTKGETVVSSLSHEGALDVRDAFVKGIYGRMFIWIVEKINSAIYQP------------KTDPRHFRTSIGVLDIFGFENFDHNSFEQLCINYANENLQQFFVQHIFKLEQEEYDNEGINWKHIEFVDNQDALDLIAVKPMNIIALVDEESKFPRGTDNTMLDKLHRNHGKNKNYLRPKSSMNTTFGLNHFAGVVFYDANGFLEKNRDTFSTDLIQLIQTSQSKYLKSLFTDDVTMGMDTRKRAPTLGAQFKKSLDLLMKTLGSCQPFFVRCIKPNEFKKPLLFDRELCCRQLRYSGMMETIRIRRAGYPIRHRFSDFVDRYRILVSGVKPS-HMEECRAASTRICREVLKDADFQMGKTKVFLKDAQDVYLEQQREQALARRILIIQKVVRGWHVRRQFLRIKKSTLTIQSTWRGFAQRKRYKMMRNGYMRLQALFRSRILTQRFISMRNKILQFQKRCRGYLVRRWVQKRMWAIVKIQSGVRAAIAKKQYRRMKIEYQRRMEAERLRKEEEEKLKKKMNSKKAKEEAERMHVVRLANIEKEKIEEAMRDKQETALKLDAIEQAQIRKDQPVNDSKMVDDIFGFIDS----EQPGADGAGPNAFKDL----LRHPQQNGTEVMASVP--LPNDDIDDLSEYKFSKFAAMYFQGSASHTYIRRSLRAPLLPLRSEGDQLASLAVWITILRFMGDLPEPKYHTSMSETRDTTPVMTKIYSTLGRRFNKKDLEDAQKMGMDLVGTLNEQEQNIPIRQGKRSMRKKLVSLTLKKKSKLTEEVTRKLQD---PEAFSSGNALLEDRPMSNLEKLHFIIGNGILRPDLRDEIYCQICKQLTQNPSKSSHARGWILLSLCVGCFAPSEKFVKYLRCFISEGPPGYAPYCEERLRRTFANGTRNQPPSWLELQATKSKKPLMLPITFMDGNTKTLLADSATTARELCQQLSDKIGLKDQFGFSLYIALFDKVSSLGSGGDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIFAPWHDPSEDSMATHLIYQQVVRGVTFGEYRCEQEEDLAMIAAQQYYIEYGATADVERLRSLLPTYIPESSVNM--KTLNYW----IQTVTKKLQNSGYFHIPAVKVKEDIVSYAKFRWPLLFSRFYEAYKFAGPSLPKNDVIIAVNWTGVYVVDDQEQVLLELSFPEITAVSSSR--------TGKMHGQSFTLATVKGDEYTFTSPNAEDIRDLVVTFLEGLKKRSKFVVALQDYSPPNTGEASSFLSFIKGDLITLDQQTGEN---VMTSGWCYGRCVRTEKSGDFPAECVYVLPTITKPPPEILNLFVHT--GEDRVQLSSQPITETSAEQTEKPHTLEDYSLDHFRPPPKQTLTKTLAPARRRKPNDLWRYSKEPLKQPLLKKLMGKEELGQEACFCFLAILKYMGDHPSKRIRVANELTDQIFEPPLRNEILRDEIYCQVIKQLTDNTTRLSEEKGWELMWLVTGCFAPSTNLLKEITLFLRSKKNPIAQDCLTRLQKTLRNGTRKYPPHQVEVEAIQHKTTQILHKVYFPDDSDEAFQVDSSTRAKDFCQNISDKLELNSAEGFSLFVKIADKVISVPEGDFFFDFVRHLTDWIRKAKPSRDGGPPQFTYQVFFMKKLWTNTVPGRDVNADLIFHYHQELPKLLRGYHQCTRQDAARLGALVYRVKFGDDKTNLQNIPRMLKELIPADMIRQQSPDDWKRAIVATFNQDAGKTNVDGKVEFLKMIYQWPTFGSAFFEVKQTTEPHYPEILLIAINKNGVNLIHPQSKDILATHPFTKISNWSSGNTYFHMTIGNLVRGSKLLCETSLGYKMDDLLTSYISLMLTNMNKQKS 2171          
BLAST of Dach-1 vs. Ensembl Cavefish
Match: myo7ab (unconventional myosin-VIIa-like [Source:NCBI gene;Acc:103035949])

HSP 1 Score: 2103.95 bits (5450), Expect = 0.000e+0
Identity = 1118/2211 (50.57%), Postives = 1508/2211 (68.20%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDP-KGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDI--LKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRID-NVKDLSDETLH---KYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVV---QAFSKPDSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILAL--FSDRSFGDSYGGGS-NNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRS-ASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSSN 6737
            ++V  +GD+VW++ K+  +    VP+GA +K     QI V+DD+GHE  + P   T I+ MH +S+ GV+DMI LGDLNEA ILRNL IRY+   IYTYTG ILVAVNPY +LPIYTP  I+ Y N KIG++ PHIF IADN Y NM+R ++DQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++NPILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q  DERNYH+FYCML G+  + +++ GL  +  Y YL  G      G  D+ ++ ++ SAMKVL FT+ E  EI +LLAA LH+GN+ F+A+  +++DSC V    +   A+ LL++D +D+   LTT+ +ITR + V T +S+ QG+++R+A VKGIYGRLFVWIVEKIN AIYR          L+ + N    SIG+LDIFGFENF+ NSFEQLCIN+ANENLQQFFVRH+FK+EQEEY  E I+WQHI FTDNQ+ LD+I +K  NI++LIDEES+FPKGTD ++L+KL +       +I  K      FGI+HFAGVV Y+  GFLEKNRD  ++D+++L+ ++K++F+K +F+ D  MG +TRKR+PTL  QF++SLD LM+ L   +PFFVRCIKPNE KK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F+DRYR+L+PG+  + + +D R T + +  ++L   + ++IG+TK+FLKD  D+ LE  RDKA+++++ILIQK  R    R  FLK +SA I IQT  R  + R+ +  M+ GF  LQA  R++      +D +  I  +Q  CR  L R     +  AI  IQ+  R   A ++ K L+ +  +  EA   +  +E   +N M+  +A  EAE++H+ RL Q+  E     + + ++    K+ + + E+ R +PV +S+M+D++FG +      S+PN    AP  F DLE    +  +D        +P  L N   ED+SE+ F KFAATYFQ +    + R+PL++PLLFH +   Q++ALAVW+ +LRFM D+PEP    S +  +  +P+MTKIY++LG++  K+++  L+  EE+  +      ++    + R  +VSLTLKKKSK T+EV   L +++  L     +S+LE+RPTSNLEKLHFIIGNGIL P +RDEIYCQICKQL  NP   S +RG ILL+LC+GCFAP+EKFV+ LR FI +     A +   RL+RTF N TR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ L+ KI LKD+FGFSL+IA+ DKVSS+GSG DHVMDA+SQCEQ+AKE+G  E  A WRLFFRKEIFTPWHN  +D VAT+L+Y Q++RG+KFGEYRCD ++D+ +L + Q  I+   + L D  L     Y+P   I  ++   K W  ++    K    T ++     +++KEE+V FAR KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ LELSFPEI AVSSSR          +L G S +L+T+KG  YTF   N+EDIR+L+V FL+GL++RS + + +      +  DSSFLS  KGDL++L+ +     + TS W +G N RTK+ GDFPAD VY+LP I  P  +I+AL   S     DS      N   ++ + K +TLEEFS  +FR P   + S  M    +    LW  SR+ LK PLLKK+LN E+LCQ+A        +YMGD PSK   S  E+ + IF+  LK E LKDE++CQ++ Q+T N    SE+ GWEL+WL TG+  P++NL   + +  +S     LA +C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD C NI  ++ LK  +GF+LFVK  DK IS+P+GDFFFDF+R L+DW+KK+RPVKD  L    +V+FMKKLWTNTVPG D +AD +FHY QE+ KYL GYHK   ++   L ALI RA  ++D S+  +  + L  L+P D + +    + ++ +++ ++     +  +AK+ FLKI+++WPTFGSAFFEVKQST+ N PE +LIAINK+GV LI  KTK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLTT+TK  S+
Sbjct:    1 LLVFLQGDYVWLDPKTGHEFD--VPLGAVVKRCDSGQIQVLDDEGHEHWISPQNATNIKPMHPTSIHGVEDMIQLGDLNEACILRNLFIRYRDRVIYTYTGSILVAVNPYQLLPIYTPDHIRLYSNRKIGEMPPHIFGIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNRRGAIEGAKIEQYLLEKSRVCRQAPDERNYHIFYCMLRGMSSDQKTKLGLGLATDYNYLTMGNCTVCDGRDDMKEYSSILSAMKVLMFTDTENWEISKLLAAILHMGNLRFEARTFKHLDSCVVVRSPDLAKAATLLEVDPQDVMTCLTTRTLITRGESVSTPLSVDQGLDVRNAFVKGIYGRLFVWIVEKINAAIYR---------TLSNQDNDIPRSIGLLDIFGFENFNINSFEQLCINFANENLQQFFVRHVFKLEQEEYNLERINWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDATMLSKLNSQHKLSINYIPPKNSHETHFGIQHFAGVVQYETKGFLEKNRDSLHSDIIQLVHSSKNKFIKQIFQADVAMGVETRKRSPTLSSQFKRSLDLLMRTLSVCQPFFVRCIKPNELKKPMLFDRGLCVRQLRYSGMMETIRIRRAGYPIRYTFAEFVDRYRVLMPGVKPAHKQEDHRGTCQRIAVSVLGRNEDWKIGRTKIFLKDHHDVQLEIERDKAITDKVILIQKAVRGMKDRANFLKARSAVIVIQTMWRGFICRKNYRVMRTGFLRLQALCRSRKHYLAYRDSRTRIIQLQARCRAFLIRRTFCTRLNAICTIQAYARGMIARRRCKHLRLERERRLEAERQRLAEEERLRNLMTARRARAEAERKHQERLAQLALEQEERERAEREEARRKKELLEQMEQARQEPVSDSDMVDKMFGFLGS---TSLPNLEGDAPAGFEDLEYVSKDYEDDS---IDEALP--LPNEEQEDLSEYKFAKFAATYFQGNTTHTYVRRPLKQPLLFHEDEGDQLAALAVWVTVLRFMGDMPEPKYQISISDGSEKIPVMTKIYETLGKRTYKRELQALQGDEESSII------DSQKRNSVRHKLVSLTLKKKSKITEEVTRRLTESDYSLQG---NSMLEDRPTSNLEKLHFIIGNGILRPAVRDEIYCQICKQLTQNPSKSSHARGWILLSLCVGCFAPSEKFVKYLRTFINSGPPGYAPYCEERLRRTFVNKTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAKELCNALADKIGLKDRFGFSLYIALFDKVSSLGSGKDHVMDAVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHNPAEDSVATNLVYQQIVRGVKFGEYRCDGEEDLAELASQQYYIEYGCEILQDRLLSLIPSYIPDREISSSRTMDK-WAQVIMTTHKKGIYTQKR--FDPQRVKEEVVDFARFKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEITAVSSSR--------GGKLQGHSFTLATIKGDEYTFTSNNAEDIRELVVNFLDGLRKRSKFVVALVDSHNMAGHDSSFLSFSKGDLILLDEHTG-EHVLTSGWAHGVNDRTKKRGDFPADSVYVLPTITRPQYDIVALVTMSPDQRKDSISLSQLNMVESEEKVKPYTLEEFSVDHFRPPPKSTLSRVMISKGRGKDKLWCCSREPLKQPLLKKVLNNEELCQEAC-------LYMGDYPSKRTRSVNELTDQIFEGPLKAEPLKDEIFCQIMKQLTENHVKFSEEKGWELLWLCTGLFPPSNNLLPHVQKFLQSRKHHPLAPDCMQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCLNISGRMLLKSSEGFSLFVKISDKVISVPDGDFFFDFVRHLTDWIKKNRPVKDVYLP-ERKVYFMKKLWTNTVPGKDSMADSIFHYYQELPKYLRGYHKCPHEEVFQLAALIYRAKFEEDKSQFINISKILKELVPQDQIRQLSPDDWKRSIVSCFNKHAGKTREEAKLMFLKIVYKWPTFGSAFFEVKQSTDPNFPEVLLIAINKHGVSLIDPKTKDILMTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTTMTKQRSS 2163          
BLAST of Dach-1 vs. Ensembl Cavefish
Match: myo7aa (myosin VIIAa [Source:ZFIN;Acc:ZDB-GENE-020709-1])

HSP 1 Score: 2098.17 bits (5435), Expect = 0.000e+0
Identity = 1110/2168 (51.20%), Postives = 1480/2168 (68.27%), Query Frame = 3
Query:  231 PIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILD-PKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKN-----IVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILI--YMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSAS-SLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPL 6662
            P+GA +K     QI V+DD+G+E  + P   T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+ + IYTYTG ILVAVNPY +LPIYT  +I+ Y N KIG++ PHIFAIADN Y NM+R ++DQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++NPILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q RDERNYH+FYCML+G+  + + + GL  +  Y YL  G      G  D  ++  + SAMKVL FT+ E  EI +LLA+ LH+GN++++A+   N+D+CEV   ++   ASKLL++DS+DL   LT++ +ITR + V T +S+ Q +++RDA VKGIYGRLFVWIVEKIN AI++P       ++ + K+  +  SIG+LDIFGFENF  NSFEQLCIN+ANENLQQFFVRH+FK+EQEEY  E I+WQHI FTDNQ+ LD+I +K  NI++LIDEES+FPKGTD ++LNKL +    +  +I  K +    FGI+HFAG+V+Y+  GFLEKNRD  + D+++L+ ++K++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNE+KK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F+DRYR+L+PG+  +++ +D R T + + + +L     +Q+GKTK+FLKD  D+LLE  RDKA+++++ILIQK  R +  R+ FLK K AA+ IQ   R    R+ +  M+ GF  LQA +R++   +     +  I   Q  CRG L R   + +  A+I IQ+  R   A + +K LK +  +  EA  ++  +E   +NQMS ++A  EAE++H+ RL Q+  E     +++ ++    K+ + + E+ R +PV++S+M+D++FG +   +  S P     AP  F DLE ++     +        +P  L    +ED+SE+ F KFAATYFQ      + R+PL++PLLFH +   Q++ALAVWI +LRFM DLPEP  + + +  +  +P+MTKIY++LG++  K+++     E          EN  + +++KN     +VSLTLKKKSK T+EV   LND E  ++    +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQICKQL  NP   S +RG IL++LC+GCFAP+EKFV+ LRNFI       A +   RL+RTF NGTR QPPSWLEL+A K K+PI+L V  M+G T+T+  DSA+TA+ELC+ LS KI L+D+FGFSL+IA+ DKVSS+GSG DHVMDA+SQCEQ+AKE+G  E  A WRLFFRKEIFTPWH+  +D VAT+LIY Q++RG+KFGEYRCD  DD+ +L + Q  +D   ++  E L      Y+P   I   K  +K W   +  A K    T ++  +  +K+KEE+V FAR KWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ LELSFPEI AVSSSR          +L GQS +L+TVK   YTF   N+EDIRDL+V FLEGL++RS + + +Q    P   DS+FLS  KGDL++L+  D    +  S W +G N RTK+ GDFPAD VY+LP I  P  +++AL +   D+              +  R K +TLEEFS  YFR P   + S  M    +    LW  +R+ +K  LLKK+L  E+L Q+A   F  IL+  YMGD PSK   S  E+ + IF+  LK E LKDE+Y Q++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     LAL+C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD C NI  ++ LK   GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP KDG +    YQVFFMKKLWTNTVPG D  AD +FHY QE+ KYL GYHK    +   L ALI R   + D S   S  + L  LIP D++ +    + ++ V+A ++     S  +AK+ FLKIIF+WPTFGSAFFEVKQ+T  N PE +LIAINK+GV LI  KTK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET L
Sbjct:    1 PVGAVVKLCDSGQIQVLDDEGNEHWISPQNATNIKPMHPTSIHGVEDMIRLGDLNEAGILRNLLIRYREHLIYTYTGSILVAVNPYQLLPIYTADQIRLYTNKKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQARDERNYHIFYCMLKGMTSDQKKKLGLGKATDYTYLTIGNCTVCDGRDDQKEYSNIRSAMKVLMFTDTENWEISKLLASILHMGNLHYEARTYDNLDACEVVRCADLTTASKLLEVDSKDLMNCLTSRTLITRGETVSTPLSMEQALDVRDAFVKGIYGRLFVWIVEKINAAIFKP-------TSHDLKAVRR--SIGLLDIFGFENFTVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLENINWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDTTMLNKLNSQHKLNTNYIPPKNNYETQFGIQHFAGIVYYETRGFLEKNRDTLHGDIIQLVHSSKNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMMETIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQEDLRGTCQRIAEAVLGRDDDWQMGKTKIFLKDHHDMLLEIERDKAITDKVILIQKVVRGFKDRSNFLKMKRAALTIQKTWRGYHCRKNYDAMRAGFSRLQALYRSRKLYQTYHVARQRITLFQARCRGCLVRRAFRHRLWAVITIQAYTRGMIARRLYKRLKGEYRRRLEAEKMRLAEEEKLRNQMSAKRAKAEAERKHQERLAQLAKEDAEREKKEKEEARKKKEMLDQMEKARQEPVNDSDMVDKMFGFLG--TTNSFPGQEGQAPAGFEDLERTKRELEEEDLD---EALP--LPEEDEEDLSEYKFAKFAATYFQGTSTHTYMRRPLKQPLLFHEDEGDQLAALAVWITVLRFMGDLPEPKYHTAISDGSEKIPVMTKIYETLGKKTYKRELQALQGEG---------ENAHIDSHKKNSVRHKLVSLTLKKKSKITEEVTKRLNDGEYTVHG---NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQICKQLNQNPSKSSHARGWILMSLCVGCFAPSEKFVKYLRNFISEGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAKELCNALSDKITLRDRFGFSLYIALFDKVSSLGSGSDHVMDAVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHDPTEDGVATNLIYQQIVRGVKFGEYRCDR-DDLSELASQQYYVDYGSEILVERLLSLIPSYIPDREISSAKTVEK-WAHFIMAAHKKGVYTQKR--VDPQKVKEEVVDFARYKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEITAVSSSR--------GGKLQGQSFTLATVKADEYTFTSNNAEDIRDLVVTFLEGLRKRSKFVVALQDNPSPVGDDSTFLSFIKGDLILLD-QDTGEQVLNSGWAHGINERTKQRGDFPADCVYVLPTITRPQPDVVALVTMTPDQRQESIRVAHVPLPESVERVKPYTLEEFSYDYFRPPPKHTLSRVMITKNRGKDKLWCCTREPIKQALLKKVLAHEELSQEACMAFIDILLHYYMGDYPSKRTRSVNELTDQIFEGALKAEPLKDEIYSQILKQLTENHVKYSEEKGWELLWLCTGLFPPSNVLLPHVQRFLQSKKHHPLALDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCLNISGRLLLKSPDGFSLFVKISDKVISVPEGDFFFDFVRHLTDWIKKARPAKDGIVPSLTYQVFFMKKLWTNTVPGKDSFADSIFHYYQELPKYLRGYHKCSRDEVFQLAALIYRVKFEDDKSYFPSIPKMLKELIPQDLIRQLSPDDWKRSVVAYFNKHAGKSREEAKLLFLKIIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKHGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSL 2127          
BLAST of Dach-1 vs. Ensembl Cavefish
Match: si:ch73-194h10.2 (si:ch73-194h10.2 [Source:ZFIN;Acc:ZDB-GENE-100921-21])

HSP 1 Score: 1741.86 bits (4510), Expect = 0.000e+0
Identity = 963/2234 (43.11%), Postives = 1370/2234 (61.32%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDF----------------------KMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKG-YQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKD-ENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILK--AAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTD--------EVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIG-NGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKK--KYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPDS-SFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPS-QNILALFSDRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHS----RQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYREL---LEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKD-GQLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLT 6713
            MVV +KGD+VW++      +S  VPIGA++      Q+ +IDD+G   I K  T ++ MH +S+ GVDDMI LGDLNEAG+LRNLL+R++   IYTYTG ILVAVNPY +LPIYTP++++ Y + ++G+L PH+FAIAD+ + NMRR  +DQ  +ISGESGAGKTESTKLILQFLAAVSGQ SWIEQQ+L++NPILEAFGNAKTIRNDNSSRFGKYIDI+F   G+IEGA+I+Q+LLEKSR+  Q ++ERNYH+FY ML G+P E +    L ++  Y YL  G      G  DI ++    SAMK+LTF+E++  EI +LLAA LHLGN++F+A +  N++ C++   + FN A++LL++ + +L  +LT ++ +T  + V   ++  Q +  RDA VKGIYGRLF+WIVEKIN+AIY+P               S   SIG+LDIFGFENF  NSFEQLCIN+ANE LQQFFV+H+FK+EQEEYA E I W HI ++DNQ TLD++ V++ NIL+LIDEES FPKGTD +LLNKL  T SK   +I  K D    FGI+HFAG V Y   GFLEKNRD  + DL+ L++T+ ++ LK +F  +                       +M  D++KR  TL  QFR SLD+LMK L   +P+F+RCIKPN+FKK + FDR LC+RQLRYSGMMETIRIRKAGYPIRH F +F+DRYR+L+       + +  ++ ++ +C+N    +  ++IGKTK+F KD  D +LE  RDKAL+ + ++IQK  R + HR QFLK++SAA+ +Q + R     RK  +++ GF  LQA+ R++  +++ +  +     +Q    G   R   ++K  A I +Q+ IR   AL                  LK K    + K+Q         +  +  + L +   E +A  ++Q K    ++Q+       +++ + + EM+D IFG +       V      AP  F +++L     + D+         DY      +D+ E++F+KFA+ YFQ    P   R  LR+PLL+H + +  +++L VW  ILRFM DLPEP        +   +P         G  F ++ + K  A+ +  ++++ +  + +S            LKK S FTD          ++     E  +      +L  +RP ++LEKLH I+G  G+L   LRDEIYCQICKQL +N    S  RG ILL+LC+G F PTE+F + L++FI+      A +   RL+RT +NG R +PPSWLEL+A K K+P+ ++V  M+G T ++  DSAST++E+C +LSQKI L+D FGFSL++A+ DKV S+GSG +HVMDAISQCEQ  K KG  E  A WRL+FRKEIFTPWH+   D V+T+LIY QVIRG+KFGEY+C+ +DD+ KL      +    D S E     +   I     E K    W+ ++N A       + K+   + ++K E+V +AR KWPM FSRF+E I+ SGP L  N+ I  INWTGI  +D  ER  LELS+P +  V           NT R   QS+ L T+K G++  N     DI DL+  FL GL ERS YA+ +Q  ++ D  +FLS +KG+L++L  +D+     +  W  G+N RT + G  P + + ILP ++ P+ +++++L  D+    +    +       R    TL+E+S  YFR            L    +  LW HS    RQ     LL    +    C    +  + IL YMGD P++   +  E+ + IF P  ++E L+DE+YCQ+I Q+TSN N  S + GW+L+WL  G+  P+++L + +   LE  R  +  LA +C  RLQ  L+   R+ PPH +E++A+Q     I HKI+FPN++ + FE+++ TK +DL ++I + + L    GF+LFVK+ DK +S+ E D+ FD +RQ++DW K  +  KD G +  +Y VFFMKKLW N VPG D  AD +FH+PQE+ KYL GYH+   +D + LGAL+ R   D D ++     + L  L+P D L      + ++ + A Y+    ++  +A ++FLK++F+WPTFG AFFEVKQ+++ N P+ + IAI+K GV +IH KTK+ L  +P + I++W SG+TYF+MT+GNLI G K+LCET LGYKMDDLLTSY ++ L+
Sbjct:    1 MVVLRKGDYVWVD------SSIGVPIGAEVTISKTGQLQLIDDEGKVTISKDVT-LKSMHPTSVSGVDDMIRLGDLNEAGLLRNLLVRHRDGIIYTYTGSILVAVNPYQLLPIYTPEQVQLYTDRRLGELPPHVFAIADSCFFNMRRNRKDQCCVISGESGAGKTESTKLILQFLAAVSGQRSWIEQQILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFSKGGSIEGARIEQYLLEKSRVCRQAQEERNYHIFYYMLMGMPAEQKKILSLGSAAEYNYLTMGKCTSCEGRDDIQEYAHFRSAMKILTFSENDSWEIHKLLAAILHLGNLDFEATISNNLEGCDILSSNHFNMAAQLLEVKALEL--SLTQRSFMTNRESVSKPLTSEQALGGRDAFVKGIYGRLFIWIVEKINSAIYKPP-----------AEGSTCQSIGLLDIFGFENFKQNSFEQLCINFANEQLQQFFVKHVFKLEQEEYARENIVWTHIEYSDNQRTLDILAVRSLNILSLIDEESHFPKGTDSTLLNKLDKTHSKSTIYISPKNDHDTKFGIQHFAGPVFYDSKGFLEKNRDALSLDLILLVETSTNKLLKKIFHSELSTNDTKGRGNSKMVITPQNSLRQMTNDSKKRVLTLCGQFRLSLDALMKTLTACQPYFIRCIKPNDFKKPMLFDRELCMRQLRYSGMMETIRIRKAGYPIRHTFQEFLDRYRVLLNSTVCDPKTESAKKCSESICQNTFSAEDDWKIGKTKVFFKDFHDTMLELKRDKALNEKALIIQKVLRGHKHRKQFLKQRSAAVVVQKYWRGH-KGRKLYRVQLGFARLQATVRSRQITRQYELERKAALLLQTQIHGYFARKEWRRKRDAAILLQAHIRGMNALTV---------------CLKLKGFSTLCKSQY---LTQGSSGLQAFLSLQERRAEELAALERQKKLEEVLRQKKEREAAEQSESITDQEMVDTIFGFLPSL----VGGQEGQAPTGFEEVDLDDAPMMEDLPE------EDY------DDLDEYSFSKFASMYFQGAATPTHIRHRLRQPLLYHEDESDVVASLTVWWIILRFMGDLPEP--------RPQRIP-------RSGMGFAERSLQKDVASRQDRRLSHMVGLDQVS------------LKKSSTFTDLLTRNRKISTISEEGPEEEEMMLGEGPTL--DRPLTSLEKLHIIVGYTGLLF--LRDEIYCQICKQLQENGNRSSFFRGWILLSLCLGIFPPTERFSKYLQSFIRLGPAGYAPYCAERLRRTVANGVRAEPPSWLELQATKTKKPMAMSVTLMDGRTISLPVDSASTSKEVCQMLSQKIKLQDTFGFSLYVALYDKVWSLGSGREHVMDAISQCEQEVKRKGGKEQHAPWRLYFRKEIFTPWHDCSQDSVSTELIYRQVIRGLKFGEYQCEREDDVVKLAMKHFFVQYGSDSSMENTKTVVQDCINSKLLEAKSESKWVQMINTAHLEGPYINSKN--RAAEVKAEVVDYARQKWPMFFSRFFEVIRTSGPPLPKNKFIMAINWTGITFLDERERKLLELSYPMVTGV-----------NTVREGKQSVCLRTLK-GDFMLNAVMGGDIVDLVALFLAGLAERSLYAVALQEVNRQDDPTFLSFKKGELILLIKDDDFS--PSRGWLKGQNERTGQKGAVPTETILILPTLSKPTNESLISLSPDQR--KTIINNTLRGTAAERVAPATLKEYSIEYFRYLQ------ISYLNPLPSTRLWAHSREPIRQPFLKRLLGNPEHLSSGCNSLTALCAPILKYMGDYPTRQIQNPLELTDQIFGPAAQNEALRDEIYCQIIKQMTSNNNRYSMEQGWQLLWLCCGLFPPSTSLMKHIQRFLETRRRET--LASDCLLRLQGALRTEPRKLPPHQVEVDAIQQNSTQIFHKIHFPNDTEEIFEVSTTTKVRDLVRSIATNLRLMTEDGFSLFVKTPDKVLSLNETDYIFDSLRQITDWSKTTKMAKDGGPVNVSYMVFFMKKLWINVVPGRDLEADRIFHFPQELPKYLRGYHRCTKEDLVQLGALLFRVKVDNDKTQFPMIPKMLKELVPNDQLKAMSADDWKKSIFAAYNKQAGLTVEEAMVSFLKVVFKWPTFGCAFFEVKQTSDPNFPDIVRIAISKQGVTIIHPKTKDVLATHPLNKIASWCSGSTYFHMTVGNLIKGNKILCETSLGYKMDDLLTSYANMYLS 2122          
BLAST of Dach-1 vs. Ensembl Cavefish
Match: si:ch73-194h10.2 (si:ch73-194h10.2 [Source:ZFIN;Acc:ZDB-GENE-100921-21])

HSP 1 Score: 1721.06 bits (4456), Expect = 0.000e+0
Identity = 950/2162 (43.94%), Postives = 1330/2162 (61.52%), Query Frame = 3
Query:  267 QITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKK--KYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPDS-SFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYGGGSNNNHNDS---RGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGN-LWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYREL---LEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKD-GQLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLT 6713
            Q+ +IDD+G E  +K    ++ MH +S+ GVDDMI LGDLNEAG+LRNLL+R++   IYTYTG ILVAVNPY +LPIYTP++++ Y + ++G+L PH+FAIAD+ + NMRR  +DQ  +ISGESGAGKTESTKLILQFLAAVSGQ SWIEQQ+L++NPILEAFGNAKTIRNDNSSRFGKYIDI+F   G+IEGA+I+Q+LLEKSR+  Q ++ERNYH+FY ML G+P E +    L ++  Y YL  G      G  DI ++    SAMK+LTF+E++  EI +LLAA LHLGN++F+A +  N++ C++   + FN A++LL++D++ L  +LT ++ +T  + V   ++  Q +  RDA VKGIYGRLF+WIVEKIN+AIY+P               S   SIG+LDIFGFENF  NSFEQLCIN+ANE LQQFFV+H+FK+EQEEYA E I W HI ++DNQ TLD++ V++ NIL+LIDEES FPKGTD +LLNKL  T SK   +I  K D    FGI+HFAG V Y   GFLEKNRD  + DL+ L++T+ ++ LK +F  +     DT+ R  TL  QFR SLD+LMK L   +P+F+RCIKPN+FKK + FDR LC+RQLRYSGMMETIRIRKAGYPIRH F +F+DRYR+L+    +S  C D +      C+ + +   ++IGKTK+F KD  D +LE  RDKAL+ + ++IQK  R + HR QFLK++SAA+ +Q + R    R+ +   + GF  LQA+ R++  +++ +  +     +Q    G   R   ++K  A I +Q+ IR   A +                   K    + K+Q         +  +  + L +   E +A  ++Q K    ++Q+       +++ + + EM+D IFG +       V      AP  F DLE  R  AL +V       M D      D D+ E++F+KFA+ YFQ    P   R  LR+PLL+H + +  +++L VW  ILRFM DLPEP        +   +P                             +GM +   S+   +K++ S          D  ++H+      L+  +L S   +R  S    L F          LRDEIYCQICKQL +N    S  RG ILL+LC+G F PTE+F + L++FI+      A +   RL+RT +NG R +PPSWLEL+A K K+P+ ++V  M+G T ++  DSAST++E+C +LSQKI L+D FGFSL++A+ DKV S+GSG +HVMDAISQCEQ  K KG  E  A WRL+FRKEIFTPWH+   D V+T+LIY QVIRG+KFGEY+C+  DD+ KL      +    D S E     +   I     E K    W+ ++N A       + K+   + ++K E+V +AR KWPM FSRF+E I+ SGP L  N+ I  INWTGI  +D  ER  LELS+P +  V           NT R   QS+ L T+K G++  N     DI DL+  FL GL ERS YA+ +Q  ++ D  +FLS +KG+L++L  +D+     +  W  G+N RT + G  P + + ILP ++ P+  +L+L S     D      NN    +   R    TL+E+S  YFR P+       +S  K VA   LW HSR+ ++ P LK+L      C    +  + IL YMGD P++   +  E+ + IF P  ++E L+DE+YCQ+I Q+TSN N  S + GW+L+WL  G+  P+++L + +   LE  R  +  LA +C  RLQ  L+   R+ PPH +E++A+Q     I HKI+FPN++ + FE+++ TK +DL ++I + + L    GF+LFVK+ DK +S+ E D+ FD +RQ++DW K  +  KD G +  +Y VFFMKKLW N VPG D  AD +FH+PQE+ KYL GYH+   +D + LGAL+ R   D D ++     + L  L+P D L      + ++ + A Y+    ++  +A ++FLK++F+WPTFG AFFEVKQ+++ N P+ + IAI+K GV +IH KTK+ L  +P + I++W SG+TYF+MT+GNLI G K+LCET LGYKMDDLLTSY ++ L+
Sbjct:    8 QLQLIDDEGKEHKIKKDVTLKSMHPTSVSGVDDMIRLGDLNEAGLLRNLLVRHRDGIIYTYTGSILVAVNPYQLLPIYTPEQVQLYTDRRLGELPPHVFAIADSCFFNMRRNRKDQCCVISGESGAGKTESTKLILQFLAAVSGQRSWIEQQILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFSKGGSIEGARIEQYLLEKSRVCRQAQEERNYHIFYYMLMGMPAEQKKILSLGSAAEYNYLTMGKCTSCEGRDDIQEYAHFRSAMKILTFSENDSWEIHKLLAAILHLGNLDFEATISNNLEGCDILSSNHFNMAAQLLEVDTKALELSLTQRSFMTNRESVSKPLTSEQALGGRDAFVKGIYGRLFIWIVEKINSAIYKP-----------PAEGSTCQSIGLLDIFGFENFKQNSFEQLCINFANEQLQQFFVKHVFKLEQEEYARENIVWTHIEYSDNQRTLDILAVRSLNILSLIDEESHFPKGTDSTLLNKLDKTHSKSTIYISPKNDHDTKFGIQHFAGPVFYDSKGFLEKNRDALSLDLILLVETSTNKLLKKIFHSELSTN-DTKGRVLTLCGQFRLSLDALMKTLTACQPYFIRCIKPNDFKKPMLFDRELCMRQLRYSGMMETIRIRKAGYPIRHTFQEFLDRYRVLL----NSTVC-DPKTVRTNTCQEVAE-DDWKIGKTKVFFKDFHDTMLELKRDKALNEKALIIQKVLRGHKHRKQFLKQRSAAVVVQKYWRGHKGRKLY---RLGFARLQATVRSRQITRQYELERKAALLLQTQIHGYFARKEWRRKRDAAILLQAHIRGMNARRL------------------KGFSTLCKSQY---LTQGSSGLQAFLSLQERRAEELAALERQKKLEEVLRQKKEREAAEQSESITDQEMVDTIFGFLPSL----VGGQEGQAPTGFEDLE-GRWTALEEVDLDDAPMMEDLPEEDYD-DLDEYSFSKFASMYFQGAATPTHIRHRLRQPLLYHEDESDVVASLTVWWIILRFMGDLPEP--------RPQRIP----------------------------RSGMGFAERSL---QKDVASR--------QDRRLSHMVG----LDQVSLKSTWRQRGCSRETGLLF----------LRDEIYCQICKQLQENGNRSSFFRGWILLSLCLGIFPPTERFSKYLQSFIRLGPAGYAPYCAERLRRTVANGVRAEPPSWLELQATKTKKPMAMSVTLMDGRTISLPVDSASTSKEVCQMLSQKIKLQDTFGFSLYVALYDKVWSLGSGREHVMDAISQCEQEVKRKGGKEQHAPWRLYFRKEIFTPWHDCSQDSVSTELIYRQVIRGLKFGEYQCER-DDVVKLAMKHFFVQYGSDSSMENTKTVVQDCINSKLLEAKSESKWVQMINTAHLEGPYINSKN--RAAEVKAEVVDYARQKWPMFFSRFFEVIRTSGPPLPKNKFIMAINWTGITFLDERERKLLELSYPMVTGV-----------NTVREGKQSVCLRTLK-GDFMLNAVMGGDIVDLVALFLAGLAERSLYAVALQEVNRQDDPTFLSFKKGELILLIKDDDFS--PSRGWLKGQNERTGQKGAVPTETILILPTLSKPTNEVLSLISLSP--DQRKTIINNTLRGTAAERVAPATLKEYSIEYFRPPTKDVNRQVIS--KNVAPERLWAHSREPIRQPFLKRLG-----CNSLTALCAPILKYMGDYPTRQIQNPLELTDQIFGPAAQNEALRDEIYCQIIKQMTSNNNRYSMEQGWQLLWLCCGLFPPSTSLMKHIQRFLETRRRET--LASDCLLRLQGALRTEPRKLPPHQVEVDAIQQNSTQIFHKIHFPNDTEEIFEVSTTTKVRDLVRSIATNLRLMTEDGFSLFVKTPDKVLSLNETDYIFDSLRQITDWSKTTKMAKDGGPVNVSYMVFFMKKLWINVVPGRDLEADRIFHFPQELPKYLRGYHRCTKEDLVQLGALLFRVKVDNDKTQFPMIPKMLKELVPNDQLKAMSADDWKKSIFAAYNKQAGLTVEEAMVSFLKVVFKWPTFGCAFFEVKQTSDPNFPDIVRIAISKQGVTIIHPKTKDVLATHPLNKIASWCSGSTYFHMTVGNLIKGNKILCETSLGYKMDDLLTSYANMYLS 2032          
BLAST of Dach-1 vs. Ensembl Cavefish
Match: si:ch73-194h10.2 (si:ch73-194h10.2 [Source:ZFIN;Acc:ZDB-GENE-100921-21])

HSP 1 Score: 1682.54 bits (4356), Expect = 0.000e+0
Identity = 937/2166 (43.26%), Postives = 1302/2166 (60.11%), Query Frame = 3
Query:  267 QITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKK--KYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPDS-SFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYGGGSNNNHNDS---RGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGN-LWQHS----RQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYREL---LEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKD-GQLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLT 6713
            Q+ +IDD+G E  +K    ++ MH +S+ GVDDMI LGDLNEAG+LRNLL+R++   IYTYTG ILVAVNPY +LPIYTP++++ Y + ++G+L PH+FAIAD+ + NMRR  +DQ  +ISGESGAGKTESTKLILQFLAAVSGQ SWIEQQ+L++NPILEAFGNAKTIRNDNSSRFGKYIDI+F   G+IEGA+I+Q+LLEKSR+  Q ++ERNYH+FY ML G+P E +    L ++  Y YL  G      G  DI ++    SAMK+LTF+E++  EI +LLAA LHLGN++F+ +                                 LT ++ +T  + V   ++  Q +  RDA VKGIYGRLF+WIVEKIN+AIY+P               S   SIG+LDIFGFENF  NSFEQLCIN+ANE LQQFFV+H+FK+EQEEYA E I W HI ++DNQ TLD++ V++ NIL+LIDEES FPKGTD +LLNKL  T SK   +I  K D    FGI+HFAG V Y   GFLEKNRD  + DL+ L++T+ ++ LK +F  +     DT+ R  TL  QFR SLD+LMK L   +P+F+RCIKPN+FKK + FDR LC+RQLRYSGMMETIRIRKAGYPIRH F +F+DRYR+L+    +S  C D +      C+ + +   ++IGKTK+F KD  D +LE  RDKAL+ + ++IQK  R + HR QFLK++SAA+ +Q + R    R+ +   + GF  LQA+ R++  +++ +  +     +Q    G   R   ++K  A I +Q+ IR                           +   +  Q S       +  +  + L +   E +A  ++Q K    ++Q+       +++ + + EM+D IFG +       V      AP  F DLE  R  AL +V       M D      D D+ E++F+KFA+ YFQ    P   R  LR+PLL+H + +  +++L VW  ILRFM DLPEP        +   +P                             +GM +   S+   +K++ S          D  ++H+      L+  +L S   +R  S    L F          LRDEIYCQICKQL +N    S  RG ILL+LC+G F PTE+F + L++FI+      A +   RL+RT +NG R +PPSWLEL+A K K+P+ ++V  M+G T ++  DSAST++E+C +LSQKI L+D FGFSL++A+ DKV S+GSG +HVMDAISQCEQ  K KG  E  A WRL+FRKEIFTPWH+   D V+T+LIY QVIRG+KFGEY+C+ +DD+ KL      +    D S E     +   I     E K    W+ ++N A       + K+  +  ++K E+V +AR KWPM FSRF+E I+ SGP L  N+ I  INWTGI  +D  ER  LELS+P +  V           NT R   QS+ L T+K G++  N     DI DL+  FL GL ERS YA+ +Q  ++ D  +FLS +KG+L++L  +D+     +  W  G+N RT + G  P + + ILP ++ P+  +L+L S     D      NN    +   R    TL+E+S  YFR P+       +S  K VA   LW HS    RQ     LL    +    C    +  + IL YMGD P++   +  E+ + IF P  ++E L+DE+YCQ+I Q+TSN N  S + GW+L+WL  G+  P+++L + +   LE  R  +  LA +C  RLQ  L+   R+ PPH +E++A+Q     I HKI+FPN++ + FE+++ TK +DL ++I + + L    GF+LFVK+ DK +S+ E D+ FD +RQ++DW K  +  KD G +  +Y VFFMKKLW N VPG D  AD +FH+PQE+ KYL GYH+   +D + LGAL+ R   D D ++     + L  L+P D L      + ++ + A Y+    ++  +A ++FLK++F+WPTFG AFFEVKQ+++ N P+ + IAI+K GV +IH KTK+ L  +P + I++W SG+TYF+MT+GNLI G K+LCET LGYKMDDLLTSY ++ L+
Sbjct:    8 QLQLIDDEGKEHKIKKDVTLKSMHPTSVSGVDDMIRLGDLNEAGLLRNLLVRHRDGIIYTYTGSILVAVNPYQLLPIYTPEQVQLYTDRRLGELPPHVFAIADSCFFNMRRNRKDQCCVISGESGAGKTESTKLILQFLAAVSGQRSWIEQQILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFSKGGSIEGARIEQYLLEKSRVCRQAQEERNYHIFYYMLMGMPAEQKKILSLGSAAEYNYLTMGKCTSCEGRDDIQEYAHFRSAMKILTFSENDSWEIHKLLAAILHLGNLDFEGE-------------------------------NDLTQRSFMTNRESVSKPLTSEQALGGRDAFVKGIYGRLFIWIVEKINSAIYKP-----------PAEGSTCQSIGLLDIFGFENFKQNSFEQLCINFANEQLQQFFVKHVFKLEQEEYARENIVWTHIEYSDNQRTLDILAVRSLNILSLIDEESHFPKGTDSTLLNKLDKTHSKSTIYISPKNDHDTKFGIQHFAGPVFYDSKGFLEKNRDALSLDLILLVETSTNKLLKKIFHSELSTN-DTKGRVLTLCGQFRLSLDALMKTLTACQPYFIRCIKPNDFKKPMLFDRELCMRQLRYSGMMETIRIRKAGYPIRHTFQEFLDRYRVLL----NSTVC-DPKTVRTNTCQEVAE-DDWKIGKTKVFFKDFHDTMLELKRDKALNEKALIIQKVLRGHKHRKQFLKQRSAAVVVQKYWRGHKGRKLY---RLGFARLQATVRSRQITRQYELERKAALLLQTQIHGYFARKEWRRKRDAAILLQAHIRGM-------------------------NARRYLTQGS-------SGLQAFLSLQERRAEELAALERQKKLEEVLRQKKEREAAEQSESITDQEMVDTIFGFLPSL----VGGQEGQAPTGFEDLE-GRWTALEEVDLDDAPMMEDLPEEDYD-DLDEYSFSKFASMYFQGAATPTHIRHRLRQPLLYHEDESDVVASLTVWWIILRFMGDLPEP--------RPQRIP----------------------------RSGMGFAERSL---QKDVASR--------QDRRLSHMVG----LDQVSLKSTWRQRGCSRETGLLF----------LRDEIYCQICKQLQENGNRSSFFRGWILLSLCLGIFPPTERFSKYLQSFIRLGPAGYAPYCAERLRRTVANGVRAEPPSWLELQATKTKKPMAMSVTLMDGRTISLPVDSASTSKEVCQMLSQKIKLQDTFGFSLYVALYDKVWSLGSGREHVMDAISQCEQEVKRKGGKEQHAPWRLYFRKEIFTPWHDCSQDSVSTELIYRQVIRGLKFGEYQCEREDDVVKLAMKHFFVQYGSDSSMENTKTVVQDCINSKLLEAKSESKWVQMINTAHLEGPYINSKNRAA--EVKAEVVDYARQKWPMFFSRFFEVIRTSGPPLPKNKFIMAINWTGITFLDERERKLLELSYPMVTGV-----------NTVREGKQSVCLRTLK-GDFMLNAVMGGDIVDLVALFLAGLAERSLYAVALQEVNRQDDPTFLSFKKGELILLIKDDDFS--PSRGWLKGQNERTGQKGAVPTETILILPTLSKPTNEVLSLISLSP--DQRKTIINNTLRGTAAERVAPATLKEYSIEYFRPPTKDVNRQVIS--KNVAPERLWAHSREPIRQPFLKRLLGNPEHLSSGCNSLTALCAPILKYMGDYPTRQIQNPLELTDQIFGPAAQNEALRDEIYCQIIKQMTSNNNRYSMEQGWQLLWLCCGLFPPSTSLMKHIQRFLETRRRET--LASDCLLRLQGALRTEPRKLPPHQVEVDAIQQNSTQIFHKIHFPNDTEEIFEVSTTTKVRDLVRSIATNLRLMTEDGFSLFVKTPDKVLSLNETDYIFDSLRQITDWSKTTKMAKDGGPVNVSYMVFFMKKLWINVVPGRDLEADRIFHFPQELPKYLRGYHRCTKEDLVQLGALLFRVKVDNDKTQFPMIPKMLKELVPNDQLKAMSADDWKKSIFAAYNKQAGLTVEEAMVSFLKVVFKWPTFGCAFFEVKQTSDPNFPDIVRIAISKQGVTIIHPKTKDVLATHPLNKIASWCSGSTYFHMTVGNLIKGNKILCETSLGYKMDDLLTSYANMYLS 2000          
BLAST of Dach-1 vs. Ensembl Sea Lamprey
Match: myo10l1 (myosin X, like 1 [Source:ZFIN;Acc:ZDB-GENE-080425-1])

HSP 1 Score: 582.022 bits (1499), Expect = 4.436e-172
Identity = 336/845 (39.76%), Postives = 486/845 (57.51%), Query Frame = 3
Query:  174 KGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGT----KIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVL-PIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFL---------AAVSG-QHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQK-ADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFD------TRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRIL-----VPGIPSSFRCKDTRETTKLVCKNILDPK--GYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDL 2621
            +G  VW+ +       Q++P    +       + +  D G  F L        K+  MH SS++GV+DM +L DL+E  I+ NL +R+  N+IYTY G IL AVNPY ++  +Y    +  Y    +G+L PHI+AIA+  Y  + +    Q ++ISGESGAGKTESTKLIL FL         AA SG  ++ +E  +L+S+PI+EAFGNAKT+ N+NSSRFGK+I ++F   G I+G +I  +LLEK+R+V Q   ERN+HVFY +L G   E +    L   + Y YL Q G I      D+  F  + +AM+V+ F ++E +E+ +LL+  L LGNI F           ++S     +  S+LL LDS  L + LT +++I R + + T ++I Q  + R+++   +Y + F WI++KIN  I               K N  + SIG+LDIFGFENF+ N FEQ  INYANE LQ++F +HIF +EQ EY  E I W+ I++ DN E LDLI  K   +LALI+EESRFPKGTD ++L KL    + +  + K + AD    FGI+H+AG V Y + GFLEKNRD F  DL+ +++ +   F+  LFE+    G +       ++R PT+  QF+ SL SLM  L    PFFVRCIKPN  K    F+  + L QLRYSGM+ET+RIR+AGYP+R  F DF  RY++L     VP  P   +C        +    + D K   +Q+G+TK+FL+D  +  LE LRD  L     LI+     Y  R +F + ++ A+ +Q + R +  +R+F +++     LQ   R+ +A +  + L
Sbjct:    2 QGARVWLRDGD-----QMLP--CTVGPSRAGTVELTSDYGQAFCLPQAALSHDKVSPMHSSSIEGVEDMSALADLHEGAIMHNLHLRFHDNKIYTYIGSILAAVNPYRLIDGLYDKAAVGRYAQNLLGELPPHIYAIANECYRCLWKRLDSQCVLISGESGAGKTESTKLILNFLSETSQGAGKAAQSGPTNTNVETAILESSPIMEAFGNAKTVYNNNSSRFGKFIQLHFSQQGFIQGGRILDYLLEKNRVVRQNPGERNFHVFYALLAGTTAEQKESLCLSEPNSYKYLAQSGCISDDACDDVKSFEKVMTAMQVMAFVKEEVREVLKLLSGVLQLGNIEFV-----TAGGAQISNKDVVSVVSELLGLDSLQLSEVLTQRSMILRGEEISTPLTIEQAEDSRNSMAMALYSQCFSWIIQKINGRI---------------KGNDNFKSIGILDIFGFENFEVNRFEQFNINYANEKLQEYFNKHIFSLEQLEYNREGIIWEDINWMDNGECLDLI-EKKLGMLALINEESRFPKGTDFTMLEKLHGQHATNQFYTKPRVAD--HQFGIKHYAGEVLYDVRGFLEKNRDTFRDDLLNVLRESGIDFIYDLFERVSGGGGEETLKAGAKQRRPTVSSQFKDSLHSLMASLSTSNPFFVRCIKPNMKKLAQRFEHVVVLNQLRYSGMLETVRIRRAGYPVRRPFQDFYSRYKVLLGNREVPDDPKG-KC--------IALLRVYDAKNAAWQLGRTKVFLRDTLEQNLEKLRDTELHKSATLIRAHVLAYLARKRFRRLRACAVAVQAWFRCRSCQRRFSRLRASAITLQKHRRSALARRLYRAL 807          

HSP 2 Score: 58.9214 bits (141), Expect = 1.984e-8
Identity = 68/267 (25.47%), Postives = 116/267 (43.45%), Query Frame = 3
Query: 3723 LRDEIYCQICKQLADNPRLDSVSRGLILLNL--CIGC-FAPTEKFVRTLR--------NFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLK-DQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQI------ESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQ 4469
            L DE+YCQ+ KQ +  P+      GL   +L  C+ C F P    +R +R         F  T     A FI+  L++T     R   PS  E++AI  ++ +   + C  G +  I  DS +TA E+ + L + + ++  +  FSLF     K+         V+D +++ E++A     +       S   WRL+F+   F    +   D V    ++ Q   G+  G +    ++ + +L A  LR+  +  L D +     PQ
Sbjct: 1578 LHDELYCQLVKQTSFAPQPLGTG-GLRTWHLFACLSCTFPPGRAVLRYVRFHLKRVKDRFPGTETEQYASFILDSLKKT---KLREFIPSQEEIQAIVSRQEMTTTIYCHGGGSCKITIDSHTTAGEVVAKLMRGLAMEGSRNTFSLF-ERRGKMEKALENRTIVVDVLAKFEKYAVCSSNLAKQLPNSSSNSWRLYFKLYCFLDTGHVPSDSVEFAFMFEQAHEGLVRGHFPA-PEETLQQLAA--LRLQYI--LGDNSNQASFPQ 1834          
BLAST of Dach-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000498.1 (pep scaffold:Pmarinus_7.0:GL479744:368:24152:-1 gene:ENSPMAG00000000443.1 transcript:ENSPMAT00000000498.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 475.322 bits (1222), Expect = 7.997e-148
Identity = 274/663 (41.33%), Postives = 370/663 (55.81%), Query Frame = 3
Query:  348 LQGVDDMISLGDLNEAGILRNLLIRY-KRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSW--IEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSM-DSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNT-CSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILF-----------------------EKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILV 2252
            L G +D+ +L  L+E  +L NL +R+ + N IYTY G +LVA+NPY  LPIY    I  Y    +GD+ PHIFA+A+ AY  M R  ++QSII+SGESGAGKT S K  +++ A V G  S   IE++VL SNPI+EA GNAKT RNDNSSRFGKYI+I F     I GA +  +LLEKSR+V Q  +ERNYHVFY +     +       L  ++ + Y  QGG   +    D  D      A  +L         IF+++A  LHLGN+  +++ +R  ++C V+  D   N   +LL L+ + +   L  + I T  +  V  +  AQ  N RDAL K +Y +LF WIV +IN A+                S  +++ IGVLDI+GFE F+ NSFEQ CINYANE LQQ F  H+FK+EQEEY  E I W  I F DNQ  +DLI  K   +L L+DEE + PKG+D S   KL      +   F+K +   V  F I HFA  V YQ DGFLEKNRD    + + +++ ++S  L + F                           +    T+ R+     QFR SL  LM+ L    P +VRCIKPN+ K    FD    ++QLR  G++ETIR+  AGYP R  + +F +RYR+L+
Sbjct:    1 LVGENDLTALSYLHEPAVLHNLKVRFAESNHIYTYCGIVLVAINPYEQLPIYGEDIIFAYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSIIVSGESGAGKTVSAKYAMRYFATVGGSASEANIEEKVLASNPIMEAIGNAKTTRNDNSSRFGKYIEIGFNRQYLIVGANMRTYLLEKSRVVFQAEEERNYHVFYQLCASAELPEFKDLHLEPAEAFVYTAQGGNAVIEDVDDGEDLERTRRAFTLLGIGASYQMGIFKIIAGILHLGNVEVQSQ-DREQETCFVNKEDKHLNIFCELLGLERDQMAHWLCHRKISTGAETYVKPMGRAQAQNARDALAKHVYAQLFSWIVHRINKAL--------------RSSTKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNLHVFKLEQEEYMREEIPWTLIDFYDNQPCIDLIEAK-LGVLDLLDEECKMPKGSDQSWAQKLYEKHLGRGKHFLKPRMSNVA-FIICHFADKVEYQCDGFLEKNRDTVYEEQINILKASQSSLLTLAFVSRPPCLHPTGTPPPRRRRNSTEGNRHRSSARTKARSHVATFQFRNSLHLLMETLNATTPHYVRCIKPNDDKMAFTFDPKRAVQQLRACGVLETIRLSAAGYPSRWTYQEFFNRYRVLM 646          
BLAST of Dach-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000990.1 (pep scaffold:Pmarinus_7.0:GL476918:15609:106669:1 gene:ENSPMAG00000000865.1 transcript:ENSPMAT00000000990.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 489.96 bits (1260), Expect = 1.971e-147
Identity = 297/775 (38.32%), Postives = 439/775 (56.65%), Query Frame = 3
Query:  354 GVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQH---SWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDH-YAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERN-MDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILA-LIDEESRFPKG-TDHSLLNKLVNTCSKHPRFIKQKADI---------VKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPK-GYQIGKTKLFLKDAQDIL-LEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLK 2624
            G+ DM+ L  L E   L+NL  R+K +E YTY G ++++VNPY  L IY+ ++++ Y+N  I +LSPH+FAIAD AY ++R   +DQ I+I+GESGAGKTE +K ++ ++AAV G+    + +++Q+L SNP+LEAFGNAKTIRNDNSSRFGKY+DI F   G   G  I  +LLEKSR+V Q++ ERN+H+FY +L G      +   L+ +   Y YL QG    + G  D   F T+  AM+V+ F+++E   +++ LA  L LGNI F      N +D C      E +    LL LD E L +ALT + +    + V T +++AQG   RDAL K +Y RLF W+V +IN              ++  KS  K   +GVLDI+GFE F+ NSFEQ  IN+ NE LQQ F+    K EQEEY  E + W  I + +N    DLI       L  ++D+E   P   TD + L+KL + C KH  F K  +            + F ++H+A  V Y +DGF++KN D    D+ + +  ++ + ++ LF +       + KR  T   Q + S+++LMK L+ + P ++RC+KPN+ K    F   L L Q+RY G+ME +R+R+AGY  R  +   + RY++L       +   D +E  K +  ++  P+  Y  G TK+F+K    +  LE  R + +     LIQKT+R Y  RT FL  K + I I ++VR    R++++K  +   LLQ   R   A + L+ LK
Sbjct:   15 GLADMVLLDPLTEDSFLKNLRERFKHDEFYTYIGNVVLSVNPYKPLTIYSAEKVEEYRNRNIYELSPHVFAIADEAYRSLRDADKDQCILITGESGAGKTEVSKYVMSYVAAVCGKGEEVNMVKEQLLQSNPVLEAFGNAKTIRNDNSSRFGKYMDIEFNFKGDPVGGIIRNYLLEKSRVVYQLQGERNFHIFYQLLAGASPSLLASLKLQQNPSVYTYLMQGKTAHVEGLNDSQSFHTVQKAMQVIGFSDEEIATVWEALAVVLKLGNIVFVDIPRTNGLDECTFKESKELDEVCALLGLDDELLERALTKRTVEANKEKVSTTLNMAQGKYARDALCKNLYNRLFSWLVSRIN-------------ESIKVKSKIKKKVMGVLDIYGFEIFEVNSFEQFIINFCNEKLQQIFIELTLKEEQEEYIREGVKWIQIEYFNNAIICDLIENNVFVYLGPMLDDECMRPGNVTDSTFLDKLNDKCGKHEHFEKHNSASSARSTTKRHYRCFRVQHYAVKVTYSVDGFVDKNNDLLFRDISQTMWQSQRKLVRDLFPEG-NPSKQSLKRPLTASSQLKTSVNALMKDLLIKNPNYIRCLKPNDRKSSSLFQDELVLNQVRYLGLMENVRVRRAGYVFRQLYALCLHRYKMLGSQTWPHWN-GDAKEGVKSILVDLKLPQEEYAFGVTKVFIKSPTTLFQLERKRTERMHELATLIQKTYRGYKCRTHFLLMKKSQIIIASYVRSHQERKRYVKTLECIVLLQRIVRGWKARRLLRHLK 774          
BLAST of Dach-1 vs. Ensembl Sea Lamprey
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 483.026 bits (1242), Expect = 5.855e-146
Identity = 314/845 (37.16%), Postives = 452/845 (53.49%), Query Frame = 3
Query:  237 GAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSW---------IEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFT-DNQETLDLI--GVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRF-----IKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILF----------------EKDFKMGFDTRKRA-PTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVP-GIPSSFRCKDTRETTKLVCKNI-LDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKK-------------SAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLK 2624
             A IK+   D++ V   +  + +      ++ M+      V+DM  L  LNEA +L NL  RY    IYTY+G   V VNPY  LPIY+ + I+ Y+  K  ++ PHI+A+ D AY +M +   DQSI+ +GESGAGKTE+TK ++Q+LA V+  H           +E+Q+L +NPILEAFGNAKT++NDNSSRFGK+I I F V G I GA I+ +LLEKSR + Q +DER +H+FY +L G     ++   L   ++Y +L+ G  + + G  D  +F    S+M ++ FT +E   + +++++ LH GNI FK   ERN D   +  ++       LL +   D  +A+ T  I    D+V    +  Q     +AL K  Y RLF W+V+++N A+ R                   + IG+LDI GFE F+ NSFEQLCINY NE LQQ F   +F +EQEEY  E I+W  I F  D Q  ++LI        ILAL+DEE  FPK TD S   KLV     HP+F     +K KAD    F + H+AG V Y+ D +L KN D  N ++  L+  +  +F+  L+                +  F   + TRK    T+G  +++ L  LM  L    P FVRCI PN  KK    +  L L QLR +G++E IRI + G+P R  F +F  RY IL P  IP  F   D ++  + + K + LDP  Y+IG++K+F +      LE+ RD  +++ II  Q T R Y  R  F K++             SA +K++ +   +L    F K+K    LLQ S + +V   K ++L+
Sbjct:   53 AASIKEERGDEVLVELAENQKKVTVNKDDVQKMNPPKFAKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVVNPYKNLPIYSEEIIEMYRGKKRHEVPPHIYAVTDTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRKDHGAPGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDERTFHIFYQLLSGAGEHLKTDLLLEGYNNYRFLSNGNVV-IPGQQDKDNFQETTSSMNIMGFTHEEQISLLRVVSSVLHYGNIVFKK--ERNTDQASMPDNTAAQKLCHLLGIAVTDFTRAILTPRIKVGRDYVQKAQTKEQADFAIEALAKATYERLFRWLVQRLNKALDRT-------------KRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIEKPAGPPGILALLDEECWFPKATDKSFCEKLVQEQGTHPKFQKPKQLKDKAD----FSVIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDKFVAELWKDVDRIVGLDTVSGMTDTAFGSTYKTRKGMFRTVGQLYKEQLTKLMATLRNTNPNFVRCIIPNHEKKAGKLEPHLVLDQLRCNGVLEGIRICRQGFPNRIIFQEFRQRYEILTPNAIPKGFM--DGKQACERMIKGLELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDIIIAFQATCRGYLARRAFGKRQQQLSALRVIQRNCSAYLKLRNWQWWRL----FTKVKP---LLQVSRQDEVLLAKAEELQ 868          
BLAST of Dach-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001434.1 (pep scaffold:Pmarinus_7.0:GL493165:42961:106906:1 gene:ENSPMAG00000001264.1 transcript:ENSPMAT00000001434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 484.567 bits (1246), Expect = 1.131e-145
Identity = 274/747 (36.68%), Postives = 418/747 (55.96%), Query Frame = 3
Query:  315 GTKIRHM---HVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQ---VLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIIT----RDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLI--GVKNCNILALIDEESRF----PKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDI-LLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKI 2504
            G+K R+    H     GVDDM+ L  ++E  I+ NL  RY  + I+TY G +L++VNP+  +P +T KEI+ Y+     +  PHI+A+ADN Y NM     +Q +IISGESGAGKT + K I+ +++ VSG  S ++     +L SNP+LEAFGNAKT+RN+NSSRFGKY +I F   G  +G KI  FLLEKSR+VSQ   ERN+H++Y + E    + +   G+   D+Y YLNQ G   +    D  DF     AM+V+    +  Q + Q++A  LHLGN++F+       +   V  D    F + LL ++   L++ LT++ + +    + + +   +++ Q    RDAL K +Y R+F ++VE IN AI               K + +Y ++GVLDI+GFE F  N FEQ CIN+ NE LQQ F+    K EQEEY  E I W  I + +N+   DLI   V    I++++D+         +G D +LL KL      H  F       +    + H+AG V Y ++GF E+NRD    DL+EL+Q+++  F++ LF ++ +   + + R  T+  + +K  + L+  LM+  P ++RCIKPNE K+  D++ S    Q  Y G+ E IR+R+AGY  R  F  F+ RY IL       +  ++ +    L+    +DP  YQ+G+TK+F+K  + + LLE++R++        IQK WRK+    +++K +  A  I
Sbjct:    2 GSKERYHWQSHNVKHSGVDDMVLLPKISEDAIVDNLKKRYMDDFIFTYIGPVLISVNPFKQMPYFTDKEIELYQGAAQYENPPHIYALADNMYRNMLIDQENQCVIISGESGAGKTVAAKYIMSYVSKVSGGGSKVQHVKDIILLSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVSQNPQERNFHIYYQLTEAAVGDQKESLGITTPDYYYYLNQSGAYKVDDIDDRKDFQETMKAMRVIGIPAEHQQMVLQIVAGILHLGNLSFREA----GNYAAVENDDFLAFPAFLLGIEQARLKEKLTSRQMDSKWGGKSETIEVTLNVEQANYTRDALAKALYARVFDYLVEAINRAI--------------QKDHEEY-NVGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIDYFNNKIVCDLIENKVNPPGIMSVLDDVCATMHAKGEGADATLLQKLRAQIGSHEHFNSWNQGFI----VHHYAGKVSYDVEGFCERNRDVLFTDLIELMQSSEHSFIQALFPENIQS--EKKGRPTTVASKIKKQANDLVNTLMKCTPHYIRCIKPNETKRPRDWEESRVKHQAEYLGLRENIRVRRAGYAYRRIFKKFLQRYAILTRETWPEWHGEERKGVEYLLRTVNMDPDQYQMGRTKVFVKAPESLFLLEEMRERKYDGYARAIQKAWRKHVAHKRYMKMREEASDI 723          
BLAST of Dach-1 vs. Ensembl Yeast
Match: MYO2 (Type V myosin motor involved in actin-based transport of cargos; required for the polarized delivery of secretory vesicles, the vacuole, late Golgi elements, peroxisomes, and the mitotic spindle; MYO2 has a paralog, MYO4, that arose from the whole genome duplication [Source:SGD;Acc:S000005853])

HSP 1 Score: 561.992 bits (1447), Expect = 1.489e-168
Identity = 338/841 (40.19%), Postives = 486/841 (57.79%), Query Frame = 3
Query:  348 LQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPY-AVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAV------SGQH----SWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTS-IGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPR---FIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQ-TTKSQFLKIL--FEKDFKMGFDTRK------------------RAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSS--FRCKDTRETTKL-VCKNILDP-----KGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFC--LLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTK--AIIKIQSQIR 2726
            L+  +D+ SL  LNE  +L  +  RY +  IYTY+G +L+A NP+  V  +YT   I+ Y   + G+L PH+FAIA+ AY  M+   ++Q+I++SGESGAGKT S K I+++ A+V      + QH    S  EQ++L +NPI+EAFGNAKT RNDNSSRFGKY++I F  + +I GA+I  +LLE+SR+V Q   ERNYH+FY ++ GLP +T+    L  +  Y Y+NQGG   + G  D  ++     A+ ++  T++   +IF++LAA LH+GNI  K    RN D+   + +     A +LL +D+ +  K +T K IITR + +V+N++ +Q +  +D++ K IY  LF W+VE INT +  PA+            N + +S IGVLDI+GFE+F+ NSFEQ CINYANE LQQ F +H+FK+EQEEY  E I+W  I F DNQ  +DLI  K   IL+L+DEESR P G+D S   KL  T  K P    F K +    K F + H+A  V Y ++GF+EKNRD  +   +E+++ +T    + IL   EK  K   + +K                  R PTLG  F++SL  LM  +      ++RCIKPN  K+   FD  + L QLR  G++ETIRI  AG+P R  F +F+ RY IL+P       F+ K+T E   + V K ILD        YQIG TK+F K      LE LR   + N I++IQK  R  Y+R Q+L+   A   +Q  ++  + R++     K  C  LLQA++R       +  +   I N+Q+  R  L +  LKQ+ +  A + IQS++R
Sbjct:   69 LEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKT--RN-DASLSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVENINTVLCNPAV------------NDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENK-LGILSLLDEESRLPAGSDESWTQKLYQTLDKSPTNKVFSKPRFGQTK-FIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLINILEGLEKAAKKLEEAKKLELEQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVR 892          
BLAST of Dach-1 vs. Ensembl Yeast
Match: MYO4 (Type V myosin motor involved in actin-based transport of cargos; required for mRNA transport, including ASH1 mRNA, and facilitating the growth and movement of ER tubules into the growing bud along with She3p; MYO4 has a paralog, MYO2, that arose from the whole genome duplication [Source:SGD;Acc:S000000027])

HSP 1 Score: 548.895 bits (1413), Expect = 5.366e-165
Identity = 326/842 (38.72%), Postives = 472/842 (56.06%), Query Frame = 3
Query:  348 LQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPY-AVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSG--------QHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPR---FIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILF----------------EKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILV-----------PGIPSSFRCKDTRETTKLVCKNILDP-----KGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKF---IKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQK--TKAIIKIQSQIR 2726
            L+  DD+ +L  LNE  +L  +  RY   +IYTY+G +L+A NP+  V  +Y+ + I+NY + +  +L PH+FAIA+ AY  M     +Q++++SGESGAGKT S K I+++ A+V          + S IE Q+L +NPI+EAFGNAKT RNDNSSRFGKY+ I F  N  I G+KI  +LLEKSR+V Q   ERNYH+FY +LEGLP   +    L +   Y Y NQGG+ ++ G  +  ++     A+ ++    +    IF++LA  LH+GNI  + K+ RN D+   S +     A +LL +D  +  K +  K I+TR + +VTN++  Q +  RD++ K IY  LF W+V+ IN  +Y P L Q          +  ++ IG+LDI+GFE+F+ NSFEQ CINYANE LQQ F +H+FK+EQEEY  E I+W  I F+DNQ  +DLI  K   IL+L+DEESR P G+D S  +KL +  +K P    F K +    K F + H+A  V Y+++GF+EKNRD  +   +++ + T +   K +                 EK   +     ++ PTLG  F+KSL  LM I+      ++RCIKPN  KK  +FD  + L QLR  G++ETIRI  AG+P R  F +F+ RY +L            P +P        +E     C++ILD        YQIG TK+F K      LE LR   ++   I+IQK  R  Y+R Q+L+   +  K Q+ +R  L R +    +K +    LLQ + RA    +  +   G I  +Q  C+ +L  D + +K    A + IQS IR
Sbjct:   70 LESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNI--EMKMTRN-DASLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTLFDWLVDNINKTLYDPELDQ---------QDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENK-LGILSLLDEESRLPSGSDESWASKLYSAFNKPPSNEVFSKPRFGQTK-FIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDYSLWSGILYNPDLP--------KEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKLRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAI-LLQTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIR 888          
BLAST of Dach-1 vs. Ensembl Yeast
Match: MYO3 (One of two type I myosins; localizes to actin cortical patches; deletion of MYO3 has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO3 has a paralog, MYO5, that arose from the whole genome duplication [Source:SGD;Acc:S000001612])

HSP 1 Score: 479.174 bits (1232), Expect = 1.275e-142
Identity = 281/753 (37.32%), Postives = 426/753 (56.57%), Query Frame = 3
Query:  354 GVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSW----IEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALT-----TKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKN-CNILALIDEESRFP----KGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCK---DTRETTKLVCKNILDP-KGYQIGKTKLFLKDAQDIL-LEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMK 2555
            G+ D+  L  +++  I  NL  R+K   IYTY G +L++VNP+  L IYT   +++YK     ++ PH+FAIA++ Y N++  + +Q +IISGESGAGKTE+ K I+Q++AA S  HS     I+  VL +NP+LE+FG AKT+RN+NSSR GKY++I F          I  +LLEK R+V Q+++ERN+H+FY   +G     +  FG++  + Y Y    G        D+ D+     AM+ +   ++E  +IF++LAA L +GNI+F   +E    + +V   S  +F + LLQ+D+  L K L      T + + R       ++  Q   +RDAL K IY  LF WIV+++N      +L   P +           SIG+LDI+GFE F++NSFEQ+CINY NE LQQ F++   K EQE Y  E I W  I + DN+   DLI  KN   ILA +++            D +   +L N  + +P F + +A+    F I+H+AG V Y I+G  +KN+D    DL+ELI TT + FL  +F  D     D+++R PT G +  KS + L++ L + EP ++R IKPN+ K   D+D    L Q++Y G+ E +RIR+AG+  R  F  F++R+ +L P    +       DT E  KL+ ++ + P K +Q+G T +F+K  + +  LED+RDK   N    IQ+ WR++  R     +  AAIKIQ  +R K    K++K++
Sbjct:   37 GISDLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPFRDLGIYTNAVLESYKGKNRLEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASNSHSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITNYLLEKQRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQMPEQYIYTAAAGCTTADTIDDVKDYEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISF---IENEEGNAQVGDTSVTDFVAYLLQVDASLLVKCLVERIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFDWIVDRVNV-----SLQAFPGAD---------KSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQETYEREKIKWTPIKYFDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAADQAFAQRL-NLFNSNPYF-ELRAN---KFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTFLSTIFPDDVDK--DSKRRPPTAGDKIIKSANELVETLSKAEPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPDCSYAGDYTWDGDTLEAVKLILRDAMIPEKEFQLGVTSVFIKTPESLFALEDMRDKYWYNMAARIQRAWRRFLQR-----RIDAAIKIQRTIREKKGGNKYVKLR 760          
BLAST of Dach-1 vs. Ensembl Yeast
Match: MYO5 (One of two type I myosin motors; contains proline-rich tail homology 2 (TH2) and SH3 domains; MYO5 deletion has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO5 has a paralog, MYO3, that arose from the whole genome duplication [Source:SGD;Acc:S000004715])

HSP 1 Score: 463.381 bits (1191), Expect = 9.808e-138
Identity = 275/753 (36.52%), Postives = 418/753 (55.51%), Query Frame = 3
Query:  354 GVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSW----IEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALT-----TKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKN-CNILALIDEESRFP----KGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVP--GIPSSFRCK-DTRETTKLVCKNILDPKG-YQIGKTKLFLKDAQDIL-LEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMK 2555
            GV D+  L  +++  I  NL  R+    IYTY G +L++VNP+  L IYT   +  YK     ++ PH+FAIA++ Y NM+  + +Q +IISGESGAGKTE+ K I+Q++AA S  H+     I+  VL +NP+LE+FG AKT+RN+NSSR GKY++I F          I  +LLEK R+VSQ+++ERN+H+FY   +G     R  FG++  + Y Y    G I      D+ D+     AM+V+   ++E  +IF++LAA L +GN++F   +E    + +V   S  +F + LLQ+DS+ L K+L      T + + R       ++I Q   +RDAL K IY  LF WIV ++N      +L   P +           SIG+LDI+GFE F++NSFEQ+CINY NE LQQ F++   K EQE Y  E I W  I + DN+   DLI  +    I A +++            D +   +L N  + +P F  +    V    I+H+AG V Y IDG  +KN+D    DL+ELI TT + FL  +F        ++++R PT G +  KS + L++ L + +P ++R IKPNE K   D+D    L Q++Y G+ E +RIR+AG+  R  F  F++R+ +L P       +  + DT +  K + ++   P+  YQ+G T +F+K  + +  LE +RD+   N    IQ+ WR++  R     +  AA KIQ  +R +    K+ K++
Sbjct:   37 GVSDLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPFRDLGIYTDAVMNEYKGKNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASSTHTESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITNYLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAETIDDLQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSF---IENEEGNAQVRDTSVTDFVAYLLQIDSQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVSRVNK-----SLQAFPGAE---------KSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRL-NLFTTNPHFDLRSNKFV----IKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLATIFPDTVDR--ESKRRPPTAGDKIIKSANDLVETLSKAQPSYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSPHCSYAGDYTWQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDRYWHNMAARIQRAWRRFLQR-----RIDAATKIQRTIRERKEGNKYEKLR 760          
BLAST of Dach-1 vs. Ensembl Yeast
Match: MYO1 (Type II myosin heavy chain; required for wild-type cytokinesis and cell separation; localizes to the actomyosin ring; binds to myosin light chains Mlc1p and Mlc2p through its IQ1 and IQ2 motifs respectively [Source:SGD;Acc:S000001065])

HSP 1 Score: 450.284 bits (1157), Expect = 4.737e-129
Identity = 296/765 (38.69%), Postives = 426/765 (55.69%), Query Frame = 3
Query:  342 SSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKN-------CKIGD-----LSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAV-SGQHSWI------------EQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASD--HYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCE-VSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISF-TDNQETLDLIGVKN--CNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILF----EKDFKMGFDT-------RKRA-----PTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVP--GIPSSFRCKDTRETTKLVCKNI-----LDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQF 2474
            S+   V++M  L  LNE  +L NL  RY  + IYTY+G  LVA+NPY  L +Y+   I  Y N        ++ +     L PHIFAIA+ AY N+    +DQSI+++GESGAGKTE+TK ILQ+LA++ SG  S I            E ++L SNPILE+FGNA+T+RN+NSSRFGK+I I F  +G I GA I+ +LLEKSRIV Q   ERNYH+FY +L GL         L++ +   Y  L+   +  + G  D+ +F  L SA+ ++ F++D+ + IFQ++A  L +GNI F +      D  E  S  ++ +     L +D +D + A+         ++V  + +  Q   I +AL + +Y RLF +IV+ IN  +   +      + LN         IG+LDI GFE F+NNSFEQLCINY NE LQQFF  H+F +EQ EY  E I W +I +  D Q T+DLI  K     +L L+DEE+  PK TD S  +KL++T  ++    K ++ +   F ++H+AG V Y ++G+L KN+D  N +L+ L+ ++++  +  LF    EK    G +        +K A      T   + R+   +L+  L    P FVRCI PN  KK   F+R L L QLR +G++E IR+ + GYP R  F +F  RYRIL P     ++F  K  + +TK  C+ +     LD K Y+IG TKLF K      LE  +D  L+N +I +  T R Y  R + 
Sbjct:   72 STFDKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLNLYSEDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAGKTENTKKILQYLASITSGSPSNIAPVSGSSIVESFEMKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKNLRLKSRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILLIGNIEFVS------DRAEQASFKNDVSAICSNLGVDEKDFQTAILRPRSKAGKEWVSQSKNSQQAKFILNALSRNLYERLFGYIVDMINKNLDHGS------ATLNY--------IGLLDIAGFEIFENNSFEQLCINYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLPLLDEEAVLPKSTDESFYSKLISTWDQNSSKFK-RSRLKNGFILKHYAGDVEYTVEGWLSKNKDPLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEVKKSARTSTFKTTSSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRLAREGYPNRIAFQEFFQRYRILYPENSTTTTFSSK-LKASTKQNCEFLLTSLQLDTKVYKIGNTKLFFKAGVLADLEKQKDVKLNNIMIKLTATIRGYTVRKEI 814          
BLAST of Dach-1 vs. Ensembl Nematostella
Match: EDO35658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKY6])

HSP 1 Score: 1631.69 bits (4224), Expect = 0.000e+0
Identity = 913/1978 (46.16%), Postives = 1239/1978 (62.64%), Query Frame = 3
Query:  894 MRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPG-IPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVA----DAQQQLKDNSDIKQRIAEAE-RRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSR--MNALNDVGSIFGTTMP--DYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMR-TNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSS-----LLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRI----DNVKDLSDETLHKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP--DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDS------YGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLG-KQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSK-NYSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSL--LALECQTRLQKTLKMGQRRYPPHAIEINAVQ-MGKLIQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITK 6725
            M DERNYH+FY ML G+  + ++  GL     Y YL QG  I   G  D  +F  +  AMKVL F E E  +IF+L+AA LH+GN+ F+    + +D+C+++ +   +  SKLL+   E ++ A T+K+   R + + T VS  +  +IRDA  KGIYGR+FVWIV KIN AIY+P              NS    +G  ++F    F   SFEQLCINYANE+LQQFFV+HIFK+EQE+Y  E I WQHISF DNQ  LDL+  K  NI+A+++EESRFPKGTD ++L KL +  +    +I  K      FG+ HFAG V+Y   GFLEKNRD F+ADL++L+ ++KS+FL  +F K+  MG +TRKR+P LG QF+KSLD LMK L    PFFVRCIKPN++KK + FDR LC RQLRYSGMMETIRIRKAGYPIRH F +FIDRY +L P  +  +      ++ T  +    L    +Q+GKTK+FLKDAQD  LE+ RD+ L++R ILIQK  R +  R  +L+ +  A+ IQ   +    R+K+ K+ +G+  LQA +R +V S K + L+  +   Q +CRG L R     +  ++IKIQS +R   A +  + L+ +  K +EA  ++++ E   +  M+ ++A   A++ ++ RL Q+  E       +A+Q  +   +I+  IAE + R+R +  D++E   E+                   P    DL +S    N++N   SIF    P  ++L N    DVSE+ F+KFAATYFQ    P + R+PL++ LL  ++    ++ALAVWI ILRFM DLPEP    S         +  K+  + G   ++  + +  +     T     E    + T RK IVSLTLK+KSK T +V   L +A+    + TLS        +++PT+NLEKLHFIIG+GIL  ELRDEIYCQICKQL  NP   S +RG ILL+LC+GCFAP+EKFV+ L  FI+      A +   RL+RT  NG R+QPPSWLEL+A K K+P++L +  M+G T+T+ ADSA+TA+ELC+ L+ KI L DQFGFSL+IA+ DKVSS+GSG DHVMDAISQCEQ+AKE+G  E  A WRLFFRKEIF+PWH+   D + T+LIY QVIRGIKFGEYRCD DDD+ ++ A +  +    D + D     L  YLP+ ++   +   +YW  ++  A K  + T        + +KE++VT+AR KWP+LFSRFYEA +FSGPSL  N+VI  +NWTG+Y+VD  E + L+L FP+I +V+SS+        T+RL G S +++TVKG  YTF  ANSEDIR+L+ FFL+GL+ RS Y + +  +  P   SSFLS +KGDL+IL++ D    +  S W  G   RT + GDFPA+ VY+LP    P    L  FSD+S  +S                ++  K  TLE +S  +F  P   + S T+  G  +  G  W   R          L     L    +        YMGD PSK +  +T++ ++IF+  L HE L+DEVYCQLI QIT N  P S   GWEL+WL TGI   ++ L RE+ ++FRS  S   L  +C  RLQKT+++GQR+YPPH +E+ A+Q     I HK+YFP++S QAFE+ S TK K+ C  I  ++GLK  +GF+LFVK  DK IS+PEGDFFFDF+R L++W+KK  P KDG+     YQVFFMKKLWTNTV G D  AD +FHY QE+ KYL GYHK + ++A  L ALI R    +D S+ Q+    +  LIP D++ +    E ++ ++AQ++     + ++AKI+FLKII++WPTFGSAFFEVKQ T  N P+ +LIAINK+GV LI+ +TKE L  YP++ ISNWSSGNTYF+MTIG+L+ G KLLCET LGYKMDDLLTSYISLMLT + K
Sbjct:    1 MLDERNYHIFYRMLAGMTPKEKALLGLTDVADYYYLTQGNCITCEGMNDAEEFAIIRGAMKVLMFNEVEMMDIFKLVAAILHMGNLEFEGTERKTVDACDIADEDLGDIISKLLETPLEQMKVAFTSKSTFARGEMIFTPVSKDKAKDIRDAFCKGIYGRVFVWIVNKINKAIYKPV-------------NSAAFVVGYSELFNVLFF---SFEQLCINYANEHLQQFFVKHIFKLEQEQYDKEGIRWQHISFVDNQMILDLLAQKPMNIVAIVNEESRFPKGTDTTMLQKLQSNHNDSSLYIPSKNSFDMSFGVRHFAGTVYYDSRGFLEKNRDTFSADLVDLVGSSKSKFLLEIFSKERTMGEETRKRSPALGAQFKKSLDLLMKTLSRCHPFFVRCIKPNDYKKPMMFDRLLCCRQLRYSGMMETIRIRKAGYPIRHTFAEFIDRYYMLSPDPVQKNLDVSGLKKATNNIAVKYLSNSDWQLGKTKIFLKDAQDQQLEEHRDRLLTSRAILIQKVVRGFLTRKVYLRMRMGAVMIQKTWKGHHQRQKYQKILQGYARLQALYRTRVISAKYQTLRSRVCIFQAYCRGFLARRDYVTRINSVIKIQSGVRMVLAKRTAQGLRVEKKKREEAERIRRRQEEALREAMAGDEARILADRLYQERLKQMEEEKKREEMLNAEQAQRKKREIE--IAEEKARKRREDDDDTESAFEL-------------------PPPPPDLGVSESCHNSMNCYESIFDEIPPPLEFLDNDHAIDVSEYKFSKFAATYFQGGATPGYIRRPLKQSLLPLNSEADSMAALAVWITILRFMGDLPEPKFITSS--------VDNKVSHTTGGSSSQFMVSQTFKTNNSTTTSRDREREKEKDTLRKRIVSLTLKRKSKITKDVTARLKEADE---SGTLSDGYGPLSAQDKPTTNLEKLHFIIGHGILRKELRDEIYCQICKQLTGNPSKTSHARGWILLSLCLGCFAPSEKFVKYLWCFIKEGPPGYAPYCEERLRRTQQNGCRHQPPSWLELQATKSKKPLMLPITFMDGTTKTLLADSATTARELCTQLADKISLLDQFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIFSPWHDPTMDKIGTNLIYQQVIRGIKFGEYRCDRDDDLAEIAAKEYYVEYGRDMIPDRLSSLLTSYLPEALLQSGRSAHEYWHGMILAAHKRAHYTL--SGTEPQLVKEDLVTYARFKWPLLFSRFYEAYQFSGPSLPKNDVIIAVNWTGVYVVDDQEHVLLDLQFPDITSVTSSK--------TNRLEGSSFTITTVKGDEYTFTSANSEDIRELVQFFLDGLRTRSKYVVTLMDYQSPGESSSFLSFKKGDLIILDS-DTGETVLNSGWCSGLCERTVKRGDFPAECVYVLPTTTKPGPESLIAFSDQSSENSEKIIATTKTAIYQEDQETFEKPCTLEAYSVDHFMPPPKRTLSKTLQGGLLERGGGYWTGKR----------LKKVGGLSNHHIVLQLTFNHYMGDYPSKRSRQATDLTDAIFESALLHEPLRDEVYCQLIKQITENRLPSSFDRGWELLWLCTGIFACSAVLLREVNQIFRSWVSRQPLGHDCLARLQKTIRVGQRKYPPHIVEVEAIQHQTTQIFHKVYFPDDSDQAFEVDSGTKAKEFCNIIAQRLGLKSAEGFSLFVKITDKVISVPEGDFFFDFVRHLTEWLKKAGPTKDGRTPNLTYQVFFMKKLWTNTVVGKDPAADCIFHYHQELPKYLRGYHKCIKEEAAQLAALIYRVKFGEDKSQFQNIPRMVKELIPHDLVKQMSPDEWKRAIVAQFNKHPGRTKSEAKISFLKIIYRWPTFGSAFFEVKQGTEPNFPDNLLIAINKSGVNLINPQTKEILATYPFTKISNWSSGNTYFHMTIGSLVKGSKLLCETSLGYKMDDLLTSYISLMLTNMNK 1909          
BLAST of Dach-1 vs. Ensembl Nematostella
Match: EDO45563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSH2])

HSP 1 Score: 815.453 bits (2105), Expect = 0.000e+0
Identity = 404/815 (49.57%), Postives = 555/815 (68.10%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFIL--KPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNY-KNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAK 2594
            M    +GD VW+E          V IGA +K++    + ++DD+G E ++       ++HMH SS++GV++MI LGDL+EAGILRNLLIRY+ N+IYTY G +LVAVNPY   PIY    I  Y K     DL PHI+A  + ++  M+R   +Q ++ISGESGAGKTESTK ILQ+L AVSG+HS IE+Q+LD+NPILEAFGNAKTIRNDNSSRFGKYID++F  +  IEGAKID +LLE+SRIV+QM +ERNYH+FY ML G+  + +    L  +  Y YL+QG  +   G  D  ++  +  AM  L FTE+E Q IF+ +AA LHLGNI+F+AK+E N+++C+V        A+ LLQ+  E + +A T K+     + + + VS+ +  +IRDA VKG+Y ++F+WIV KIN++IY+P               S   SIGVLDIFGFE FD NSFEQLCINYANENLQQFFV  IFK EQEEY  E I+W  ++F DNQE LD++  K  N +ALIDEESRFP+GTD S L+KL      +  F++ K+ +   FG+ HFAG V+Y   GFL+KNR+ F+ADL++LI ++K  F   +F K+  MG +TRKR+PTLG+QFR+SLD LMK L     FFVRC+KPN +KK ++FDR LC +QLRYSGM+ET+RIRK+GY +RH F +F+ RY +LV     S R   +R+ + L+  ++L  + +++G  ++FLK++QD+LLE+ R + LS++II +Q+  R+Y    +  + +  A+ IQ+  R    R+ F+ MK+GF  LQA+FRA+
Sbjct:    1 MAFKAQGDHVWLEAGDGEND---VAIGACVKEVQGASVILVDDEGKEVVIDRSVAESLKHMHPSSVEGVENMIELGDLDEAGILRNLLIRYRANKIYTYVGSVLVAVNPYCSFPIYGTAYISRYQKAVNATDLPPHIYATGEMSFAMMKREKHNQCVVISGESGAGKTESTKFILQYLTAVSGRHSTIEEQILDANPILEAFGNAKTIRNDNSSRFGKYIDVHFNDSWVIEGAKIDHYLLEQSRIVAQMPNERNYHIFYRMLAGMSPQEKKSLHLTHAQDYYYLSQGNCLTCEGMDDAYEYDVIRKAMTALWFTEEETQFIFRSIAAVLHLGNISFEAKMEDNIEACDVMNPETVAAAADLLQVPKEHMEEAFTRKSTFAEGEMIYSPVSVERATDIRDAFVKGLYSKVFIWIVNKINSSIYKPR---------GKDDTSGRQSIGVLDIFGFEKFDMNSFEQLCINYANENLQQFFVAQIFKNEQEEYDREGIEWNFVTFVDNQEVLDMLAEKPMNFIALIDEESRFPQGTDESFLDKLNYNHKDNKHFVRPKSRVQSQFGVVHFAGTVYYDTTGFLDKNRNTFSADLVDLISSSKCNFFLNMFFKERSMGTETRKRSPTLGVQFRRSLDVLMKTLASCRSFFVRCVKPNNYKKPMEFDRELCWQQLRYSGMLETVRIRKSGYAMRHTFEEFVTRYHMLV---RDSLRDMSSRDASHLIATSLLGQENWKLGTKRIFLKESQDVLLEESRAQLLSSKIIFLQRAMRRYLRMRRARRTRKGAVLIQSRWRGYRNRKAFLAMKRGFARLQATFRAR 800          
BLAST of Dach-1 vs. Ensembl Nematostella
Match: EDO41819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3A8])

HSP 1 Score: 544.273 bits (1401), Expect = 1.932e-165
Identity = 337/874 (38.56%), Postives = 480/874 (54.92%), Query Frame = 3
Query:  186 VWIENKSSTKTSQLVPIGAKIKDIVKDQI-TVIDDDGHEFILKPGTK----IRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRY-KRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQ--HSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSM-DSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNT-CSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILF-EKDFKMGFDTRKRAP---------------TLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKN-ILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIR 2726
            VWI +        LV IG ++   ++D+I  ++ +DG E I+         +R+  +  L G +D+ +L  L+E  +L NL +R+ + N IYTY G +LVA+NPY  LP+Y P  +  Y+   +GD+ PHIFA+A++A+ +M R  R+QS+I+SGESGAGKT S K  +++ +AV G    + IE++V+ +NPI+EA GNAKTIRNDNSSRFGKY++I F  N  I GA +  +LLEKSR+V Q  +ERNYHVFY M     +     F L   D+++YLNQG    +    D   F  L  A+ ++   +DE   +F++L+A LHLGN+     L+   D C V   D      + LL +D   LRK L  + I+T  + ++  +SI +    R+A+ K IY +LF W+V  IN  +                ++  ++ IGVLDI+GFE F+ NSFEQ CINYANE LQQ F +H+FK+EQ+EY  E I W  I+F DNQ  +DLI  K   IL L+DEE + PKG+D     KL      K   F K +   +  F I HFA  V Y + GF+EKNRD  N + + L++ ++ + +  +F E D       RKRA                ++G QF  SL  LM+ L    P +VRCIKPN+ K   +F     ++QLR  G++ETIRI  AGYP R  + +F  RY +L+P        K  RET KL+ +  I D   +Q+GKTK+F +  Q   LE LR   L    ++IQK +R Y     +L+ + AAI IQ +VR    R           L ++  R K A+            +QR+ RG   R    +K  AI+ IQS  R
Sbjct:    3 VWIPHPD------LVWIGGELTKDIEDKILEILLEDGREIIIDTRKSRLPPLRNPEI--LVGENDLTTLSYLHEPAVLHNLNVRFIQSNAIYTYCGIVLVAINPYEELPLYGPDIVAAYRGRSMGDMDPHIFAVAEDAFQSMIRDERNQSVIVSGESGAGKTVSAKYAMRYFSAVGGASTETQIEKKVIATNPIMEAIGNAKTIRNDNSSRFGKYLEISFDRNHHIIGAHMRTYLLEKSRVVFQAAEERNYHVFYQMCAACELPEMKDFRLAHPDNFSYLNQGDAPVVDSIDDADCFEELREALSMVGINDDEQLMLFRILSAILHLGNVEI---LQAGDDECTVEENDFHLEMTAVLLGIDKNQLRKWLCNRKIVTVGEVLIKPLSITEANYGREAISKRIYSQLFKWVVNTINCTL--------------TSTSKPHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFTQHVFKLEQDEYVREEIQWSFINFYDNQPCIDLIEAK-LGILDLLDEECKMPKGSDSQWAQKLYKQHLQKSKHFSKPRMSNLA-FVIHHFADHVEYFVSGFVEKNRDTVNDEHLALLRASEDEMVGEMFTENDAHSA--PRKRAASRAGKQGGKGGKMFKSVGSQFSVSLSKLMETLNSTTPHYVRCIKPNDTKAPFEFHPKRSIQQLRACGVLETIRISAAGYPSRWTYREFFARYIMLLPS--KKINRKKPRETIKLILETFIKDEDMFQMGKTKIFFRAGQVAYLEKLRGDKLRRSCVMIQKNYRCYREHKLYLRMRKAAILIQAWVRGDQARN----------LARSLRRNKSAT-----------TIQRYYRGFHLRQAYLRKHAAILTIQSYAR 824          
BLAST of Dach-1 vs. Ensembl Nematostella
Match: EDO49515 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF6])

HSP 1 Score: 507.294 bits (1305), Expect = 9.959e-154
Identity = 291/776 (37.50%), Postives = 436/776 (56.19%), Query Frame = 3
Query:  339 VSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIE---QQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGL-RASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKA-KLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFP-KGTDHSLLNKLVNTCSKHP--------RFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDIL-LEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDL 2621
            + ++ GV DM+ L  L E  I+ NL  RY    IYTY G ++V++NPY   P+YT + I  Y++  I +L PHI+AIAD+AY +MR  ++DQ III+GESG+GKTE++K+I+Q++AAV G+   ++   +Q+L SNPILEAFGNAKT+RNDNSSRFGKY+DI F   G   G  I ++LLEKSR+V Q + ERN+H+FY +L G          L R  D Y YLNQ   + +    D  DF  +  AM+V+ FTEDE   +++LL+A L+LGN   +        ++  V  +       ++LQ D E L  +L  + + T+ + V T +++AQ    RDAL K +Y RLF WIV+++N +I               +   K   IGVLDI+GFE F +NSFEQ  INY NE LQQ F+    K EQEEY  E I+W  I + +N    +LI   +  ILAL+DEE   P + +D + L KL      H         +++  K      F ++H+AG V Y +DGFL+KN D     L + + +      K LF +       +++R  T   QF++S+  LMK L  + P ++RCIKPNE K    FD  L   Q+RY G+ME IR+R+AG+  R E+P  + RY++L P    ++         +L+    + P  Y  G+TK+F+++ + +  LE+ R   + +  ++IQK +R +  + Q+   + + I I  + R    +R + +M+    L+ +  R   A K  + +
Sbjct:   17 LDNMVGVSDMVLLEPLTEDAIMENLWDRYNAKAIYTYIGNVVVSINPYRKFPLYTREVIAEYRSRNIYELPPHIYAIADDAYRSMRDHNKDQCIIITGESGSGKTEASKVIMQYVAAVCGKGREVDRVKEQLLQSNPILEAFGNAKTLRNDNSSRFGKYMDIEFDFKGDPVGGVITKYLLEKSRLVYQNKGERNFHIFYHLLRGASDNLLDDLRLTRDFDGYHYLNQSECVSVPTKDDKEDFSVVEKAMEVVGFTEDEISAVYKLLSAILNLGNTELEEFTTSDGTEAVTVLNEQVLKNTCEMLQCDVELLLNSLRERTVETKTERVHTPLNVAQASYARDALAKAVYQRLFAWIVDRVNDSI-------------QVRKRGKRKVIGVLDIYGFEIFVDNSFEQFIINYCNEKLQQIFIELTLKSEQEEYVREGIEWTTIEYFNNAVICELIEKNHSGILALLDEECLRPGEVSDLTFLEKLDKQWIHHEHYESRKDKKYLSDKTLPHGYFRLKHYAGKVTYDVDGFLDKNNDLLFRGLSQCMYSCNHPLTKKLFPEGCPTK-SSKRRPKTTATQFKESVAELMKNLKSKNPNYIRCIKPNERKAAGVFDERLIKHQVRYLGLMENIRVRRAGFAFRQEYPVALQRYKMLCPRTWPNWLGAPRDGIVELLKHLNVKPTEYAYGRTKIFIRNPRTLFALEEKRKDGMEDLAVIIQKIFRGWRRKKQYQNMRRSEITIAKYYRRFRDQRDYRRMRNAAILIASYARGWKARKAYRAI 778          
BLAST of Dach-1 vs. Ensembl Nematostella
Match: EDO31924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWK4])

HSP 1 Score: 490.73 bits (1262), Expect = 1.353e-153
Identity = 263/613 (42.90%), Postives = 374/613 (61.01%), Query Frame = 3
Query:  432 NEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLA-AVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRK---RAP-------TLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDR 2237
            N + TY G+IL++VNPY  L  YTP+ ++ Y +  IG L PHIFAI   AY  +++    Q I+ISGESGAGKTESTK ++Q+LA A   + S   +Q++++ P+LE+FGNAKT++NDNSSRFGKY++I+F   G+I GA+I ++LLE+SRIV Q+R ERNYH+FY ML GLP E + +  L++++ + YLN+G  + +    D+  F  + SAM++L  +E E   IF  LAA LHLG+  F   L    D   +  + E    + LL LD++ L KAL  K    R + + +  +  Q I+ RDA+ K +Y R+F W+V ++N  ++                  + +SI +LDIFGFE+F  NSFEQLCINYANE+LQ FF + IFKMEQ+EY  E I W  + +TDNQ  LDL+      IL L+ +ES FPK TD S L K          ++K K  + + F + HFAG V Y++ GFL+KNRD    DL +L+  T S+ +  +     KM  + RK   +AP       T+  +F  SL  L+  +    PFFVRCI+PN  K   +F   L L Q+RY G++ET++IRK G+PIR  +P+F+ R
Sbjct:   32 NSMRTYIGKILLSVNPYKQLDSYTPELVEKYADQAIGRLPPHIFAIGSAAYAEIQKGGAHQVIVISGESGAGKTESTKQLVQYLATANPTKGSLTTEQIVEATPLLESFGNAKTVKNDNSSRFGKYLEIFFDSEGSICGARISEYLLERSRIVGQVRKERNYHIFYEMLAGLPQEKKQQLQLKSAEEHHYLNKGHGL-IQKRCDLAAFSKVISAMEILEISESERDGIFTTLAAVLHLGDAGFYKGLASAHDVAVLRDEHEAEITAHLLGLDAQHLIKALMHKQTEARGEQIFSPRNTEQAIDARDAIAKELYSRVFTWLVNRVNGMVFH---------------GKQRSSIAILDIFGFEDFRINSFEQLCINYANESLQFFFNQFIFKMEQDEYTIEGIPWHEVKYTDNQACLDLMAKPPHGILHLLSDESNFPKATDLSFLEKCHQYHKASKAYVKPKMHVPE-FAVSHFAGTVTYKVHGFLDKNRDGLKQDLTDLLCKTNSEVMMEI--GSLKMPRENRKNSLKAPPNSIQKSTVCAKFNDSLIRLVVAMKRCNPFFVRCIRPNPDKAPDEFVEKLVLDQIRYCGILETVKIRKTGFPIRIVYPNFVKR 625          
BLAST of Dach-1 vs. Ensembl Medaka
Match: ENSORLT00000002420.2 (myosin VIIA [Source:NCBI gene;Acc:101165746])

HSP 1 Score: 2125.9 bits (5507), Expect = 0.000e+0
Identity = 1120/2207 (50.75%), Postives = 1505/2207 (68.19%), Query Frame = 3
Query:  174 KGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILD-PKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNAL-NDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTN-RKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFS---DRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSAS-SLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQL-EFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSSN 6737
            +GD+VW++ K+  +    VPIGA +K     QI V+DD+G+E  + P   T I+ MH +S+ GV+DMI LGDLNEAGILRNLLIRY+   IYTYTG ILVAVNPY +LPIYT  +I+ Y N KIG++ PHIFAIADN Y NM+R +RDQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++NPILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q  DERNYH+FYCML+G+  E + + GL  +  Y YL  G      G  D+ ++  + SAMKVL FT+ E  EI +LLAA LH+GN+ ++A+   N+D+CEV        AS LL++D +DL   LT++ +ITR + V T +SI Q +++RDA VKGIYGRLFVWIVEKIN AIY+P  SQ PK+            IG+LDIFGFENF  NSFEQLCIN+ANENLQQFFVRH+FK+EQEEY  E I+WQHI FTDNQ+ LD+I +K  NI++LIDEES+FPKGTD ++LNKL      +  +I  K +    FGI+HFAGVV+Y+  GFLEKNRD    D+++L+ ++K++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNE+KK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F+DRYR+L+PG+  +++ +D R T + + + +L     +Q+GKTK+FLKD  D+LLE  RDKA+++++ILIQK  R Y  R+ FLK + +A+ IQ   R    R+ +  ++ GF  LQA  R++         +  I   Q  CRG L R   + +  A+I IQ+  R   A + F+ LK +  +  EA  ++  +E   KNQMS ++A  EAE++H+ RL Q+  E     +++ ++    K+ + + E+ R +PV++S+M+D++FG +   +  S+P     AP  F DLE +    +  D+             +  +ED+SE+ F K+AATYFQ      + R+PL++PLLFH +   Q++ALAVWI +LRFM DLPEP  + +    +  +P+MTKIY++LG++  K+++     +A Q     P  + + +T+ R  +VSLTLKKKSK T+EV   LND E  L+    +S+LE+RPTSNLEKLHFIIGNGIL P LRDEIYCQICKQL  NP   S +RG IL++LC+GCFAP++KFV+ LRNFI       A +   RL+RTF NGTR QPPSWLEL+A K K+P++L V  M+G T+T+  DSA+TA+ELC+ LS K+ L+D+FGFSL+IA+ DKVSS+GSG DHVMDA+SQCEQ+AKE+G  E  A WRLFFRKEIFTPWH+  +D VAT+LIY Q++RG+KFGEYRCD  DD+ +L + Q  +D   ++  E L      Y+P   +  +K  +K W   +  A K    T ++    S+K+KEE+V FAR KWP+LFSRFYEA KFSGP+L  +++I  +NWTG+Y VD  E++ LELSFPEI AVSSSR          ++  QS +L+T+KG  YTF  +N+EDIRDL+V FLEGL++RS + + +Q    P   +S+FLS  KGDL++L+  D    +  S W +G N RT + GDFP D +Y+LP +  P Q+I+AL +   D+               + + K +TLEEFS  YFR P   + S  M    +    LW  +R+ LK PLLKK++N EDL Q+A        +YMGD PSK   S  E+ + IF+  LK E LKDE+YCQ++ Q+T N    SE+ GWEL+WL TG+  P++ L   +    +S     L+ +C  R+ K L+ G R+YPPH +E+ A+Q     I HK+YFP+++ +AFE+ S+TK KD C+NI +++ LK  +GF+LFVK  DK IS+PEGDFFFDF+R L+DW+KK RP KDG +    YQVFFMKKLWT+TVPG D  AD +FHY QE+ KYL GYHK   ++   LGALI R   ++D S   +  + L  L+P D++ +    + ++ ++A ++     S  +AK+ FLKII++WPTFGSAFFEVKQ+T  N PE +LIAINK+GV LI  KTK+ L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLTT+ K  S 
Sbjct:   50 QGDYVWLDLKTGREFE--VPIGAVVKLCDSGQIQVVDDEGNEHWISPQNATNIKPMHPTSIHGVEDMIRLGDLNEAGILRNLLIRYREKLIYTYTGSILVAVNPYQLLPIYTADQIRLYTNKKIGEMPPHIFAIADNCYFNMQRNNRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQAHDERNYHIFYCMLKGMTAEEKKKLGLSKATDYTYLTIGKCTVCDGRDDLKEYSNIRSAMKVLMFTDRENWEISKLLAAILHMGNLQYEARTYDNLDACEVVRSPHLTTASALLEVDFKDLMNCLTSRTLITRGETVSTPLSIEQALDVRDAFVKGIYGRLFVWIVEKINAAIYKPPSSQ-PKAGRRC--------IGLLDIFGFENFVVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLENINWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDATMLNKLNFQHKLNTNYIPPKNNHETQFGIQHFAGVVYYETKGFLEKNRDTLYGDIIQLVHSSKNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMMETIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQEDLRGTCQKIAEAVLGRDDDWQMGKTKIFLKDHHDMLLEIERDKAITDKVILIQKVVRGYKDRSNFLKMRKSAVFIQKTWRGYHCRKNYGAVRTGFSRLQALVRSRKLCASYHVARQRITVFQGRCRGYLVRRAFRHRLWAVITIQAYTRGMIARRLFRRLKGEYRRRLEAEKMRLAEETKLKNQMSAKRAKAEAERKHQERLAQLAKEDAEREKKEKEEARRKKEMVEQMEKARKEPVNDSDMVDKMFGFLG--TTSSLPGQEGQAPAGFEDLERTHHELMEEDLDEALPLPD-----DDEEEDLSEYKFAKYAATYFQGTSTYTYVRRPLKQPLLFHDDEGDQLAALAVWITVLRFMGDLPEPKYHTAINDGSEKIPVMTKIYETLGKKTYKREL-----QALQANGETPLSDSNKKTSVRHKLVSLTLKKKSKITEEVTKRLNDGEYGLHG---NSMLEDRPTSNLEKLHFIIGNGILRPGLRDEIYCQICKQLTQNPSKSSHARGWILISLCVGCFAPSDKFVKYLRNFISNGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPVMLPVTFMDGTTKTLLTDSATTAKELCNALSDKVNLRDRFGFSLYIALFDKVSSLGSGNDHVMDAVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHDPTEDQVATNLIYQQIVRGVKFGEYRCDR-DDLAELASQQYYVDYGSEILLERLLSLIPSYIPDREVSSSKTVEK-WAHFIMAAHKKGIYTQKR--FDSQKVKEEVVDFARHKWPLLFSRFYEAFKFSGPNLPKDDLIVAVNWTGVYFVDEQEQVLLELSFPEITAVSSSR--------GGKMQSQSFTLATIKGEEYTFTSSNAEDIRDLVVTFLEGLRKRSKFVVALQDNPNPAGEESTFLSFLKGDLIVLD-QDTGEQVLNSGWAHGINERTNQKGDFPVDCIYVLPAMTRPQQDIVALITMTPDQRQESVRSSQIILPDTEGKLKPYTLEEFSYDYFRPPPKHTLSRVMVTKNRGKDKLWSCTREPLKQPLLKKVVNHEDLAQEAC-------MYMGDYPSKRTRSVNELTDQIFEGALKAEPLKDEIYCQILKQLTDNHVKYSEEKGWELLWLCTGLFPPSNVLLPHIQRFLQSKKHHPLSADCMQRVHKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCKNISTRLLLKSAEGFSLFVKISDKVISVPEGDFFFDFVRHLTDWIKKSRPAKDGIVPSLTYQVFFMKKLWTSTVPGKDSFADSIFHYYQELPKYLRGYHKCSREEVFQLGALIYRVKFEEDKSHFPTIPKMLRELVPQDLIRQMSPDDWKRSIVAHFNKHAGKSREEAKLMFLKIIYKWPTFGSAFFEVKQTTEPNYPEILLIAINKHGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTTMNKQRSG 2210          
BLAST of Dach-1 vs. Ensembl Medaka
Match: si:ch73-194h10.2 (unconventional myosin-VIIb [Source:NCBI gene;Acc:101163405])

HSP 1 Score: 1609.73 bits (4167), Expect = 0.000e+0
Identity = 929/2225 (41.75%), Postives = 1338/2225 (60.13%), Query Frame = 3
Query:  177 GDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDG--HEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIY-TYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDT-----------------------RKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRIL----VPGIPSSFRCKDTRETTKLVCKNIL-DPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLEL-KAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRI----DNVKDLSDETLHKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPDSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGN-LWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSST-EIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRE---LLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNES--VQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTEL-QQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVK--QSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLML 6710
            GDFVW++          VPIGA+++     Q+ ++DD+G  H+   K   KIR MH SS+ GVDDMI LGDLNE G+LRNLL+R+K  +IY TYTG ILVAVNPY +LPIYT   +  Y + ++G+L PH+FAIAD+ + NMRR  ++Q  +I GESGAGKTESTKL+LQ+LAAVSGQHSWIEQQ+L++NPILE FGNAKTIRNDNSSRFGKYID+ F  +GAIEGA+I+Q+LLEKSR++ Q  +ERNYH+FY ML G+  + +    L  +  Y YL  G      G  D+ +F    SA+K+LTF+E +  EIF+LLAA LHLGN+ F+  +  NM+ CE+   S FN AS+LL++D + L  +LT +++ T  + V   ++ AQ ++ RDA VK +YG+LF+W+V KIN+A+Y+ A           +      SIG+LDIFGFENF  N FEQLCIN+ANE LQQFFV+H+FK+EQ+EY+ E I W+HI + DNQ+TLD++  K  N+LALIDEES FPKGTD +LL K+     K   +I+ K     +FGI HFAG V+Y    FLEKNRD F++D++++++ + ++ L+  F+ +      T                       +KR PTL  QFR+SLDSLMK L   +P+F+RCIKPN+FK+ + FDR LC+RQLRYSGMMETI+IRKAGYP+R+ F +F+DRYR+L    +    S  +C +T      +CK++L + K ++ GKTK+FLKD  D  LE  R   L+ + +LIQ+  R Y +R +FLKK+SAAI +Q   R    R+ F  ++ GF  LQA  R++    + K  +     +Q H RG   R   ++K  A+I +Q+  R                       L ++     K  M      +EAE+R  +   Q H E +   +QQ++             +++++ +   E++D++F    G+   SV      AP  F ++E  R   + +   I    + + L     +D+ EFTF+KFA+ YFQ      + R+ LRKPLLFH +     ++L VW  ILRFM DLPEP   Q+R  Q NS             +F  QD++   +       G+  E++                             D + P    TL     +RP ++LEKLH I+G GI+  +L DEI+CQICKQL DN   +S  RG ILL+LC+G F P+++F R L++FI+   RD A +   RL+RT  NG R +PP+WLEL +A K ++P+I++V  MNG +  +  DSA+T++E+C ++  KI L D FGFSL++A+ +KV ++GS  DHVMDAISQCEQ  K KG  E  A WRL  RKEIFTPWH+   D V+TDLIY Q+I+G+KFGEY+   +DD+ +L A  L I    D+  D   E + + +  +++   K + K+   +     +    +SRK   + + +K EIV FAR +WP+ FSRF+E  K S P L  ++ I  INWTGI  +D  E+  LELSFPE+  V+SS               Q++ L T+K G++T + + +ED+ +LI  FL GL ERS YA+ ++  S  D + L+ +KGDL+I+  ++ +  +    W  GEN  T++ G  P + + ILP +  P+   L         +          +  R    TL+EFS  YF+     +R     + +  A   LW HSR+ ++ P L+KL+   +L Q+A   F+ IL YMGD P++   +  E+ + IF P  ++E L+DE+YCQ++ Q+TSN N      GW+L+WL  G+  P+  L +     LE  R  +  LA +C  RLQ +L M  R+ PPH +E++A+Q     I HKI+FPN++  +Q  E+ + TK +DL ++I  K+ L    G++LFVK+ DK IS+ + D+FFD +RQ++DW KK + +KDG +   Y VFFM+KLW N +PG D  AD++FH+PQEV KYL GYH     + + + AL+ RA   KD S++    + L  L+P D L    + E  +Q +   Y+   +M+ ++AK+ FLK + +WPTFG AFFEVK  Q++  + P+ + IAI+K G+ +IH KTKE L  +P++ I++W SG+TYF+MTIG+L+ G K LCET LGYKMDDL+TSY+++ L
Sbjct:    1 GDFVWVDPGVG------VPIGAEVQLTDTGQLQLLDDEGKVHKVDKKNEGKIRQMHPSSVTGVDDMIMLGDLNEEGLLRNLLVRHKEGKIYQTYTGSILVAVNPYQLLPIYTTDHVHMYTDQRLGELPPHVFAIADSCFFNMRRNRKNQCCVI-GESGAGKTESTKLMLQYLAAVSGQHSWIEQQILEANPILE-FGNAKTIRNDNSSRFGKYIDVNFNKSGAIEGARIEQYLLEKSRVIRQAPEERNYHIFYYMLMGMSADQKKILSLGTAADYKYLTMGNCTSCEGRDDVKEFAHFRSALKILTFSEADSWEIFKLLAAILHLGNVEFET-IVSNMEGCELCKCSHFNMASQLLEVDPKALETSLTQRSVSTIKETVSKFLTRAQAVDGRDAFVKALYGKLFIWVVNKINSAVYKTA----------EEDKDLQQSIGLLDIFGFENFTKN-FEQLCINFANEQLQQFFVKHVFKLEQDEYSRENIVWKHIEYQDNQKTLDVLASKTMNMLALIDEESNFPKGTDTTLLQKMNQFHEKGNVYIRPKNVHETVFGIRHFAGEVYYD-SQFLEKNRDAFSSDMIQVVEASTNKLLRQTFQNELSSSSKTIKSSSNPRMVITMSKSSTNKTPEKKRVPTLIGQFRQSLDSLMKTLSACQPYFIRCIKPNDFKRPMLFDRDLCMRQLRYSGMMETIKIRKAGYPVRYTFKEFLDRYRVLLKTSICNPESEEKCCET------ICKSVLKEDKDWKTGKTKIFLKDIHDTKLEVERMIELNTKALLIQRVLRGYKYR-EFLKKRSAAIVLQKNWRGHKGRKLFKMVQLGFARLQAQVRSRHLHLQYKRKRQAALVLQTHIRGYQARKEWQRKRNAVIVLQTHTRGV---------------------LARRALQKMKRDMYLSAKEKEAEQRALLE-KQKHLEEILWRRQQME------------AQKQSESMSAMELVDDMF----GFLPDSVGGQEGQAPVGFENIEGKR--TIIEEIDIDELPIEENLPQEDYDDLDEFTFSKFASMYFQGGVTSTYIRQRLRKPLLFHEDEEDVQASLTVWWIILRFMGDLPEP-KKQTRV-QLNSPQ----------ERFMPQDLVARKDRRLSHMVGLDQEDI-----------------------------DPDEP----TL-----DRPLTSLEKLHIIVGYGIVRQDL-DEIFCQICKQLQDNSNTNSCLRGWILLSLCLGVFPPSDRFTRYLQSFIRGAPRDFASYCAERLRRTRMNGARGEPPAWLELQQATKTRKPMIVSVRLMNGVSINVPVDSATTSKEICQMVCNKIKLTDSFGFSLYVAMYEKVWALGSARDHVMDAISQCEQEVKRKGGQERHAPWRLVIRKEIFTPWHDCKKDKVSTDLIYKQIIQGLKFGEYQSKKEDDIVELTAKHLYIQHGRDSRPDYVKEAVQECVSNSLLE-AKSEAKWVQMVSTAHSQGQFVSSRK---TEDAVKAEIVDFAREEWPIFFSRFFEVTKVS-PPLQKSKFIVAINWTGITFLDEREKRLLELSFPEVTGVNSS---------------QAVCLLTLK-GDFTLSGSKAEDMGELITMFLGGLTERSQYAVALKDASGQDPTLLNFKKGDLIIIIKDNEL--LEGRGWVKGENDSTRKRGAVPVEAILILPTLTKPTNESLINLPPNQRKNLIQTNQKETGSVGRAPLATLKEFSVQYFQPIKDVNRQV---ISRNAAPERLWAHSREPIRQPFLQKLVGNPELSQKACLAFT-ILKYMGDYPTRQVQNPLELTDQIFSPATENEALRDEIYCQIMKQMTSNNNIDQ---GWQLLWLCCGLFPPSQALLKHTQRFLETRRRDA--LASDCLQRLQSSL-MEPRKLPPHHVEVDAIQQNSTKIFHKIHFPNDTMELQTLEVATGTKVRDLIKSISKKLNLISADGYSLFVKAQDKVISLNDTDYFFDSLRQITDWSKKSKQMKDGPVNIPYLVFFMRKLWFNVIPGKDTQADLIFHFPQEVPKYLRGYHTCSKDEMVNIAALLFRAKFGKDNSQMAMLTKMLKELVPADQLKAISENEWKKQNIATSYNKQGNMTADEAKVGFLKAVSRWPTFGCAFFEVKFQQTSEPSFPDIVRIAISKLGLTIIHPKTKEVLATHPFNRIASWCSGSTYFHMTIGSLVKGNKFLCETSLGYKMDDLITSYVNVYL 2073          
BLAST of Dach-1 vs. Ensembl Medaka
Match: myo7ab (myosin VIIAb [Source:ZFIN;Acc:ZDB-GENE-091110-4])

HSP 1 Score: 1113.21 bits (2878), Expect = 0.000e+0
Identity = 595/1192 (49.92%), Postives = 804/1192 (67.45%), Query Frame = 3
Query:  174 KGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKP--GTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPK-----GYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELR 3728
            +GD+VW+++K+  +    VP+GA +K     QI V+DD+G E  + P   T I+ MH +S+ GV DMI LGDLNEAGILRNLLIRY  + IYTYTG ILVAVNPY +LPIYT   I+ Y N KIG++ PHIFAIADN Y NM+R ++DQ  IISGESGAGKTESTKLILQFLAA+SGQHSWIEQQVL++ PILEAFGNAKTIRNDNSSRFGKYIDI+F   GAIEGAKI+Q+LLEKSR+  Q  DERNYHVFYCML+G+  E +++ GL  +  Y+YL  G   +  G  D+ ++ ++ SAMKVL FTE E  EI +LLAA LH+GN+ F+A+   N+D+C V    +   A+ L++++ +D+   LTT+ +ITR + V T +S+ QG+++RDA VKGIYGRLFVWIV+KIN AIYRP          + +S+    S+G+LDIFGFENF  NSFEQLCIN+ANENLQQFFVRH+FK+EQ+EY  E I WQHI FTDNQ+ LD+I  K  NI++LIDEES+FPKGTD ++L KL +    +  +I  K      FGI+HFAGVVHY+  GFLEKNRD  + D+++L+ +++++F+K +F+ D  MG +TRKR+PTL  QF++SL+ LM+ L   +PFFVRCIKPNE KK + FDR LC+RQLRYSGMMETIRIR+AGYPIR+ F +F+DRYR+L+PGI  S   +D R T    C+ IL  +      +QIGKTK+FLKD  D+ LE  RDKA++N++ILIQK+ R    R  FL+ +SA   +Q   R    R+K+  MK GF  LQA  R++   +  +  +  +  +Q  CRG L R    +  +A++ IQ+  R     +  + L+ +  +  +A   +  +E   +NQM+  +A  EAE++H+ RL Q+  +     ++  ++    K+ + + ER ++QPVD S+M+D +FG +       +PN    AP  F DLE S   A  +     G  +P+      +ED+S+F F+KFAATYFQ      + R+ L++PLLFH +   Q++ALAVWI +LRFM DLPEP         +  +P+MTKIY++LG++  K+++ +   E E     +   N    + R  +VSLTLK+KSK T+EV   L +  +       +S+LEERPTSNLEKLHFIIGNGIL P LR
Sbjct:   11 QGDYVWLDHKTGREFD--VPVGAVVKLCDSGQIQVLDDEGQEHWIFPQNATNIKPMHPTSIHGVQDMIRLGDLNEAGILRNLLIRYNEHVIYTYTGSILVAVNPYQLLPIYTADHIRLYTNKKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQAPDERNYHVFYCMLKGMAPEMKAKLGLGLATDYSYLTMGNCTECDGRNDLREYSSILSAMKVLMFTETEIWEISKLLAAILHMGNLRFEARTYDNLDACVVVRSPDLVTAASLMEVEPKDVMVCLTTRTLITRGESVTTPLSMNQGLDVRDAFVKGIYGRLFVWIVDKINAAIYRPP---------SCESSLIRRSMGLLDIFGFENFFVNSFEQLCINFANENLQQFFVRHVFKLEQKEYNLEDISWQHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDATMLYKLNSQHKLNCNYIPPKNSYETQFGIQHFAGVVHYESRGFLEKNRDSLHTDIIQLVHSSRNKFIKQIFQADVAMGVETRKRSPTLSSQFKRSLEMLMRTLSVCQPFFVRCIKPNELKKPMLFDRELCIRQLRYSGMMETIRIRRAGYPIRYSFAEFVDRYRVLMPGIKPSHLQEDLRGT----CQQILTARLGKHEDWQIGKTKIFLKDQHDMQLEIDRDKAITNKVILIQKSVRGLQARKNFLRLRSAVTVLQKAWRGYQCRKKYRIMKTGFLRLQAVCRSRKYYRSYRKTRLRVTLLQARCRGFLVRQAFARHLRAVLTIQAYTRGMIGRRLCQRLRAELQRRLQAERQRLAEEEQLRNQMTMRRAKAEAERKHQERLVQLAQQQEEREREVKEEARKKKELLEQMEREKDQPVDHSDMVDRMFGFLGDSG--PLPNQDGQAPTGFEDLERSAC-AEEEEVLGEGLRLPEE----EEEDLSQFKFSKFAATYFQGVSTHTYIRRALKQPLLFHEDEGDQLAALAVWITVLRFMGDLPEPKCQLVINDGSEKIPVMTKIYETLGKRTYKRELQELQVEEEVRWPDVQKRN----SVRHKLVSLTLKRKSKITEEVARRLTEGGD--YALQGNSMLEERPTSNLEKLHFIIGNGILRPTLR 1174          
BLAST of Dach-1 vs. Ensembl Medaka
Match: ENSORLT00000041909.1 (pep primary_assembly:ASM223467v1:14:27127847:27148802:1 gene:ENSORLG00000021923.1 transcript:ENSORLT00000041909.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 928.317 bits (2398), Expect = 0.000e+0
Identity = 488/975 (50.05%), Postives = 650/975 (66.67%), Query Frame = 3
Query: 3858 LRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETL----HKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKP---DSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYGGGSN-----NNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSS-TEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSL-LALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKL-IQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSSN 6737
            LR F++      A +   RL+RTF N TR QPPSWLEL+A K K+PI+L V  M+G T+T+ ADSA+TA ELC+ L+ KI L+D+FGFSL+IA+ DKVSS+GSG DHVMDA+SQCEQ+AKE+G  E  A WRLFFRKEIFTPWH+  DD VAT+LIY Q+IRG+KFGEYR + +DD+ +L + Q  +D   ++  E L      Y+P   I  TK  +K+           L  ++ +  + ++++KE++V FARLKWP+LFSRFYEA KFSGPSL  N+VI  +NWTG+Y VD  E++ LELSFPEI AVS       + +   +L GQS +L+T+KG  YTF   N+EDIRDL+V FLEGL++RS Y + +  +  P   DS+FLS  KGDL+IL+ +D    +  S W +G N RTK+ GDFPAD VY+LP I  P  +I+            G G       + + + R K +TLEEFS  +FR P   + S  M    +    LW  SR+ LK PLLKK+L  E+L Q+A   F  IL YMGD PSK   S +E+ + IFD  LK E LKDE++CQ++ Q+T N    +E+ GWEL+WL TG+  P++ L   + +  ++     LA +C  RLQK L+ G R+YPPH +E+ A+Q     I HK+YFP++S + FE+ S+TK KD C NI  ++ LK  +GF+LFVK  DK IS+P+GDFFFDF+R L+DW+KK R VKD      YQVFFMKKLWTNTVPG D +AD +FHY QE+ KYL GYHK   ++   L ALI R   ++D S  Q   + L  L+P D +      + ++ ++  Y+     +  DA+++FLK+I++WPTFGSAFFEVKQ+T+ N PE +LIAINK+GV LI  K+KE L  +P++ ISNWSSGNTYF++TIGNL+ G KLLCET LGYKMDDLLTSYIS MLTT+TK  ++
Sbjct:    5 LRTFLKNGPPGYAPYCEERLRRTFVNRTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLADSATTASELCNALADKINLRDRFGFSLYIALFDKVSSLGSGSDHVMDAVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHSPADDYVATNLIYQQIIRGVKFGEYRSEREDDLAELASQQYFVDYGSEILQERLLSLIPSYIPDREITSTKTVEKW---------AQLVISAHRKVLDTQQVKEDVVDFARLKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEITAVS-------MGNRGGKLQGQSFTLATIKGDEYTFTSNNAEDIRDLVVNFLEGLRKRSKYVVGLLDYPNPAGADSNFLSFSKGDLIILDEHDG-EHVMNSGWAHGINDRTKQRGDFPADYVYVLPAITRPQYDIVV----------SGDGKQPPKFASFYTELRSKAYTLEEFSYDFFRPPPKSTLSRVMISKTRGKERLWSCSREPLKQPLLKKVLAHEELSQEACLAFIDILWYMGDYPSKRVRSVSELTDQIFDGALKAEPLKDEIFCQILKQLTDNHI--NEEKGWELLWLCTGLFPPSNVLLPHVQKFLQAKKHYPLAPDCMQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDSDEVFEVESSTKAKDFCHNISGRLMLKSSEGFSLFVKITDKVISVPDGDFFFDFVRHLTDWIKKARHVKDVLPPLTYQVFFMKKLWTNTVPGRDTMADSIFHYYQELPKYLRGYHKCSREEVHQLAALIYRVKFEEDKSHFQDVSKVLKDLVPQDQIRLLSPDDWKRSIMTLYNKHSGKTREDARLSFLKVIYKWPTFGSAFFEVKQTTDPNYPETLLIAINKHGVSLIDLKSKEILITHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTTMTKQRAS 950          

HSP 2 Score: 115.931 bits (289), Expect = 2.536e-25
Identity = 103/384 (26.82%), Postives = 182/384 (47.40%), Query Frame = 3
Query: 3696 IGNGILIPE-LRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFR-----DCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIF-ADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIES---KAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLS-----DETLHKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARL--KWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVD-SNERIHLELSFPEIVAVSSSRT 4793
            I +G L  E L+DEI+CQI KQL DN    +  +G  LL LC G F P+   +  ++ F+Q         DC +    RLQ+   NG+R  PP  +E++AI+HK   I        +++ +F  +S++ A++ C  +S ++ LK   GFSLF+ I DKV S+   GD   D +     + K+   ++       +++FF K+++T      D +  +   Y+Q +     G ++C + +++ +L A   R+   +D S      + L   +PQ  I +       W   +       +  +R+D+          ++F ++  KWP   S F+E  + + P+     ++  IN  G+ L+D  ++ I +   F +I   SS  T
Sbjct:  541 IFDGALKAEPLKDEIFCQILKQLTDNHI--NEEKGWELLWLCTGLFPPSNVLLPHVQKFLQAKKHYPLAPDCMQ----RLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDSDEVFEVESSTKAKDFCHNISGRLMLKSSEGFSLFVKITDKVISV-PDGDFFFDFVRHLTDWIKKARHVKDVLPPLTYQVFFMKKLWTNTVPGRDTMADSIFHYYQELPKYLRGYHKC-SREEVHQLAALIYRVKFEEDKSHFQDVSKVLKDLVPQDQIRLLSPDD--WKRSIMTLYNKHSGKTREDA---------RLSFLKVIYKWPTFGSAFFEVKQTTDPNY-PETLLIAINKHGVSLIDLKSKEILITHPFTKISNWSSGNT 904          
BLAST of Dach-1 vs. Ensembl Medaka
Match: myo1b (myosin IB [Source:NCBI gene;Acc:101175446])

HSP 1 Score: 546.199 bits (1406), Expect = 4.385e-167
Identity = 298/774 (38.50%), Postives = 454/774 (58.66%), Query Frame = 3
Query:  354 GVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQH---SWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGL-RASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERN-MDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKG-TDHSLLNKLVNTCSKHPRFIKQKADIVKI----------FGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDI-LLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLK 2624
            GV DM+ L  L+E   L NL  R+  NEIYTY G +++++NPY  LPIYTP++++ Y+N    +LSPHI+A+AD AY ++R   +DQ I+I+GESGAGKTE++KL++ ++AAV G+    + +++Q+L SNP+LEAFGNAKT+RNDNSSRFGKY+DI F   G   G  I  +LLEKSR+V Q R ERN+HVFY +L G   ET  +  L R    Y YL       ++G  D  +F T+ +AM+++ F EDE Q + QL+AA L LGNI FK +   N +D   V   ++     +LL ++   L +A + + +  + + V T +++AQ    RDAL K +Y RLF W+V +IN +I              A++ +++  +GVLDI+GFE F++NSFEQ  INY NE LQQ F+    + EQEEY  E I+W +I + +N    DL+      ILA++DEE   P   TD + L+KL   C++H  F  + +   K           F I+H+AG V Y+++GF++KN D    DL + +       +K LF +      +  KR PT G QF+ S+ +LM+ L  + P ++RCIKPN+ K    F  SL   Q+RY G+ME +R+R+AGY  R  +   ++RY++L       ++    +    L+    +  + Y  G++K+F+++ + +  LE+ R + L +   LIQK +R +  R QFL  K + + +  + R     +K+ K+K+   ++Q+  R   A K L+ LK
Sbjct:   13 GVGDMVLLEPLSEDSFLENLKKRFDHNEIYTYIGSVVISMNPYRSLPIYTPEKVEEYRNRNFYELSPHIYALADEAYRSLRDQDKDQCILITGESGAGKTEASKLVMSYVAAVCGKGQEVNKVKEQLLQSNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERNFHVFYQLLSGASDETLKKLKLDRDVSKYNYLCLDS-ASVSGVDDAANFRTVRNAMQIVGFMEDEVQSVLQLVAAVLKLGNIEFKPESRSNGLDESRVKDKNDLKEMCELLGIEQSVLERAFSYRTVEAKSEKVSTTLNVAQAYYARDALAKNLYSRLFSWLVTRINGSI-------------KAQAKTRHKVMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTLREEQEEYIREGIEWTNIEYFNNAVICDLMENNQNGILAMLDEECLRPGTVTDETFLDKLNTICAEHQHFESRLSKNSKFLTDHSLPHNCFRIQHYAGKVLYRVEGFVDKNNDLLYRDLSQAMYKANHNLIKQLFPEGSPAKINL-KRPPTAGFQFKASVGTLMRNLQTKNPNYIRCIKPNDKKASHIFTESLVCHQVRYLGLMENVRVRRAGYAFRQAYEPCLERYKMLCKKTWPHWKGPARQGVEVLMADLKVPAEEYSYGRSKIFIRNPRTLFFLEERRRQCLQDLAALIQKIYRGWKCRRQFLLMKKSQVVVAAWYRRYAQEKKYKKIKRATTVMQSYARGWQARKLLRQLK 771          
BLAST of Dach-1 vs. Planmine SMEST
Match: SMESG000005090.1 (SMESG000005090.1)

HSP 1 Score: 4266.07 bits (11063), Expect = 0.000e+0
Identity = 2134/2193 (97.31%), Postives = 2147/2193 (97.90%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPDSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKLIQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSSN 6737
            MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRP+LSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKF+KMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRKFCALKKFKDLKKKDMKLKEALSLKKKDENIFKNQMSEEKAHEEAEKRHKMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGS+FGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPS   L   ++ +       C+N +   +   + + ++    I S             F  ILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKKKYWLALLNKAVKNLNETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPDSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYG GSNNN NDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVA NLWQHSRQLLKLPLLKKLLNKEDLCQQAVSCFSAILIYMGDQPSKNYSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKLIQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSSN
Sbjct:    1 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPSLSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFLKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRKFCALKKFKDLKKKDMKLKEALSLKKKDENIFKNQMSEEKAHEEAEKRHKMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSVFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSCSRLYERQYGD--YFCRFCVNSSRIVLDIVTENLSEGSIRIFS-------------FYRILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKKKYWLALLNKAVKNLNETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPDSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYGSGSNNNDNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVASNLWQHSRQLLKLPLLKKLLNKEDLCQQAVSCFSAILIYMGDQPSKNYSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKLIQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSSN 2178          
BLAST of Dach-1 vs. Planmine SMEST
Match: SMESG000005090.1 (SMESG000005090.1)

HSP 1 Score: 4242.96 bits (11003), Expect = 0.000e+0
Identity = 2126/2193 (96.94%), Postives = 2139/2193 (97.54%), Query Frame = 3
Query:  159 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRXXXXXXXXXXXXXXXXXXXXXXSLKKKDENIFKNQMSXXXXXXXXXXXXXMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSASTAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKKKYWXXXXXXXXXXXXETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVSSNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPDSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYGGGSNNNHNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQXXXXXXXXXXXXXEDLCQQAVSCFSAILIYMGDQPSKNYSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKLIQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSSN 6737
            MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRP+LSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKF+KMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRKFCALKKFKDLKKKDMKLKEALSLKKKDENIFKNQMSEEKAHEEAEKRHKMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGS+FGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPS   L   ++ +       C+N +   +   + + ++    I S             F  ILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKKKYWLALLNKAVKNLNETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSR        TSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPDSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYG GSNNN NDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVA NLWQHSRQLLKLPLLKKLLNKEDLCQQAVSCFSAILIYMGDQPSKNYSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKLIQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSSN
Sbjct:    1 MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPSLSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFLKMKKGFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIKIQSQIRKFCALKKFKDLKKKDMKLKEALSLKKKDENIFKNQMSEEKAHEEAEKRHKMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEMLDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSVFGTTMPDYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQDILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLNDAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQLADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIVFRLQRTFSNGTRNQPPSCSRLYERQYGD--YFCRFCVNSSRIVLDIVTENLSEGSIRIFS-------------FYRILDKVSSIGSGGDHVMDAISQCEQFAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFGEYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKKKYWLALLNKAVKNLNETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKFSGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSR--------TSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAIVVQAFSKPDSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGDFPADIVYILPIINFPSQNILALFSDRSFGDSYGSGSNNNDNDSRGKQHTLEEFSKIYFRTPSSGSRSFTMSLGKQVASNLWQHSRQLLKLPLLKKLLNKEDLCQQAVSCFSAILIYMGDQPSKNYSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKLIQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIRQLSDWVKKHRPVKDGQLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVKQSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFNMTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSSN 2170          
BLAST of Dach-1 vs. Planmine SMEST
Match: SMESG000061386.1 (SMESG000061386.1)

HSP 1 Score: 538.495 bits (1386), Expect = 2.982e-155
Identity = 308/785 (39.24%), Postives = 461/785 (58.73%), Query Frame = 3
Query:  321 KIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQ-----------QVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPAL-----SQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKM---GFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETT-KLVCK-NILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQASFRAKVASKKL 2612
            KI  +H+S  Q +D+M +L +L++  +L NL +RY +  IYTY G IL+++NPY  L IY  K I +Y+N  I D+ PH+F I +  Y  M R + +Q I+ISGESGAGKTES K +L++ A VSG    ++Q           ++LDS P+LE+FGNA+TIRNDNSSRFGKY++I+F  NG I G++I  +LLEKSRIV+    ER YH+FY +L GL    +S++  +    Y+YLN      +    D  +     S    L  T ++     ++L+A LHLGNI F   +E    S  V  ++     SK+L++D + L+  LT K   T  D  ++ ++  Q IN RD L K +Y  LF WIV K+NT + +  L     S V +S L+A SN  + SI +LDI+GFENF +NS EQLCINYANE LQQFF R++F++EQEEY  E I W +IS+ DNQ  +DL+  K   I+ ++++E   P+G+D S LNK  N   K+  + K K      F I HFAG + Y + GFLEKNRD    +++ +I+  +   +  +F K  ++       + R P +   F+ SL +L+  +   +P+F+RC+KPN  K+ L F++ + + Q++Y+G++ET++IRK+G+PI+  F  F+ R+ +LV          D +    KL+ K   +  K +++GKTKLFLK+     LE       +   ++IQ+ WR Y+     + +  AA KIQ+ VR  + RR+  K+  G   LQA  R ++A K+ 
Sbjct:    3 KIGKLHLSD-QRIDNMTNLVELSDQSLLSNLQVRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF---MEEQETSYLVETEN-IGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSN--FRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYISYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLTDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRF 779          
BLAST of Dach-1 vs. Planmine SMEST
Match: SMESG000056451.1 (SMESG000056451.1)

HSP 1 Score: 477.633 bits (1228), Expect = 1.428e-146
Identity = 286/762 (37.53%), Postives = 425/762 (55.77%), Query Frame = 3
Query:  234 IGAKIKDIVKDQITVIDDDGHEFILKPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSG-----------QHSWIEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDH-YAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISF-TDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLV-NTCSKHPRFIKQK----ADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILF----EKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVP-GIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWR 2450
            I   +++   D++TV  D G   ++K  + +  M+      ++DM +L  LN+A +  NL  RY +N IYTY+G   +AVNPY   PIYT + I  YK  + G++ PHIF+I+DNAY+NM     +QS++I+GESGAGKTE+TK ++ + A V+            +   +E Q++ +NP+LEA+GNAKT RN+NSSRFGK+I I+FG +G I GA I+ +LLEKSR++SQ + ERNYH+FY +L         +  + A    ++++NQ G + + G  D  +      A  +L F+++E   +F+   + +++G + FK +     +  E    +E    S LL ++++DL +A+    +   +++V    S  Q +    AL K +Y R+F W+V ++N               L+ K   ++  IGVLDI GFE FD N FEQ+CINY NE LQQFF  H+F +EQEEY  E IDW+ I F  D Q  ++LI  K   IL++++EE  FPK +D +L  KL  N   K P F K K          F + H+AG V Y I G+LEKN+D  N  ++ L+  +K   +  LF    +              T+    R+SL+ LMK LM   P F+RCI PNEFK+    D  L + QL  +G++E IRI + G+P R  + +F  RY IL P  IP  F  +  + T K++    LD   Y++G TK+F K      LED+RD+ LS+ I L Q   R
Sbjct:   42 IAITVEETNGDKVTVKTDKGETKVVKQDS-LEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVAAASKKDDDDPSKKKGSLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQ-GELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPRE--EQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVN-------------KTLDTKVKRQFF-IGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIE-KPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGKPKPPKPGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDTGKPGTKKKGGSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGF-VEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIR 783          
BLAST of Dach-1 vs. Planmine SMEST
Match: SMESG000051401.1 (SMESG000051401.1)

HSP 1 Score: 472.241 bits (1214), Expect = 1.156e-141
Identity = 280/767 (36.51%), Postives = 431/767 (56.19%), Query Frame = 3
Query:  354 GVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAV---SGQHSW--IEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRA-SDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFK--------AKLERNMDSCEVSMDS--EFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFP-KGTDHSLLNKLVNTCSKHPRFIKQK-------ADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDIL-LEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKKGFCLLQA 2579
            G+ D I + +++    + NL  R+ +N IYTY G +LVAVNPY  L IY+ KE+  YK  ++ +  PHIFAIAD A+  ++R ++D  I+ISGESG+GKTE++K+IL+++A V   SGQ     ++  +L SN ILE FGNAKT RNDNSSRFGKY+DI+F   G   G  ++ +LLEKSR+V Q   ER++H FY +L G P +    FGL+   D Y Y+NQG    +    D   +  +  A+  + FT+ E + I+ L+AA LHLG + F+        + ++   +S +++  S       ++L  +    L KAL+ + +  R D ++   ++      RDA  K IY RLF WI  KIN  I    +S       +  +++K++ IGVLDI+GFE F+NNSFEQ CINY NE LQQ F++ + K EQEEY  E I W +I + +NQE  D++ +    I A++D+    P + TD   L  L +   K   +  +K        +  + F I+H+AG V Y ++GFLEKN+D F  D   L+  + +  +K ++    K   +T +R  ++G  F+ S+  L++ L ++ P +VRCIKPN  K     D  L   Q RY G++E +R+R+AG+  R E+  F+ R+++L      S+   + +E +K +  ++   +  Q G TK+F++ AQ I  LE  R  A+   ++++QK WR    R +  K+  AA KI    R    R   +K    F  L++
Sbjct:   11 GIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTKLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSIPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKI---KISDKDSRENDLSNHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN-SNLKEGSKAIIDDMGILEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVLAR-RLAKRIRAANKIVNAYRHYKIRSYIVKFVANFSSLKS 772          
The following BLAST results are available for this feature:
BLAST of Dach-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYO7A0.000e+050.68myosin VIIA [Source:HGNC Symbol;Acc:HGNC:7606][more]
MYO7A0.000e+050.98myosin VIIA [Source:HGNC Symbol;Acc:HGNC:7606][more]
MYO7A0.000e+050.13myosin VIIA [Source:HGNC Symbol;Acc:HGNC:7606][more]
MYO7B0.000e+041.86myosin VIIB [Source:HGNC Symbol;Acc:HGNC:7607][more]
MYO7B0.000e+041.86myosin VIIB [Source:HGNC Symbol;Acc:HGNC:7607][more]
back to top
BLAST of Dach-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hum-60.000e+044.31Unconventional myosin heavy chain 6 [Source:UniPr... [more]
hum-51.597e-14737.32Heavy chain, Unconventional Myosin; Myosin IA [So... [more]
hum-51.597e-14737.32Heavy chain, Unconventional Myosin; Myosin IA [So... [more]
hum-12.184e-14738.14Heavy chain, Unconventional Myosin [Source:UniPro... [more]
hum-21.059e-14136.31Heavy chain, Unconventional Myosin [Source:UniPro... [more]
back to top
BLAST of Dach-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ck0.000e+050.86gene:FBgn0000317 transcript:FBtr0080724[more]
ck0.000e+050.86gene:FBgn0000317 transcript:FBtr0343687[more]
ck0.000e+050.86gene:FBgn0000317 transcript:FBtr0343686[more]
ck0.000e+050.86gene:FBgn0000317 transcript:FBtr0080723[more]
Myo28B10.000e+039.25gene:FBgn0040299 transcript:FBtr0079473[more]
back to top
BLAST of Dach-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo7aa0.000e+051.47myosin VIIAa [Source:ZFIN;Acc:ZDB-GENE-020709-1][more]
myo7aa0.000e+051.47myosin VIIAa [Source:ZFIN;Acc:ZDB-GENE-020709-1][more]
myo7aa0.000e+051.45myosin VIIAa [Source:ZFIN;Acc:ZDB-GENE-020709-1][more]
BX324225.10.000e+050.27myosin VIIAb [Source:NCBI gene;Acc:556141][more]
myo7ab0.000e+050.32myosin VIIAb [Source:ZFIN;Acc:ZDB-GENE-091110-4][more]
back to top
BLAST of Dach-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYO7A0.000e+051.11myosin 7a [Source:NCBI gene;Acc:100491335][more]
MYO7A0.000e+050.74myosin 7a [Source:NCBI gene;Acc:100491335][more]
MYO7A0.000e+050.81myosin 7a [Source:NCBI gene;Acc:100491335][more]
MYO7A0.000e+050.63myosin 7a [Source:NCBI gene;Acc:100491335][more]
MYO7A0.000e+050.72myosin 7a [Source:NCBI gene;Acc:100491335][more]
back to top
BLAST of Dach-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myo7a0.000e+051.02myosin VIIA [Source:MGI Symbol;Acc:MGI:104510][more]
Myo7a0.000e+050.38myosin VIIA [Source:MGI Symbol;Acc:MGI:104510][more]
Myo7a0.000e+051.10myosin VIIA [Source:MGI Symbol;Acc:MGI:104510][more]
Myo7a0.000e+050.96myosin VIIA [Source:MGI Symbol;Acc:MGI:104510][more]
Myo7a0.000e+051.01myosin VIIA [Source:MGI Symbol;Acc:MGI:104510][more]
back to top
BLAST of Dach-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q17LW0|MYO7A_AEDAE0.000e+051.22Myosin-VIIa OS=Aedes aegypti OX=7159 GN=ck PE=3 SV... [more]
sp|P97479|MYO7A_MOUSE0.000e+050.38Unconventional myosin-VIIa OS=Mus musculus OX=1009... [more]
sp|Q29P71|MYO7A_DROPS0.000e+051.06Myosin-VIIa OS=Drosophila pseudoobscura pseudoobsc... [more]
sp|Q13402|MYO7A_HUMAN0.000e+050.13Unconventional myosin-VIIa OS=Homo sapiens OX=9606... [more]
sp|Q9V3Z6|MYO7A_DROME0.000e+050.86Myosin-VIIa OS=Drosophila melanogaster OX=7227 GN=... [more]
back to top
BLAST of Dach-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A481MTN90.000e+099.50Dach-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
A0A1I8GD030.000e+054.27Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2R2MNA50.000e+052.90myosin-VIIa OS=Lingula unguis OX=7574 GN=LOC106174... [more]
R7U0820.000e+052.31Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A288XNW00.000e+052.43Myosin VIIa OS=Leptochiton asellus OX=211853 PE=2 ... [more]
back to top
BLAST of Dach-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo7ab0.000e+050.57unconventional myosin-VIIa-like [Source:NCBI gene;... [more]
myo7aa0.000e+051.20myosin VIIAa [Source:ZFIN;Acc:ZDB-GENE-020709-1][more]
si:ch73-194h10.20.000e+043.11si:ch73-194h10.2 [Source:ZFIN;Acc:ZDB-GENE-100921-... [more]
si:ch73-194h10.20.000e+043.94si:ch73-194h10.2 [Source:ZFIN;Acc:ZDB-GENE-100921-... [more]
si:ch73-194h10.20.000e+043.26si:ch73-194h10.2 [Source:ZFIN;Acc:ZDB-GENE-100921-... [more]
back to top
BLAST of Dach-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo10l14.436e-17239.76myosin X, like 1 [Source:ZFIN;Acc:ZDB-GENE-080425-... [more]
ENSPMAT00000000498.17.997e-14841.33pep scaffold:Pmarinus_7.0:GL479744:368:24152:-1 ge... [more]
ENSPMAT00000000990.11.971e-14738.32pep scaffold:Pmarinus_7.0:GL476918:15609:106669:1 ... [more]
myh105.855e-14637.16myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
ENSPMAT00000001434.11.131e-14536.68pep scaffold:Pmarinus_7.0:GL493165:42961:106906:1 ... [more]
back to top
BLAST of Dach-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MYO21.489e-16840.19Type V myosin motor involved in actin-based transp... [more]
MYO45.366e-16538.72Type V myosin motor involved in actin-based transp... [more]
MYO31.275e-14237.32One of two type I myosins; localizes to actin cort... [more]
MYO59.808e-13836.52One of two type I myosin motors; contains proline-... [more]
MYO14.737e-12938.69Type II myosin heavy chain; required for wild-type... [more]
back to top
BLAST of Dach-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO356580.000e+046.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455630.000e+049.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418191.932e-16538.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495159.959e-15437.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319241.353e-15342.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dach-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000002420.20.000e+050.75myosin VIIA [Source:NCBI gene;Acc:101165746][more]
si:ch73-194h10.20.000e+041.75unconventional myosin-VIIb [Source:NCBI gene;Acc:1... [more]
myo7ab0.000e+049.92myosin VIIAb [Source:ZFIN;Acc:ZDB-GENE-091110-4][more]
ENSORLT00000041909.12.536e-2550.05pep primary_assembly:ASM223467v1:14:27127847:27148... [more]
myo1b4.385e-16738.50myosin IB [Source:NCBI gene;Acc:101175446][more]
back to top
BLAST of Dach-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005090.10.000e+097.31SMESG000005090.1[more]
SMESG000005090.10.000e+096.94SMESG000005090.1[more]
SMESG000061386.12.982e-15539.24SMESG000061386.1[more]
SMESG000056451.11.428e-14637.53SMESG000056451.1[more]
SMESG000051401.11.156e-14136.51SMESG000051401.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003228 ID=SMED30003228|Name=Dach-1|organism=Schmidtea mediterranea sexual|type=transcript|length=7167bp
TTGAATTAGAATTTTAATATTGAATAGATTTCATTTGTATTCTATTTTGT
AATTGGCTGGCTTGACTGATTTGGACATTTTGATAAAAATGTTTTTTCGA
GGGATTTGTTTATTTTAACTCATTATTTTACTATAAGTGACTTAACAAAC
GTTTCCACATGGTCGTTCCCCAGAAAGGAGATTTTGTGTGGATCGAGAAT
AAATCCTCAACCAAAACTTCACAACTGGTGCCGATTGGTGCCAAGATCAA
GGACATTGTGAAGGACCAAATCACTGTGATCGATGATGATGGACATGAAT
TCATCTTGAAGCCCGGCACGAAGATAAGACACATGCATGTGTCGTCTCTG
CAGGGGGTTGATGACATGATATCTCTTGGAGATTTGAATGAAGCAGGAAT
CTTGCGAAATCTATTGATTCGTTACAAGCGCAATGAAATTTACACATACA
CTGGCCGAATTCTCGTTGCCGTCAACCCTTATGCTGTTCTACCCATCTAT
ACTCCCAAAGAAATCAAGAATTATAAAAACTGCAAAATTGGTGACTTGTC
CCCCCACATATTTGCAATTGCCGATAACGCATACAATAACATGCGTCGGG
TCAGCCGGGATCAATCCATTATCATCAGTGGAGAAAGTGGCGCTGGAAAG
ACTGAAAGCACAAAATTGATCCTGCAATTTCTTGCTGCAGTAAGTGGTCA
GCACTCATGGATCGAACAGCAAGTTCTCGATTCAAACCCAATTCTGGAAG
CTTTCGGCAACGCAAAAACAATACGCAATGACAATTCAAGCAGATTCGGA
AAATACATTGACATTTATTTTGGGGTGAATGGTGCGATAGAAGGAGCAAA
AATTGACCAATTCTTATTGGAGAAGTCTCGCATCGTTAGTCAAATGCGTG
ACGAGCGCAATTATCACGTGTTCTATTGCATGTTAGAAGGTTTGCCAATA
GAAACTCGTTCACGATTCGGGTTGCGGGCAAGCGATCATTACGCGTATTT
GAACCAGGGAGGCCGGATTGATCTCACGGGAACTACAGATATCGTTGATT
TTCCTACTTTACATTCGGCGATGAAGGTGTTAACGTTTACGGAAGATGAA
TGCCAGGAAATATTCCAACTATTGGCAGCATTTCTGCATCTAGGTAACAT
AAATTTTAAAGCAAAACTTGAGAGAAACATGGACTCCTGTGAAGTATCTA
TGGACTCAGAATTCAATTTCGCTAGTAAGCTATTACAGCTTGACTCTGAA
GATCTAAGGAAGGCATTAACGACAAAGAATATAATCACTAGAGATGATTT
TGTCGTTACCAATGTCTCCATTGCGCAAGGAATTAACATCCGCGACGCGC
TTGTCAAAGGAATTTATGGGAGATTGTTTGTGTGGATAGTAGAGAAGATT
AACACGGCTATTTATCGGCCAGCTTTGTCACAAGTTCCCAAATCTGCCTT
GAATGCGAAATCGAATTCGAAATACACTTCAATAGGCGTACTTGATATAT
TTGGATTTGAGAATTTCGACAACAACAGCTTCGAGCAGCTTTGCATCAAT
TACGCGAATGAGAATCTCCAGCAGTTTTTTGTTCGTCACATATTCAAGAT
GGAGCAAGAAGAATATGCGGCTGAACTGATTGACTGGCAGCATATCTCAT
TTACAGACAATCAGGAAACATTGGACTTAATCGGAGTAAAAAATTGCAAC
ATTCTTGCGTTAATAGATGAAGAGAGCCGATTCCCCAAAGGTACAGATCA
CTCTCTCCTCAATAAGCTCGTAAATACCTGCTCCAAGCATCCAAGATTCA
TAAAGCAAAAGGCGGACATCGTAAAAATATTTGGAATAGAGCATTTTGCT
GGCGTCGTCCATTATCAGATCGACGGATTCCTGGAGAAAAACCGAGATTT
CTTCAATGCTGATCTAATGGAATTAATTCAAACAACTAAAAGCCAATTTC
TTAAAATTCTTTTCGAAAAAGATTTTAAAATGGGATTTGATACGAGAAAG
AGAGCGCCTACACTTGGAATGCAATTCAGAAAGTCTTTGGATTCGTTGAT
GAAAATACTGATGGAAAGAGAGCCATTTTTTGTCAGGTGCATCAAGCCAA
ACGAGTTCAAGAAGAAACTGGATTTCGATAGATCACTCTGTTTGAGACAG
CTGCGTTATTCGGGCATGATGGAAACAATTCGTATTAGAAAGGCCGGATA
TCCGATCCGTCATGAATTTCCAGATTTTATTGACCGTTATAGGATTCTAG
TACCCGGAATTCCGTCAAGCTTTAGATGCAAGGATACCAGAGAAACAACT
AAACTTGTATGCAAAAATATTCTTGATCCAAAAGGATATCAAATTGGGAA
AACAAAACTTTTTCTAAAAGACGCTCAAGACATTTTGTTGGAAGACCTGC
GAGACAAGGCGCTAAGTAATCGGATCATACTCATTCAAAAGACCTGGAGG
AAATATTACCATCGAACTCAGTTTCTCAAGAAGAAATCTGCCGCGATAAA
AATTCAAACTTTCGTAAGAATGAAATTGACTCGTCGAAAATTCATTAAGA
TGAAGAAAGGCTTCTGCCTTTTGCAAGCCAGTTTCAGAGCAAAAGTTGCT
AGTAAAAAATTGAAAGACCTTAAAGGTTTTATCCGTAATGTCCAAAGACA
TTGCAGGGGACGCTTGACAAGAGACATGCTTAAACAAAAGACCAAAGCAA
TCATCAAGATTCAATCTCAAATTCGCAAATTTTGTGCTTTGAAAAAATTT
AAAGATTTAAAGAAAAAAGACATGAAATTGAAAGAAGCTCTCAGCTTAAA
AAAAAAGGATGAAAACATATTTAAAAATCAAATGTCCGAGGAAAAAGCAC
ATGAAGAGGCAGAAAAAAGACATAAAATGCGACTTAACCAAATCCACAAC
GAGTCAGTGGCAGATGCACAACAGCAGCTGAAAGACAATAGTGATATCAA
GCAACGGATTGCAGAGGCAGAGAGAAGGCGCAACCAGCCAGTGGATGAAT
CAGAGATGCTTGATGAGATTTTCGGTTCAATAGATGGCTACAGTGTGAAA
TCTGTGCCGAATTCATTGTCTCATGCACCAAGGGCATTCCGGGATTTGGA
GCTGTCACGAATGAACGCTCTGAATGATGTCGGCTCCATTTTCGGCACAA
CAATGCCGGATTATCTAGTCAACATTCTCGATGAAGACGTTTCAGAATTC
ACATTCACAAAATTTGCTGCCACTTACTTTCAAAAAGATTGTGACCCGTA
TTTCTCCCGAAAACCATTAAGGAAACCCTTGTTATTTCATTCAAATCCAA
ACCATCAAATATCGGCACTTGCAGTGTGGATAGCAATTCTGAGGTTTATG
AAAGATTTGCCGGAACCTTTGGTGAACCAGAGTCGAACATCTCAAGCGAA
TTCAGTTCCTATAATGACTAAAATATATCAATCGCTTGGACGACAATTCA
ATAAGCAAGACATATTGAAAGCCGCAGAAGAAGCTGAACAGATGACAAAT
GGAATGCCGTACGAAAATCTGTCAATGAGGACCAACAGAAAGAACATAGT
GTCTTTGACCCTGAAAAAGAAGTCAAAATTCACGGATGAAGTGGTCAATC
ATTTGAATGATGCCGAGAATCCGCTGAATACAAGAACTTTGAGTTCTTTA
TTGGAAGAGAGACCAACTTCCAACTTAGAGAAATTGCATTTTATTATTGG
AAATGGCATTCTGATTCCCGAGCTGCGAGATGAGATCTATTGTCAGATCT
GTAAACAGTTGGCCGACAATCCGAGGCTGGATAGTGTGAGCAGAGGTCTG
ATACTATTGAACTTGTGTATTGGCTGTTTTGCGCCGACTGAAAAATTCGT
CAGGACCTTGCGCAATTTCATTCAAACGAATTTCAGAGATTGCGCAAAAT
TTATCGTTTTCCGGTTGCAGCGAACATTTTCAAATGGAACTCGAAATCAG
CCTCCAAGTTGGTTAGAATTGAAGGCAATCAAACACAAAGAGCCGATAAT
ACTAGCAGTCGCTTGTATGAACGGCAATACGGAGACTATTTTTGCCGATT
CTGCGTCAACAGCTCAAGAATTGTGCTCGATATTGTCACAGAAAATCTGT
CTGAAGGATCAATTCGGATTTTCTCTTTTTATCGCCATTCTTGACAAAGT
ATCCTCAATTGGGAGTGGCGGAGATCATGTAATGGATGCAATTAGTCAGT
GCGAACAATTCGCTAAAGAAAAAGGTCAGATCGAATCCAAAGCACAGTGG
AGATTGTTTTTTCGCAAAGAAATTTTCACTCCTTGGCACAATTCTTGTGA
CGATATTGTTGCTACAGATCTCATTTACCATCAGGTCATAAGGGGCATCA
AATTCGGCGAATATCGTTGCGATACTGATGATGATATGTGCAAATTGTGC
GCCTATCAACTTCGTATCGACAACGTGAAAGATTTGTCAGATGAAACTCT
CCATAAATATCTTCCTCAAACCATCATCGGTATGACAAAAGAAAAGAAAA
AATATTGGCTTGCCCTACTCAATAAAGCGGTGAAGAATTTGAATGAAACT
TCTCGCAAAGATTCGATTTCGAGTGAAAAATTGAAAGAAGAAATTGTGAC
CTTTGCACGGCTTAAATGGCCAATGCTCTTTTCGAGATTTTATGAAGCCA
TTAAATTCTCAGGCCCCTCATTGGATACTAATGAAGTTATATTTACTATT
AACTGGACGGGGATCTATCTCGTTGATTCAAATGAACGCATACATTTAGA
GCTATCCTTCCCTGAAATTGTAGCGGTATCATCGAGTCGGACCATGAATT
TCGTATCCTCTAACACTAGCCGATTGCATGGGCAGTCACTCTCGTTGTCA
ACAGTGAAAGGCGGCAATTATACTTTCAACTGTGCCAATTCTGAAGATAT
TAGAGATTTAATTGTTTTTTTTCTTGAAGGTCTCAAAGAGCGTAGTCATT
ATGCAATCGTGGTGCAGGCATTTTCTAAGCCTGATTCATCATTTTTATCC
TGTGAGAAAGGCGACCTGTTGATATTGGAGACTAATGACAACATGAGAGG
AATTACAACATCCGATTGGTATTATGGGGAAAACTATCGCACAAAAGAGC
ATGGAGATTTCCCTGCTGACATCGTTTACATTTTACCGATCATTAATTTT
CCCTCCCAAAATATTCTTGCTTTGTTTAGTGATCGGAGCTTTGGGGACTC
ATATGGCGGCGGCTCAAATAATAATCACAACGATTCGAGAGGGAAACAAC
ATACATTGGAGGAGTTTAGTAAAATATATTTCAGGACCCCTTCTAGTGGA
AGCAGATCATTTACCATGAGCTTGGGCAAACAAGTTGCTGGCAATTTGTG
GCAGCACAGTAGACAGCTGCTAAAATTGCCACTCCTAAAAAAATTATTAA
ATAAAGAGGATCTCTGTCAGCAAGCAGTATCGTGTTTCAGTGCCATTCTT
ATATACATGGGAGACCAACCTTCTAAGAATTACAGTTCGACTGAAATTGT
AGAATCTATTTTTGATCCTTGTTTGAAACACGAAATACTGAAAGATGAGG
TCTACTGTCAGTTGATAACACAGATAACATCTAATCCCAATCCTCAAAGT
GAAAAGGCTGGATGGGAATTAATCTGGCTTGCAACTGGTATCATGGTTCC
GAACTCAAATCTTTATCGAGAACTCCTTGAAGTATTTAGATCTGCCAGTT
CCCTTCTAGCTCTCGAATGTCAGACTCGTCTTCAAAAAACTTTAAAAATG
GGTCAAAGGCGTTATCCTCCTCATGCAATTGAAATCAACGCCGTACAAAT
GGGGAAACTCATCCAACATAAAATATATTTCCCTAACGAAAGTGTTCAAG
CATTCGAGATCACGTCCAATACAAAATGCAAAGATCTCTGTCAGAATATT
TGCTCCAAGATTGGGCTGAAGGATTATAAAGGCTTTGCATTATTTGTCAA
AAGTATAGACAAAGCCATTAGTATGCCGGAAGGAGACTTCTTTTTCGATT
TTATTAGACAACTCAGTGATTGGGTCAAAAAGCACAGACCCGTAAAGGAT
GGACAACTAGAATTCGCCTATCAAGTTTTTTTTATGAAAAAACTGTGGAC
AAATACCGTTCCTGGGTTAGATCAGGTCGCCGACATTCTTTTTCATTATC
CTCAGGAAGTGAGGAAATATCTTTATGGATATCACAAAGTTGTAATCAAG
GATGCTATAATTCTTGGAGCTCTGATATTGCGGGCTCATTGCGACAAGGA
CGTATCGAAATTGCAGTCGTACATAGAATCCCTGGATTTATTAATTCCAC
CTGACGTGTTGAACAGATATCCTCAAACCGAGTTGCAGCAAAAGGTTCTG
GCTCAGTACCATCTCAGTCGCAGCATGAGCGATAATGATGCCAAAATCGC
CTTTCTAAAAATTATTTTTCAATGGCCAACTTTCGGATCGGCCTTCTTTG
AAGTGAAGCAATCAACGAATGTGAATGTGCCAGAGAAGATTCTGATTGCG
ATCAACAAAAACGGAGTCTATCTTATTCATACAAAAACGAAAGAAACTCT
CGACTACTATCCTTACTCGAGCATCAGCAATTGGAGTTCTGGAAATACGT
ATTTCAACATGACCATTGGTAATCTTATCCACGGCCGCAAACTTCTATGT
GAAACGCCATTGGGTTACAAAATGGATGATCTGTTGACTTCATATATCAG
TCTAATGTTGACAACGATTACCAAGAGCTCTTCAAATTGACCTCAAACTC
ATCATATTGTCATATCACTCGTGAAATATATTCGTTTTTTAAATTTATAT
TTACGATGTCCGCCAATAATTTGCTTATTTTCTATAATTTATCTTTTTAC
CGCTTAGTCCCTCAACCCTTGAATAACCCTTGCAGCCAGAATCCCAGTTA
TTCGAAGCTAACCAATAAATGGGCTATGTTAACGTGTGTAACTTTAATTT
TTATGTATATTTTTTATATTTTATCTTTAATGTGTTTTAAGCAATTGTTG
ATCTCAGGCGATTAATCGGTACAATTTGTCTTTAGACAGCTTGGTTGCGT
GTATGTATGTGATTGTATTCGTGTGTATATGAATATACACTAGCTTTTAT
AAACTACCATCAGAAATGAAAAATATTATTAGCAAATGGTCATCTATGCT
TACTTTTTAAAATGTGA
back to top

protein sequence of SMED30003228-orf-1

>SMED30003228-orf-1 ID=SMED30003228-orf-1|Name=SMED30003228-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2194bp
MVVPQKGDFVWIENKSSTKTSQLVPIGAKIKDIVKDQITVIDDDGHEFIL
KPGTKIRHMHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGR
ILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSR
DQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQVLDSNPILEAFG
NAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDER
NYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPT
LHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDS
EFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVK
GIYGRLFVWIVEKINTAIYRPALSQVPKSALNAKSNSKYTSIGVLDIFGF
ENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTD
NQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQ
KADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKI
LFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEF
KKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPG
IPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDILLEDLRDK
ALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFIKMKK
GFCLLQASFRAKVASKKLKDLKGFIRNVQRHCRGRLTRDMLKQKTKAIIK
IQSQIRKFCALKKFKDLKKKDMKLKEALSLKKKDENIFKNQMSEEKAHEE
AEKRHKMRLNQIHNESVADAQQQLKDNSDIKQRIAEAERRRNQPVDESEM
LDEIFGSIDGYSVKSVPNSLSHAPRAFRDLELSRMNALNDVGSIFGTTMP
DYLVNILDEDVSEFTFTKFAATYFQKDCDPYFSRKPLRKPLLFHSNPNHQ
ISALAVWIAILRFMKDLPEPLVNQSRTSQANSVPIMTKIYQSLGRQFNKQ
DILKAAEEAEQMTNGMPYENLSMRTNRKNIVSLTLKKKSKFTDEVVNHLN
DAENPLNTRTLSSLLEERPTSNLEKLHFIIGNGILIPELRDEIYCQICKQ
LADNPRLDSVSRGLILLNLCIGCFAPTEKFVRTLRNFIQTNFRDCAKFIV
FRLQRTFSNGTRNQPPSWLELKAIKHKEPIILAVACMNGNTETIFADSAS
TAQELCSILSQKICLKDQFGFSLFIAILDKVSSIGSGGDHVMDAISQCEQ
FAKEKGQIESKAQWRLFFRKEIFTPWHNSCDDIVATDLIYHQVIRGIKFG
EYRCDTDDDMCKLCAYQLRIDNVKDLSDETLHKYLPQTIIGMTKEKKKYW
LALLNKAVKNLNETSRKDSISSEKLKEEIVTFARLKWPMLFSRFYEAIKF
SGPSLDTNEVIFTINWTGIYLVDSNERIHLELSFPEIVAVSSSRTMNFVS
SNTSRLHGQSLSLSTVKGGNYTFNCANSEDIRDLIVFFLEGLKERSHYAI
VVQAFSKPDSSFLSCEKGDLLILETNDNMRGITTSDWYYGENYRTKEHGD
FPADIVYILPIINFPSQNILALFSDRSFGDSYGGGSNNNHNDSRGKQHTL
EEFSKIYFRTPSSGSRSFTMSLGKQVAGNLWQHSRQLLKLPLLKKLLNKE
DLCQQAVSCFSAILIYMGDQPSKNYSSTEIVESIFDPCLKHEILKDEVYC
QLITQITSNPNPQSEKAGWELIWLATGIMVPNSNLYRELLEVFRSASSLL
ALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKLIQHKIYFPNESVQAFE
ITSNTKCKDLCQNICSKIGLKDYKGFALFVKSIDKAISMPEGDFFFDFIR
QLSDWVKKHRPVKDGQLEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQE
VRKYLYGYHKVVIKDAIILGALILRAHCDKDVSKLQSYIESLDLLIPPDV
LNRYPQTELQQKVLAQYHLSRSMSDNDAKIAFLKIIFQWPTFGSAFFEVK
QSTNVNVPEKILIAINKNGVYLIHTKTKETLDYYPYSSISNWSSGNTYFN
MTIGNLIHGRKLLCETPLGYKMDDLLTSYISLMLTTITKSSSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000017photoreceptor neuron
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001609Myosin_head_motor_dom
IPR001452SH3_domain
IPR000048IQ_motif_EF-hand-BS
IPR019749Band_41_domain
IPR000857MyTH4_dom
IPR027417P-loop_NTPase
IPR011993PH-like_dom_sf
IPR014352FERM/acyl-CoA-bd_prot_sf
IPR019748FERM_central
IPR000299FERM_domain
IPR029071Ubiquitin-like_domsf
Vocabulary: cellular component
TermDefinition
GO:0016459myosin complex
GO:0005856cytoskeleton
GO:1990435upper tip-link density
GO:0001750photoreceptor outer segment
GO:0001917photoreceptor inner segment
GO:0005737cytoplasm
GO:0005765lysosomal membrane
GO:0005829cytosol
GO:0005902microvillus
GO:0005938cell cortex
GO:0016324apical plasma membrane
GO:0031477myosin VII complex
GO:0032391photoreceptor connecting cilium
GO:0032420stereocilium
GO:0042470melanosome
GO:0045202synapse
Vocabulary: molecular function
TermDefinition
GO:0003774motor activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0000146microfilament motor activity
GO:0000166nucleotide binding
GO:0003779actin binding
GO:0005516calmodulin binding
GO:0019904protein domain specific binding
GO:0030507spectrin binding
GO:0030898actin-dependent ATPase activity
GO:0032403protein complex binding
GO:0042803protein homodimerization activity
GO:0043531ADP binding
GO:0047485protein N-terminus binding
GO:0051015actin filament binding
Vocabulary: biological process
TermDefinition
GO:0051875pigment granule localization
GO:0051904pigment granule transport
GO:0060088auditory receptor cell stereocilium organization
GO:0060113inner ear receptor cell differentiation
GO:0060122inner ear receptor stereocilium organization
GO:0001845phagolysosome assembly
GO:0006810transport
GO:0006886intracellular protein transport
GO:0006909phagocytosis
GO:0007040lysosome organization
GO:0007600sensory perception
GO:0007601visual perception
GO:0007605sensory perception of sound
GO:0030030cell projection organization
GO:0030048actin filament-based movement
GO:0042472inner ear morphogenesis
GO:0042490mechanoreceptor differentiation
GO:0042491auditory receptor cell differentiation
GO:0048563post-embryonic animal organ morphogenesis
GO:0048839inner ear development
GO:0050953sensory perception of light stimulus
GO:0050957equilibrioception