Pleckstrin homology domain-containing family F member 2

Overview
NamePleckstrin homology domain-containing family F member 2
Smed IDSMED30003223
Length (bp)1007
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pleckstrin homology domain-containing family F member 2 (SMED30003223) t-SNE clustered cells

Violin plots show distribution of expression levels for Pleckstrin homology domain-containing family F member 2 (SMED30003223) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pleckstrin homology domain-containing family F member 2 (SMED30003223) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pleckstrin homology domain-containing family F member 2 (SMED30003223) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003223

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30003223SMESG000070592.1 Contig2705GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003223SMESG000038764.1 Contig2705GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30003223SMESG000038764.1 dd_Smed_v4_6176_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Human
Match: PLEKHF2 (pleckstrin homology and FYVE domain containing 2 [Source:HGNC Symbol;Acc:HGNC:20757])

HSP 1 Score: 221.476 bits (563), Expect = 1.263e-70
Identity = 107/209 (51.20%), Postives = 138/209 (66.03%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGN 720
            S ++  RI  +EN FG +G PL+   R LIGEG+L K+CRKKPK R FFLF+DILVYG+IV+  KK   QHII +E V I  + D+     G+ +K+P KSFA+YA +A EK +WMNH+ KC+ +   K G    S   + VW+PD+ A  CM C+   F  +NRRHHCR CG VVC  CS KR+LLP QS  PVR+CD CY+ L  G+
Sbjct:    8 SEANTRRISIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKTP-SNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSAGD 215          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Human
Match: PLEKHF2 (pleckstrin homology and FYVE domain containing 2 [Source:HGNC Symbol;Acc:HGNC:20757])

HSP 1 Score: 221.476 bits (563), Expect = 1.263e-70
Identity = 107/209 (51.20%), Postives = 138/209 (66.03%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGN 720
            S ++  RI  +EN FG +G PL+   R LIGEG+L K+CRKKPK R FFLF+DILVYG+IV+  KK   QHII +E V I  + D+     G+ +K+P KSFA+YA +A EK +WMNH+ KC+ +   K G    S   + VW+PD+ A  CM C+   F  +NRRHHCR CG VVC  CS KR+LLP QS  PVR+CD CY+ L  G+
Sbjct:    8 SEANTRRISIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKTP-SNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSAGD 215          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Human
Match: PLEKHF1 (pleckstrin homology and FYVE domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20764])

HSP 1 Score: 193.741 bits (491), Expect = 1.895e-59
Identity = 96/202 (47.52%), Postives = 132/202 (65.35%), Query Frame = 1
Query:  103 SDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQL 708
            + +RI  +E+ FG SG PL+   R L+GEG+L K CRKK K R FFLF+DILVYGSIV++ +K   QHII +EEV +  L + +     + +K+ KKSF + A SA E+++W++H+++C+    +  G    +   +P WIPD     CM C  T F+ L RRHHCR CG VVC+ CS +R+LLP  SP PVRVC LCY +L
Sbjct:   11 NSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLNKRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTAKKSFVVSAASATERQEWISHIEECVRRQLRATGRPPSTEHAAP-WIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRQRFLLPRLSPKPVRVCSLCYREL 211          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Human
Match: PLEKHF1 (pleckstrin homology and FYVE domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20764])

HSP 1 Score: 193.741 bits (491), Expect = 1.895e-59
Identity = 96/202 (47.52%), Postives = 132/202 (65.35%), Query Frame = 1
Query:  103 SDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQL 708
            + +RI  +E+ FG SG PL+   R L+GEG+L K CRKK K R FFLF+DILVYGSIV++ +K   QHII +EEV +  L + +     + +K+ KKSF + A SA E+++W++H+++C+    +  G    +   +P WIPD     CM C  T F+ L RRHHCR CG VVC+ CS +R+LLP  SP PVRVC LCY +L
Sbjct:   11 NSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLNKRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTAKKSFVVSAASATERQEWISHIEECVRRQLRATGRPPSTEHAAP-WIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRQRFLLPRLSPKPVRVCSLCYREL 211          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Human
Match: PLEKHF1 (pleckstrin homology and FYVE domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20764])

HSP 1 Score: 112.849 bits (281), Expect = 3.857e-30
Identity = 55/118 (46.61%), Postives = 82/118 (69.49%), Query Frame = 1
Query:  103 SDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQK 456
            + +RI  +E+ FG SG PL+   R L+GEG+L K CRKK K R FFLF+DILVYGSIV++ +K   QHII +EEV +  L + +     + +K+ KKSF + A SA E+++W++H+++
Sbjct:   11 NSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLNKRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTAKKSFVVSAASATERQEWISHIEE 128          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Celegans
Match: ZK632.12 (pep chromosome:WBcel235:III:9830802:9832378:1 gene:WBGene00014019.1 transcript:ZK632.12.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK632.12)

HSP 1 Score: 202.601 bits (514), Expect = 2.237e-63
Identity = 95/205 (46.34%), Postives = 134/205 (65.37%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQL 708
            S  +  R+  +E  FG  G  LS   R L+GEG+L+KMCRKKPK+R FFLF+DILVYG+IV+  K+   Q I+ +E V++ DL DD I  +G+ +K+P KSFA+YA +  EK +WM H+++C+ +   +RG    +   + VW+PD  A KCMVC  T F ++ RRHHCR+CG VVC  CS + + +      PVRVCD C++ L
Sbjct:    8 SEVNSRRMANVEQCFGKMGEQLSVFGRVLVGEGVLVKMCRKKPKQRQFFLFNDILVYGNIVISKKRYNKQRILRLEGVQVEDLEDDGIEKHGWIIKTPAKSFAVYAATETEKREWMLHIERCVTDLL-ERGNKQAATAHAAVWVPDGEAVKCMVCGKTQFNLVQRRHHCRNCGRVVCGACSSRTFRIDNVHKKPVRVCDHCFDSL 211          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Celegans
Match: ZK632.12 (pep chromosome:WBcel235:III:9830792:9832430:1 gene:WBGene00014019.1 transcript:ZK632.12.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK632.12)

HSP 1 Score: 202.601 bits (514), Expect = 2.237e-63
Identity = 95/205 (46.34%), Postives = 134/205 (65.37%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQL 708
            S  +  R+  +E  FG  G  LS   R L+GEG+L+KMCRKKPK+R FFLF+DILVYG+IV+  K+   Q I+ +E V++ DL DD I  +G+ +K+P KSFA+YA +  EK +WM H+++C+ +   +RG    +   + VW+PD  A KCMVC  T F ++ RRHHCR+CG VVC  CS + + +      PVRVCD C++ L
Sbjct:    8 SEVNSRRMANVEQCFGKMGEQLSVFGRVLVGEGVLVKMCRKKPKQRQFFLFNDILVYGNIVISKKRYNKQRILRLEGVQVEDLEDDGIEKHGWIIKTPAKSFAVYAATETEKREWMLHIERCVTDLL-ERGNKQAATAHAAVWVPDGEAVKCMVCGKTQFNLVQRRHHCRNCGRVVCGACSSRTFRIDNVHKKPVRVCDHCFDSL 211          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Celegans
Match: aka-1 (A Kinase Anchor protein [Source:UniProtKB/TrEMBL;Acc:H2KZI9])

HSP 1 Score: 68.9366 bits (167), Expect = 1.539e-12
Identity = 31/71 (43.66%), Postives = 40/71 (56.34%), Query Frame = 1
Query:  511 SPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPY-----QSPVPVRVCDLCYEQL 708
            SP WIPD+  P CM+C  T F ++ RRHHCR CG V+C +C  ++  L Y     +    VRVC  C   L
Sbjct:  535 SPYWIPDSECPNCMLCN-TRFTIITRRHHCRACGRVLCGSCCNEKAFLEYLQEEGKKLQAVRVCKPCSAML 604          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Celegans
Match: aka-1 (A Kinase Anchor protein [Source:UniProtKB/TrEMBL;Acc:H2KZI9])

HSP 1 Score: 68.9366 bits (167), Expect = 1.539e-12
Identity = 31/71 (43.66%), Postives = 40/71 (56.34%), Query Frame = 1
Query:  511 SPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPY-----QSPVPVRVCDLCYEQL 708
            SP WIPD+  P CM+C  T F ++ RRHHCR CG V+C +C  ++  L Y     +    VRVC  C   L
Sbjct:  535 SPYWIPDSECPNCMLCN-TRFTIITRRHHCRACGRVLCGSCCNEKAFLEYLQEEGKKLQAVRVCKPCSAML 604          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Celegans
Match: aka-1 (A Kinase Anchor protein [Source:UniProtKB/TrEMBL;Acc:H2KZI9])

HSP 1 Score: 63.5438 bits (153), Expect = 6.498e-11
Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 1
Query:  511 SPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPY 660
            SP WIPD+  P CM+C  T F ++ RRHHCR CG V+C +C  ++  L Y
Sbjct:  535 SPYWIPDSECPNCMLCN-TRFTIITRRHHCRACGRVLCGSCCNEKAFLEY 583          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Fly
Match: rush (gene:FBgn0025381 transcript:FBtr0070259)

HSP 1 Score: 218.394 bits (555), Expect = 8.792e-69
Identity = 98/206 (47.57%), Postives = 141/206 (68.45%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLK 711
            S ++  RI  +EN FG SG+PL+   R L+GEG+L KMCRK+PK R FFLF+DILVYG+IV+  KK   QHI+ +EEV +  ++D+     G+ +++  KSF ++A ++ EK++WM H+ KC+++  +K G   +    + VW+PD  A  CM C+ T F  + RRHHCR+CG VVC+ CS K++LLP QS   +RVCD CYE+LK
Sbjct:    8 SEANTRRIASVENCFGSSGVPLAMQGRVLVGEGVLTKMCRKRPKSRQFFLFNDILVYGNIVIGKKKYNKQHIMPLEEVSLESIADNQTYRNGWYIRTTTKSFVVFAATSTEKQEWMAHINKCVEDLLRKSGKKPVE-NHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQQSTKALRVCDACYERLK 212          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Fly
Match: rush (gene:FBgn0025381 transcript:FBtr0339589)

HSP 1 Score: 218.394 bits (555), Expect = 8.792e-69
Identity = 98/206 (47.57%), Postives = 141/206 (68.45%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLK 711
            S ++  RI  +EN FG SG+PL+   R L+GEG+L KMCRK+PK R FFLF+DILVYG+IV+  KK   QHI+ +EEV +  ++D+     G+ +++  KSF ++A ++ EK++WM H+ KC+++  +K G   +    + VW+PD  A  CM C+ T F  + RRHHCR+CG VVC+ CS K++LLP QS   +RVCD CYE+LK
Sbjct:    8 SEANTRRIASVENCFGSSGVPLAMQGRVLVGEGVLTKMCRKRPKSRQFFLFNDILVYGNIVIGKKKYNKQHIMPLEEVSLESIADNQTYRNGWYIRTTTKSFVVFAATSTEKQEWMAHINKCVEDLLRKSGKKPVE-NHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQQSTKALRVCDACYERLK 212          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Fly
Match: Sara (gene:FBgn0026369 transcript:FBtr0071641)

HSP 1 Score: 71.2478 bits (173), Expect = 3.024e-13
Identity = 28/62 (45.16%), Postives = 40/62 (64.52%), Query Frame = 1
Query:  514 PVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCY 699
            P+W+PD +A +CM C+   F ++ RRHHCR CG V+CS C  +R+ L + +    RVC  CY
Sbjct:  526 PIWVPDNMAGQCMQCQQK-FTMIKRRHHCRACGKVLCSVCCSQRFRLEFATEPESRVCVQCY 586          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Fly
Match: CG6051 (gene:FBgn0039492 transcript:FBtr0339264)

HSP 1 Score: 70.8626 bits (172), Expect = 4.807e-13
Identity = 38/81 (46.91%), Postives = 42/81 (51.85%), Query Frame = 1
Query:  463 DECSKKRGLVGLSATKSP-VWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLP-YQSPVPVRVCDLCY 699
            +E          SAT SP  WIPD  AP+CM C+ T F    RRHHCR+CG V C  CS     LP Y     VRVC  CY
Sbjct:  885 NETQMPSSATSTSATLSPPAWIPDGKAPRCMACQ-TPFTAFRRRHHCRNCGGVFCGVCSNASAPLPKYGLTKAVRVCRDCY 964          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Fly
Match: CG6051 (gene:FBgn0039492 transcript:FBtr0305050)

HSP 1 Score: 70.8626 bits (172), Expect = 4.896e-13
Identity = 38/81 (46.91%), Postives = 42/81 (51.85%), Query Frame = 1
Query:  463 DECSKKRGLVGLSATKSP-VWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLP-YQSPVPVRVCDLCY 699
            +E          SAT SP  WIPD  AP+CM C+ T F    RRHHCR+CG V C  CS     LP Y     VRVC  CY
Sbjct:  886 NETQMPSSATSTSATLSPPAWIPDGKAPRCMACQ-TPFTAFRRRHHCRNCGGVFCGVCSNASAPLPKYGLTKAVRVCRDCY 965          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Zebrafish
Match: plekhf2 (pleckstrin homology domain containing, family F (with FYVE domain) member 2 [Source:NCBI gene;Acc:393214])

HSP 1 Score: 214.157 bits (544), Expect = 6.143e-68
Identity = 105/215 (48.84%), Postives = 142/215 (66.05%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGNEIISPR 738
            S ++ +RI  +E  FG +G PL+   R LIGEG+L K+CRK+PK R FFLF+DILVYG+IV+  KK   QHII +E V I  + D+     G+ +K+P KSFA+YA +A EK +WM+H+ KC+ +  +K G    +   + VW+PD+ A  CM C+   F  +NRRHHCR CG VVC  CS K++LLP QS  PVRVC+ CY+QL  G   + PR
Sbjct:    8 SEANSKRIGVVEACFGTAGQPLAIPGRVLIGEGVLTKLCRKRPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLESVTIDTVEDEGELRNGWLIKTPTKSFAVYAATATEKSEWMSHINKCVSDLLEKSGK-SPTGEHAAVWVPDSEATVCMRCQKMKFTPVNRRHHCRKCGFVVCGPCSEKKFLLPSQSSKPVRVCEFCYKQLSTG-ATLPPR 220          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Zebrafish
Match: plekhf2 (pleckstrin homology domain containing, family F (with FYVE domain) member 2 [Source:NCBI gene;Acc:393214])

HSP 1 Score: 214.157 bits (544), Expect = 6.143e-68
Identity = 105/215 (48.84%), Postives = 142/215 (66.05%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGNEIISPR 738
            S ++ +RI  +E  FG +G PL+   R LIGEG+L K+CRK+PK R FFLF+DILVYG+IV+  KK   QHII +E V I  + D+     G+ +K+P KSFA+YA +A EK +WM+H+ KC+ +  +K G    +   + VW+PD+ A  CM C+   F  +NRRHHCR CG VVC  CS K++LLP QS  PVRVC+ CY+QL  G   + PR
Sbjct:    8 SEANSKRIGVVEACFGTAGQPLAIPGRVLIGEGVLTKLCRKRPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLESVTIDTVEDEGELRNGWLIKTPTKSFAVYAATATEKSEWMSHINKCVSDLLEKSGK-SPTGEHAAVWVPDSEATVCMRCQKMKFTPVNRRHHCRKCGFVVCGPCSEKKFLLPSQSSKPVRVCEFCYKQLSTG-ATLPPR 220          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Zebrafish
Match: plekhf1 (pleckstrin homology domain containing, family F (with FYVE domain) member 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1289])

HSP 1 Score: 167.548 bits (423), Expect = 3.079e-49
Identity = 89/205 (43.41%), Postives = 123/205 (60.00%), Query Frame = 1
Query:  109 ERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATK--SPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVG 717
            ERI  +E+ FG +G  L +  R L+GEG L K+CR+ P+ R F+LF+DILVYGSI++HG+    Q+II +EEV+  DL D +     + +++P+KSF + A S EEK  WM H+++      K +GL    +    +  WIPD  +  CM C    F V NRRHHCR CG +VC  CS  R +LP+ S  PVRVC  C   +  G
Sbjct:   13 ERIQAVESSFGRTGKMLQKPGRFLVGEGCLQKLCRRGPQPRVFYLFNDILVYGSIMLHGRWNNKQNIIPLEEVQQEDLEDGMAMANQWLIRTPRKSFYVSAESPEEKIAWMGHIEQYRTLHVKNKGLPAKKSGDDFATPWIPDVASAICMRCS-KRFTVANRRHHCRRCGYIVCQACSKGRAVLPHISNRPVRVCRNCKNDMTDG 216          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Zebrafish
Match: plekhf1 (pleckstrin homology domain containing, family F (with FYVE domain) member 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1289])

HSP 1 Score: 167.548 bits (423), Expect = 3.079e-49
Identity = 89/205 (43.41%), Postives = 123/205 (60.00%), Query Frame = 1
Query:  109 ERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATK--SPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVG 717
            ERI  +E+ FG +G  L +  R L+GEG L K+CR+ P+ R F+LF+DILVYGSI++HG+    Q+II +EEV+  DL D +     + +++P+KSF + A S EEK  WM H+++      K +GL    +    +  WIPD  +  CM C    F V NRRHHCR CG +VC  CS  R +LP+ S  PVRVC  C   +  G
Sbjct:   13 ERIQAVESSFGRTGKMLQKPGRFLVGEGCLQKLCRRGPQPRVFYLFNDILVYGSIMLHGRWNNKQNIIPLEEVQQEDLEDGMAMANQWLIRTPRKSFYVSAESPEEKIAWMGHIEQYRTLHVKNKGLPAKKSGDDFATPWIPDVASAICMRCS-KRFTVANRRHHCRRCGYIVCQACSKGRAVLPHISNRPVRVCRNCKNDMTDG 216          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Zebrafish
Match: fgd6 (FYVE, RhoGEF and PH domain containing 6 [Source:ZFIN;Acc:ZDB-GENE-041210-200])

HSP 1 Score: 116.316 bits (290), Expect = 3.801e-28
Identity = 69/198 (34.85%), Postives = 107/198 (54.04%), Query Frame = 1
Query:  163 QVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKR---------GLVGLS------ATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLK 711
            Q  R  + EG LMK+ RK  + R FFLF+DIL+Y + V  G+  V   ++ +  +++S  S +        ++S ++SF + A SA E+++W+  +   ID+ ++K+          L G+S       +K+P+WIPD     CM+C    F +  RRHHCR CG VVC  CS  ++ L Y      RVCD CY +L+
Sbjct:  983 QPGRVFLKEGTLMKLSRKVMQPRMFFLFNDILLYTTPVQSGQYKVNS-MLSLAGMKVSKPSQEAYQNE-LNIESVERSFILSANSATERDEWLEAIATAIDDYTRKKISFFSSRSQELEGISDDGLPLGSKAPIWIPDLRTTMCMICTCE-FTLTWRRHHCRACGKVVCQACSSNKFYLEYLKNQLARVCDHCYIKLQ 1177          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Xenopus
Match: eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:Xenbase;Acc:XB-GENE-1010293])

HSP 1 Score: 216.853 bits (551), Expect = 7.331e-69
Identity = 106/209 (50.72%), Postives = 140/209 (66.99%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGN 720
            S ++ +RI  +E+ FG +G PL+   R LIGEG+L K+CRKKPK R FFLF+DILVYG+IV+  KK   QHII +E V I  + D+     G+ +K+P KSFA+YA +A EK +WMNH+ KC+ +   K G    ++  + VWIPD+ A  CM C+   F  +NRRHHCR CG V+C  CS KR+LLP QS  PVRVCD CY+ L  G+
Sbjct:    8 SEANSKRINLVESCFGTAGQPLAIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLENVTIDTIEDEGELRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVCDLISKSGKTP-NSEHAAVWIPDSEATICMRCKKVKFTPVNRRHHCRKCGYVICGPCSEKRYLLPSQSSKPVRVCDFCYDLLSNGD 215          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Xenopus
Match: plekhf1 (pleckstrin homology and FYVE domain containing 1 [Source:NCBI gene;Acc:548764])

HSP 1 Score: 186.422 bits (472), Expect = 1.043e-56
Identity = 96/200 (48.00%), Postives = 127/200 (63.50%), Query Frame = 1
Query:  109 ERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQL 708
            +RI  +EN FG SG PLS   R L+GEGIL K CRKKPK R FFLFSDILVYG+IV++  +   Q II +E+V +  L D I     + +K+ KKSF + A S  E+++W+ H+++CI +  +K G        +P WIPD     CM C  T F ++NRRHHCR CG VVC  CS  ++L+P     PVRVC LCY++L
Sbjct:   13 QRIAVVENCFGTSGQPLSTPGRVLVGEGILTKECRKKPKPRTFFLFSDILVYGNIVINKVRYNTQRIIPLEDVTVEILPDSIDMRNRWMIKTSKKSFVVSAASYSERKEWICHIEECIHQLLQKTGRQPSKEHAAP-WIPDKATDICMRCTQTNFTLVNRRHHCRKCGFVVCHECSKYKFLIPTIKSKPVRVCSLCYKKL 211          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Xenopus
Match: mc3r (melanocortin 3 receptor [Source:Xenbase;Acc:XB-GENE-986713])

HSP 1 Score: 102.834 bits (255), Expect = 1.773e-23
Identity = 65/220 (29.55%), Postives = 114/220 (51.82%), Query Frame = 1
Query:  109 ERIIEIENMFGLSGI-PLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKS------------------PVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLK 711
            +++I+I+  + L+G   + Q  R  + EG LMK+ RK  + R F+LF+D L+Y + V  G   +  +++ +  +++   + +        ++S ++SF + A SA E++ W+  +   I+E +KK+  +  + TKS                  P+WIPD     CM+C  + F +  RRHHCR CG ++C  CS  +  L Y      RVCD C++ L+
Sbjct:  985 QKLIQIQ--YSLNGHHEIVQPGRVFLKEGTLMKLSRKVMQPRMFYLFNDALLYTTPVQSGMYKLN-NMLSLAGMKVRKPTQEAY-QNELNIESVERSFILSASSASERDDWLEAISLAIEEYAKKK--ITFNPTKSLEEADPGEKEDCTLGSTAPIWIPDGRVTMCMIC-TSEFTLTWRRHHCRACGKIICQACSTNKHSLEYLKNHLARVCDRCFQVLQ 1197          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Xenopus
Match: FGD4 (FYVE, RhoGEF and PH domain containing 4 [Source:NCBI gene;Acc:100038050])

HSP 1 Score: 80.8777 bits (198), Expect = 3.211e-16
Identity = 53/187 (28.34%), Postives = 92/187 (49.20%), Query Frame = 1
Query:  175 KLIGEGILMKMCRKK--PKERHFFLFSDILVY--GSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWM----NHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLK 711
            +LI EG ++K+  +    +ER+ FL +++L+Y      + G K   +  I +E +++ +  ++  P+  F +   +++  + A S + KE+W+    N+    I         +     ++P WI D     CM C+    A+  RRHHCR CG VVC  CS  +  L Y S    +VC  CY+ L+
Sbjct:  244 ELIKEGQILKLAARNTSAQERYLFLLNNMLLYCVPKFSLVGTKYTLRTKIGLEGMKVVETQNEDYPH-TFQISGKERTLELQASSEQNKEEWIKVSDNYYIILIYLYILYLSSISELGLRAPRWIRDNEVTMCMKCKEQFNALTRRRHHCRACGYVVCWKCSDYKATLEYDSNKMNKVCKDCYKILR 429          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Xenopus
Match: FGD4 (FYVE, RhoGEF and PH domain containing 4 [Source:NCBI gene;Acc:100038050])

HSP 1 Score: 77.7962 bits (190), Expect = 3.472e-15
Identity = 53/189 (28.04%), Postives = 94/189 (49.74%), Query Frame = 1
Query:  175 KLIGEGILMKMCRKK--PKERHFFLFSDILVY--GSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVS------AEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLK 711
            +LI EG ++K+  +    +ER+ FL +++L+Y      + G K   +  I +E +++ +  ++  P+  F +   +++  + A+        ++ E +   + K ++E   +   +GL A   P WI D     CM C+    A+  RRHHCR CG VVC  CS  +  L Y S    +VC  CY+ L+
Sbjct:  204 ELIKEGQILKLAARNTSAQERYLFLLNNMLLYCVPKFSLVGTKYTLRTKIGLEGMKVVETQNEDYPH-TFQISGKERTLELQALRDTIAEVQQKNETFKIAIAKELEETPSEVAELGLRA---PRWIRDNEVTMCMKCKEQFNALTRRRHHCRACGYVVCWKCSDYKATLEYDSNKMNKVCKDCYKILR 388          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Mouse
Match: Plekhf2 (pleckstrin homology domain containing, family F (with FYVE domain) member 2 [Source:MGI Symbol;Acc:MGI:1919051])

HSP 1 Score: 219.164 bits (557), Expect = 6.500e-70
Identity = 106/209 (50.72%), Postives = 138/209 (66.03%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGN 720
            S ++  RI  +E+ FG +G PL+   R LIGEG+L K+CRKKPK R FFLF+DILVYG+IV+  KK   QHII +E V I  + D+     G+ +K+P KSFA+YA +A EK +WMNH+ KC+ +   K G    S   + VW+PD+ A  CM C+   F  +NRRHHCR CG VVC  CS KR+LLP QS  PVR+CD CY+ L  G+
Sbjct:    8 SEANTRRISIVESCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGELRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKTP-SNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSTGD 215          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Mouse
Match: Plekhf2 (pleckstrin homology domain containing, family F (with FYVE domain) member 2 [Source:MGI Symbol;Acc:MGI:1919051])

HSP 1 Score: 197.208 bits (500), Expect = 6.092e-62
Identity = 97/191 (50.79%), Postives = 126/191 (65.97%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQS 666
            S ++  RI  +E+ FG +G PL+   R LIGEG+L K+CRKKPK R FFLF+DILVYG+IV+  KK   QHII +E V I  + D+     G+ +K+P KSFA+YA +A EK +WMNH+ KC+ +   K G    S   + VW+PD+ A  CM C+   F  +NRRHHCR CG VVC  CS KR+LLP QS
Sbjct:    8 SEANTRRISIVESCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGELRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKTP-SNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQS 197          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Mouse
Match: Plekhf1 (pleckstrin homology domain containing, family F (with FYVE domain) member 1 [Source:MGI Symbol;Acc:MGI:1919537])

HSP 1 Score: 189.889 bits (481), Expect = 4.292e-58
Identity = 94/204 (46.08%), Postives = 129/204 (63.24%), Query Frame = 1
Query:  103 SDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKV 714
            + +RI  +E+ FG SG PL+   R L+GEG+L K CRKK K R FFLF+DILVYGSIV+  +K   QHII +EEV +  L + +     + +K+ KKSF + A S  E+++W++H+++C+       G    +   +P WIPD     CM C  T F+ L RRHHCR CG VVC+ CS +R+LLP  SP P+RVC LCY +L  
Sbjct:   11 NSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLSKRKYRSQHIIPLEEVTLEPLPETLQAKNRWMIKTAKKSFVVSAASTTERQEWISHIEECVRRQLLATGRQPTTEHAAP-WIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRERFLLPRLSPKPLRVCSLCYRELAA 213          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Mouse
Match: Fgd6 (FYVE, RhoGEF and PH domain containing 6 [Source:MGI Symbol;Acc:MGI:1261419])

HSP 1 Score: 112.849 bits (281), Expect = 6.930e-27
Identity = 70/231 (30.30%), Postives = 121/231 (52.38%), Query Frame = 1
Query:  109 ERIIEIENMFGLSGI-PLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKR----------------GLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGNEIISPRFPYP 750
            +++++I+  + LSG   + Q  R  + EG LMK+ RK  + R FFLF+D L+Y + +  G   +  +++ +  +++   + +        ++S ++SF + A SA E++ W+  +   I+E +KKR                  V     K+P+WIPD  A  CM+C  + F +  RRHHCR CG +VC  CS  ++ L Y      RVC+ C+++L+  +  +SPR   P
Sbjct: 1038 QKLMQIQ--YSLSGHHEIVQPGRVFLKEGTLMKLSRKVMQPRMFFLFNDALLYTTPMQSGMYKLN-NMLSLAGMKVRKPTQEAY-QNELKIESVERSFILSASSAAERDDWLEAISSSIEEYAKKRITFCPSRSLDEDSERKEEVSPLGAKAPIWIPDTRATMCMIC-TSEFTLTWRRHHCRACGKIVCQACSSNKYGLDYLKGQLARVCEHCFQELQKLDHQLSPRVGSP 1263          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Mouse
Match: Fgd2 (FYVE, RhoGEF and PH domain containing 2 [Source:MGI Symbol;Acc:MGI:1347084])

HSP 1 Score: 99.7525 bits (247), Expect = 1.144e-22
Identity = 73/241 (30.29%), Postives = 115/241 (47.72%), Query Frame = 1
Query:   88 SMSNSSDERIIEIENMFGL------SGIPLSQVD--RKLIGEGILMKMC--RKKPKERHFFLFSDILVY--GSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKK--------RGLVGLS----------ATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGN 720
            S +  S+  I E+E + GL       G+    VD    L+ EG ++K+   R  P ER+  LF+++L+Y    ++  G +   +  I++  +++ +L+D   P+  F V   +++  + A S +E   WM   Q  ID+  K+        +G  G +            ++P W+ D +   CM C+    A+  RRHHCR CG VVC+ CS  R  L Y S  P RVC  CY  L  GN
Sbjct:  282 SAAQHSNAAIAEMERLQGLWDVYQRLGLEDDIVDPSNTLLREGPVLKISFRRSDPMERYLVLFNNMLLYCVPRVLQVGAQFQVRTRIDVAGMKVRELTDAEFPH-SFLVSGKQRTLELQARSRDEMVSWMQACQAAIDQVEKRSETFKAAVQGPQGDTQEPKPQVEELGLRAPQWVRDKMVTMCMRCQEPFNALTRRRHHCRACGYVVCAKCSDYRAELKYDSNRPNRVCLTCYTFL-TGN 520          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. UniProt/SwissProt
Match: sp|Q9H8W4|PKHF2_HUMAN (Pleckstrin homology domain-containing family F member 2 OS=Homo sapiens OX=9606 GN=PLEKHF2 PE=1 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 6.064e-70
Identity = 107/209 (51.20%), Postives = 138/209 (66.03%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGN 720
            S ++  RI  +EN FG +G PL+   R LIGEG+L K+CRKKPK R FFLF+DILVYG+IV+  KK   QHII +E V I  + D+     G+ +K+P KSFA+YA +A EK +WMNH+ KC+ +   K G    S   + VW+PD+ A  CM C+   F  +NRRHHCR CG VVC  CS KR+LLP QS  PVR+CD CY+ L  G+
Sbjct:    8 SEANTRRISIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKTP-SNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSAGD 215          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. UniProt/SwissProt
Match: sp|Q5ZLY5|PKHF2_CHICK (Pleckstrin homology domain-containing family F member 2 OS=Gallus gallus OX=9031 GN=PLEKHF2 PE=2 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.716e-69
Identity = 107/208 (51.44%), Postives = 137/208 (65.87%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVG 717
            S ++  RI  +EN FG +G PL+   R LIGEG+L K+CRKKPK R FFLF+DILVYG+IV+  KK   QHII +E V I  + D+     G+ +K+P KSFA+YA +A EK +WMNH+ KC+ +   K G    S   + VW+PD+ A  CM C+   F  +NRRHHCR CG VVC  CS KR+LLP QS  PVR+CD CY+ L  G
Sbjct:    8 SEANTRRISIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLENVTIDSIQDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVSDLLSKSGKTP-SNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVRICDSCYDLLSTG 214          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. UniProt/SwissProt
Match: sp|Q91WB4|PKHF2_MOUSE (Pleckstrin homology domain-containing family F member 2 OS=Mus musculus OX=10090 GN=Plekhf2 PE=1 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 4.547e-69
Identity = 106/209 (50.72%), Postives = 138/209 (66.03%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGN 720
            S ++  RI  +E+ FG +G PL+   R LIGEG+L K+CRKKPK R FFLF+DILVYG+IV+  KK   QHII +E V I  + D+     G+ +K+P KSFA+YA +A EK +WMNH+ KC+ +   K G    S   + VW+PD+ A  CM C+   F  +NRRHHCR CG VVC  CS KR+LLP QS  PVR+CD CY+ L  G+
Sbjct:    8 SEANTRRISIVESCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGELRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKTP-SNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSTGD 215          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. UniProt/SwissProt
Match: sp|O76902|PKHF1_DROME (Pleckstrin homology domain-containing family F member 1 homolog OS=Drosophila melanogaster OX=7227 GN=rush PE=1 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 8.813e-68
Identity = 98/206 (47.57%), Postives = 141/206 (68.45%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLK 711
            S ++  RI  +EN FG SG+PL+   R L+GEG+L KMCRK+PK R FFLF+DILVYG+IV+  KK   QHI+ +EEV +  ++D+     G+ +++  KSF ++A ++ EK++WM H+ KC+++  +K G   +    + VW+PD  A  CM C+ T F  + RRHHCR+CG VVC+ CS K++LLP QS   +RVCD CYE+LK
Sbjct:    8 SEANTRRIASVENCFGSSGVPLAMQGRVLVGEGVLTKMCRKRPKSRQFFLFNDILVYGNIVIGKKKYNKQHIMPLEEVSLESIADNQTYRNGWYIRTTTKSFVVFAATSTEKQEWMAHINKCVEDLLRKSGKKPVE-NHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQQSTKALRVCDACYERLK 212          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. UniProt/SwissProt
Match: sp|Q7ZUV1|PKHF2_DANRE (Pleckstrin homology domain-containing family F member 2 OS=Danio rerio OX=7955 GN=plekhf2 PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 4.637e-67
Identity = 105/215 (48.84%), Postives = 142/215 (66.05%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGNEIISPR 738
            S ++ +RI  +E  FG +G PL+   R LIGEG+L K+CRK+PK R FFLF+DILVYG+IV+  KK   QHII +E V I  + D+     G+ +K+P KSFA+YA +A EK +WM+H+ KC+ +  +K G    +   + VW+PD+ A  CM C+   F  +NRRHHCR CG VVC  CS K++LLP QS  PVRVC+ CY+QL  G   + PR
Sbjct:    8 SEANSKRIGVVEACFGTAGQPLAIPGRVLIGEGVLTKLCRKRPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLESVTIDTVEDEGELRNGWLIKTPTKSFAVYAATATEKSEWMSHINKCVSDLLEKSGK-SPTGEHAAVWVPDSEATVCMRCQKMKFTPVNRRHHCRKCGFVVCGPCSEKKFLLPSQSSKPVRVCEFCYKQLSTG-ATLPPR 220          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. TrEMBL
Match: A0A443RKS4 (Pleckstrin domain-containing family F member 2-like protein OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_06700 PE=4 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 2.709e-73
Identity = 109/202 (53.96%), Postives = 145/202 (71.78%), Query Frame = 1
Query:  112 RIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVG 717
            RI  +EN FG+SG+PL+   R L+GEGIL KMCRKKPK R FFLF+DILVYG+IV+ GKK   QHII +EEV++ DL DD     G+ +K+P KSFA+YA +  EK++WM H+Q+C+DE  K+ G    +   + VW+PDA A +CM C  + F++LNRRHHCR CG V+C  CS  ++L+P QS  PVRVCD C+++L  G
Sbjct:   14 RIANVENCFGISGVPLNIPGRVLVGEGILTKMCRKKPKPRQFFLFNDILVYGNIVLKGKKYSRQHIIPLEEVKLEDLKDDDAMQNGWLIKTPTKSFAVYAATNTEKQEWMQHIQRCVDELIKRTGK-QPTGEHAAVWVPDAEARRCMHCNKSEFSLLNRRHHCRSCGAVICGACSKHKFLIPTQSSKPVRVCDTCFDKLSKG 214          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. TrEMBL
Match: A0A1S3IFL5 (LOW QUALITY PROTEIN: pleckstrin homology domain-containing family F member 2-like OS=Lingula unguis OX=7574 GN=LOC106163866 PE=4 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 2.749e-69
Identity = 106/205 (51.71%), Postives = 143/205 (69.76%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQL 708
            S+++++RI  +E  FG SG PL+   R L+GEG+L KMCRK+PK R FFLF+DILVYG+IV++ KK   QHI+ +E+V++  + D+     G+ + SP KSF +YA +A EK +WM H+ KC+ +   KRG    +   SPVWIPD+ A KCM C    F++LNRRHHCR CG VVC+ CS K+WLLP QS  P+RVC  CY+QL
Sbjct:    8 SDANNKRIAFVEQCFGSSGQPLTVPGRVLVGEGVLTKMCRKRPKPRQFFLFNDILVYGNIVINKKKYNKQHILPLEDVKLQSVEDEGSLRNGWQIISPSKSFTVYAATATEKAEWMAHINKCVQDLLAKRGKKHQAVDDSPVWIPDSEASKCMQCNRVEFSILNRRHHCRKCGRVVCNPCSSKKWLLPQQSSKPLRVCLNCYDQL 212          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. TrEMBL
Match: A0A433TXR7 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_005843 PE=4 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 3.398e-69
Identity = 99/205 (48.29%), Postives = 147/205 (71.71%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQL 708
            S ++  R+  +E  FG SG PL    R L+GEG+L K+CRK+ K R FFLF+D LVYG+I++H KK   QHI+ +E+V++ +++DD     G+ + +PKKSF +YA +A EK++WM H++KC+++   +RG+    +T SPVW+PD+ A  CM C  + F+++NRRHHCRHCG+V C++C+ KRWLLP QS  P+RVC  CY++L
Sbjct:    8 SEANARRVHNVEQCFGSSGQPLGIPGRVLVGEGVLTKICRKRAKPRQFFLFNDALVYGNIIIHKKKYNKQHILALEDVKLENVNDDGNLRNGWKIINPKKSFVVYAATATEKKEWMAHIRKCVEDLLTQRGVSRSCSTDSPVWVPDSEAKNCMHCSKSEFSMVNRRHHCRHCGIVACNSCTSKRWLLPEQSTKPIRVCLTCYQKL 212          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. TrEMBL
Match: T1G2W8 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20215416 PE=4 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 6.569e-69
Identity = 107/205 (52.20%), Postives = 140/205 (68.29%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQL 708
            S ++ +RI  +E  FG+SG PL+   R L+GEG+L KMCRKKPK R FFLF+DILVYG+I+++ KK   QHII +E+V +  + D+   Y G+ + SP KSF +YA +A EK +WM H+ +CI E  K RG   +    SPVW+PD  A  CM CR + F V+NRRHHCR CG V C+ C+ KRWLLP  S  PVRVC++CYE L
Sbjct:    5 SEANSKRINFVEQCFGVSGQPLAAPRRVLVGEGVLTKMCRKKPKPRQFFLFNDILVYGNIIINKKKYNKQHIINLEDVSLESVPDEGELYNGWQIISPSKSFTVYAATAMEKVEWMAHITRCIQELHKTRGKKSMVTEASPVWVPDNNADVCMRCRKSEFNVINRRHHCRKCGFVCCNDCTNKRWLLPCISTKPVRVCNVCYESL 209          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. TrEMBL
Match: A0A087TG54 (Pleckstrin domain-containing family F member 2 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_12958 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 6.696e-69
Identity = 113/205 (55.12%), Postives = 142/205 (69.27%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQL 708
            S ++  RI  +EN FG SG PL+   R L+GEG+L KMCRKK K R FFLF+DILVYG+IV+  KK   QHII +EEV++ +L DD I   G+ +++P KSFA+YA +A EK +WM H+ KC+D+  KK G    S   + VWIPDA A  CM CR T F VLNRRHHCR CG VVC+ CS K++LLP QS  P+RVC  CY+ L
Sbjct:    8 SEANARRIATVENCFGASGQPLAIQGRVLVGEGVLTKMCRKKGKPREFFLFNDILVYGNIVMDKKKYNKQHIIPLEEVKLENLKDDGILKNGWLIRTPTKSFAVYAATATEKMEWMAHINKCVDDLLKKTGK-KPSLEHAAVWIPDAEASVCMHCRKTQFTVLNRRHHCRKCGAVVCNPCSSKKFLLPAQSSKPLRVCLSCYDTL 211          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Cavefish
Match: plekhf2 (pleckstrin homology and FYVE domain containing 2 [Source:NCBI gene;Acc:103028556])

HSP 1 Score: 216.853 bits (551), Expect = 4.603e-69
Identity = 104/205 (50.73%), Postives = 139/205 (67.80%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQL 708
            S ++ +RI  +E  FG +G PL+   R LIGEG+L K+CRKKPK R FFLF+DILVYG+IV+  KK   QHII +E V I  ++D+     G+ +K+P KSFA+YA +A EK +WMNH+ KC+ +  +K G    +   + VW+PD+ A  CM C+   F  ++RRHHCR CG VVC  CS K++LLP QS  PVRVC+ CYEQL
Sbjct:    8 SEANSKRIAVVEGCFGTAGQPLAIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLESVTIDTVADEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHISKCVSDLLEKSGK-SPTGEHAAVWVPDSEASVCMRCQKVKFTPVSRRHHCRKCGFVVCGPCSEKKFLLPSQSSKPVRVCEFCYEQL 211          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Cavefish
Match: PLEKHF1 (pleckstrin homology and FYVE domain containing 1 [Source:NCBI gene;Acc:103028531])

HSP 1 Score: 171.014 bits (432), Expect = 1.012e-50
Identity = 92/210 (43.81%), Postives = 130/210 (61.90%), Query Frame = 1
Query:  109 ERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGL-VGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGNEIISP 735
            ERI  + + FG SG  L +  R L+GEG L+K+C+++P+ R FFLF+DILVYGSIV+ G+    Q II +EEVE  DL D       + +K+P+KSF + A SAEEK+ WM H++ C +   +  G  V +    +  WIPD  +  CM C  + F V +RRHHCR CG +VC++CS  R +L   S  PVRVC LC   L+  +++ +P
Sbjct:   13 ERIQAVASSFGPSGRSLMEPGRVLVGEGRLIKLCKRRPQPRSFFLFNDILVYGSIVMGGRWNKKQQIIRLEEVEQEDLEDSAQMCNQWLLKTPRKSFYVAAASAEEKQAWMEHIENCRNLKLQSLGRPVNVQPVFAATWIPDHASAICMRCS-SRFTVTHRRHHCRCCGFIVCNSCSKARVVLKNISNKPVRVCGLCKTGLENKDKMKTP 221          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Cavefish
Match: ENSAMXT00000014177.2 (FYVE, RhoGEF and PH domain-containing protein 6-like [Source:NCBI gene;Acc:103024376])

HSP 1 Score: 114.005 bits (284), Expect = 1.993e-27
Identity = 69/206 (33.50%), Postives = 108/206 (52.43%), Query Frame = 1
Query:  172 RKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLS---------------ATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLK---VGNEIISP 735
            R L+ EG LMK+ RK  + R FFLF+D L+Y + +  G+  +   +  +  +++S  S +        ++S ++SF + A S   +++W+  +   I++ +KK    G S                +K+P+WIPD  A  CM+C    F +  RRHHCR CG VVC  CS  ++ L Y    P RVCD C+E L+    G+ I+SP
Sbjct:  836 RTLLKEGTLMKLSRKVMQPRMFFLFNDTLLYTTPLQTGQYKLNNEL-SLAGMKVSKPSQEG-HQNELNIESVERSFILSASSPTARDEWLEAISAAINDYTKKMISFGSSRSPEEGGKDTVDAQLGSKAPIWIPDLRATMCMICTCE-FTLTWRRHHCRACGKVVCQACSTNKYPLEYLKYHPERVCDQCFETLQHNSSGSSILSP 1038          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Cavefish
Match: fgd6 (FYVE, RhoGEF and PH domain containing 6 [Source:NCBI gene;Acc:103037109])

HSP 1 Score: 112.464 bits (280), Expect = 6.564e-27
Identity = 69/199 (34.67%), Postives = 107/199 (53.77%), Query Frame = 1
Query:  163 QVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYG-FCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKR---------GLVGLS------ATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLK 711
            Q  R  + EG LMK+ RK  + R FFLF+DIL+Y + V  G+  V   ++ +  +++S  S  +  Y     ++S ++SF + A SA E+++W+  +   I++ ++K+            GLS       +K+P+WIPD     CM+C    F +  RRHHCR CG VVC  CS  ++ L Y      RVCD CY +L+
Sbjct:  950 QPGRVFLKEGTLMKLSRKVMQPRMFFLFNDILLYTTPVQSGQYKVNS-MLSLAGMKVSKPS--LEAYQNELNIESVERSFILSASSATERDEWLEAIATAIEDYTRKKISFISSRSQESEGLSVDGPPLGSKAPIWIPDLRTTMCMICTCE-FTLTWRRHHCRACGKVVCQACSSNKYYLEYLKNQLARVCDQCYAKLQ 1144          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Cavefish
Match: ENSAMXT00000054774.1 (FYVE, RhoGEF and PH domain-containing protein 4-like [Source:NCBI gene;Acc:103046578])

HSP 1 Score: 89.7373 bits (221), Expect = 2.499e-19
Identity = 59/212 (27.83%), Postives = 103/212 (48.58%), Query Frame = 1
Query:  112 RIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPK--ERHFFLFSDILVY--GSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCID----------ECSKKRGLVGLS--ATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCY 699
            +++EI  M G     +     + I EG ++K+  +     +R+ FLF+++L+Y      + G+K   +  I I+ +++++  ++  P+  F V   +++  + A + ++KE W+   Q+ I+            SK+   V +S    ++P WI D     CM CR    A+  RRHHCR CG VVC  CS  +  L Y      +VC  CY
Sbjct:  326 KLLEIYEMLGEEE-DIVNASNEFIKEGHILKLAARNTSAMDRYLFLFNNMLLYCVPKFSLVGQKFTVRTRIGIDGMKVAETYNEDYPH-TFQVSGKERTLELQASTQQDKEDWIKAFQETIEIFHQKNETFKTASKEVEEVSISELGKRAPRWIRDNEVTMCMKCREPFNALTRRRHHCRACGYVVCWKCSDNKASLEYDGNKMNKVCRDCY 535          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Sea Lamprey
Match: plekhf2 (pleckstrin homology domain containing, family F (with FYVE domain) member 2 [Source:NCBI gene;Acc:393214])

HSP 1 Score: 187.193 bits (474), Expect = 3.418e-58
Identity = 87/207 (42.03%), Postives = 128/207 (61.84%), Query Frame = 1
Query:   88 SMSNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQL 708
            + S  +  RI  IE+ FG +G PL    R L+GEG L K+CRK PK R FFLF D++VYG+ V+  ++   Q ++ +E V I  L D+     G+ +++P KSF ++A +  E+ +W+ H+++C+ E   KRGL       +  W+PD+ A  CM  + + F  LNRRHHCR CG+VVC  CS +R+LLP QS  P+RVC  C++ L
Sbjct:    6 ASSEENCRRIARIESCFGAAGRPLMAPGRVLVGEGTLTKLCRKGPKPRQFFLFDDMVVYGAAVLGNRRYANQRVLALEAVTICTLPDEGELSNGWLMQTPAKSFKVFAATESERAEWIGHIERCVRELRAKRGLPPHGLEPAAWWVPDSSASACMRRQRSRFNALNRRHHCRKCGIVVCGACSDRRFLLPGQSSRPLRVCIDCFDSL 212          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005437.1 (pep scaffold:Pmarinus_7.0:GL486528:10206:16522:1 gene:ENSPMAG00000004933.1 transcript:ENSPMAT00000005437.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 3.747e-24
Identity = 63/226 (27.88%), Postives = 110/226 (48.67%), Query Frame = 1
Query:   97 NSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRK--KPKERHFFLFSDILVY--GSIVVHGKKLVGQHIIEIEEVEISDLSD-DIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDEC-SKKRGLVGLSAT----------------KSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQL 708
            N   + ++ +  M G     +   D +L+ EGI++K   +   P+ER+ FLF+++L++    +   G++   +  I + ++E+ D++  D +P +  C    +++    A + EEK+ WM  + + I     K+   +G +A                 ++P+W+ D     CM C+     +  RRHHCR CG VVC  CS  R LL Y+     RVC+ CY QL
Sbjct:   67 NEHMQALLRVHEMLGGEVTDIVCPDTELLKEGIILKRSVRIGVPQERYLFLFNNMLLHCVPKLWSMGQRYTLRTRINVRDLEVKDVNQHDQVPTFQVC--GVQRTIDFQARTEEEKQDWMKAINEVIKTFREKEETFMGHTANVSDVSPPATQGMELGQRAPMWVRDVNVTLCMTCQDPFTTLTRRRHHCRACGKVVCWKCSDHRVLLAYEPRKLQRVCEACYAQL 290          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001934.1 (pep scaffold:Pmarinus_7.0:GL488632:1056:3278:1 gene:ENSPMAG00000001758.1 transcript:ENSPMAT00000001934.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 5.987e-14
Identity = 30/66 (45.45%), Postives = 41/66 (62.12%), Query Frame = 1
Query:  502 ATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCY 699
            A +  VW+ D  A  C +C    F++  R+HHCR+CG + C++CS     LP  SP PVRVCDLC+
Sbjct:   49 ALQGQVWLKDQDATNCKLCE-KEFSISRRKHHCRNCGEIFCNSCSDNELPLPS-SPKPVRVCDLCH 112          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Sea Lamprey
Match: eea1 (early endosome antigen 1 [Source:ZFIN;Acc:ZDB-GENE-041111-270])

HSP 1 Score: 68.1662 bits (165), Expect = 8.263e-13
Identity = 29/64 (45.31%), Postives = 38/64 (59.38%), Query Frame = 1
Query:  520 WIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLK 711
            W  D     CM C    F+V  R+HHCRHCG + C  CS +  ++P  +  PVRVCD C+E+LK
Sbjct: 1307 WAEDGEVQNCMGCG-KGFSVTVRKHHCRHCGNIFCGECSARNSMIP-SAKKPVRVCDTCFEELK 1368          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Sea Lamprey
Match: zfyve9a (zinc finger, FYVE domain containing 9a [Source:ZFIN;Acc:ZDB-GENE-070705-182])

HSP 1 Score: 63.929 bits (154), Expect = 1.754e-11
Identity = 29/69 (42.03%), Postives = 38/69 (55.07%), Query Frame = 1
Query:  502 ATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQL 708
             T +P+W+PDA AP CM C+   F    RRHHCR CG V C+ C  ++  L Y      RVC  C+  +
Sbjct:    4 GTSAPMWVPDAEAPNCMRCKAR-FTFTRRRHHCRACGKVFCAPCCSQKSRLRYMENKEARVCIRCHTHI 71          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Yeast
Match: VPS27 (Endosomal protein that forms a complex with Hse1p; required for recycling Golgi proteins, forming lumenal membranes and sorting ubiquitinated proteins destined for degradation; has Ubiquitin Interaction Motifs which bind ubiquitin (Ubi4p) [Source:SGD;Acc:S000005289])

HSP 1 Score: 55.0694 bits (131), Expect = 7.158e-9
Identity = 32/80 (40.00%), Postives = 42/80 (52.50%), Query Frame = 1
Query:  496 LSATKSPVWIPDALAPK-------CMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLP----YQSPVPVRVCDLCYE 702
            L+ + SP  + D+  P        CM+C    F++LNR+HHCR CG V C   S     LP    Y+   PVRVCD C+E
Sbjct:  152 LTLSNSPTAMFDSKTPADWIDSDACMICS-KKFSLLNRKHHCRSCGGVFCQEHSSNSIPLPDLGIYE---PVRVCDSCFE 227          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Yeast
Match: PIB1 (RING-type ubiquitin ligase of the endosomal and vacuolar membranes; binds phosphatidylinositol(3)-phosphate; contains a FYVE finger domain [Source:SGD;Acc:S000002721])

HSP 1 Score: 50.0618 bits (118), Expect = 1.530e-7
Identity = 30/84 (35.71%), Postives = 42/84 (50.00%), Query Frame = 1
Query:  520 WIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCS-------------LKRWLLPYQSPVPVRVCDLCYEQLKVGNEIIS 732
            W  D  A  C  C+ T F+ L RRHHCR CG + CS+C+             L++     +SP P R C+ CY+ L   N ++S
Sbjct:   14 WQADEEAHSCFQCK-TNFSFLVRRHHCRCCGRIFCSSCTENFVNYNKKRVHALQKKNSDVESP-PYRTCNECYDNLLHLNLLVS 95          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Yeast
Match: FAB1 (1-phosphatidylinositol-3-phosphate 5-kinase; vacuolar membrane kinase that generates phosphatidylinositol (3,5)P2, which is involved in vacuolar sorting and homeostasis [Source:SGD;Acc:S000001915])

HSP 1 Score: 50.0618 bits (118), Expect = 3.548e-7
Identity = 23/62 (37.10%), Postives = 32/62 (51.61%), Query Frame = 1
Query:  520 WIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQ 705
            W+ D  + +C  C  T F    R+HHCR CG + CS+C+L      +     +RVC  CYE 
Sbjct:  237 WMKDESSKECFSCGKT-FNTFRRKHHCRICGQIFCSSCTLLIDGDRFGCHAKMRVCYNCYEH 297          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Nematostella
Match: EDO38501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCW3])

HSP 1 Score: 209.534 bits (532), Expect = 9.268e-67
Identity = 106/219 (48.40%), Postives = 137/219 (62.56%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPL--SQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGNEIISPRFP 744
            S ++  RI  +++ FG SG PL      R L+GEG+L K+CRKKPK R FFLF+DILVYG+IV++ KK   QHII +EE+++  L DD     G+ + S KKSFA+YA +A EK +WM H+ KCI +   K G        + VW+PD+ A  CM C  T F  +NRRHHCR CG VVC  CS K++LLP QS  P+RVC+ CY  L        PR P
Sbjct:    8 SEANKRRIQHVQSCFGSSGQPLWLENKSRVLVGEGVLTKLCRKKPKPRQFFLFNDILVYGNIVINKKKYNKQHIIPLEEIKLLTLEDDGNLKNGWQIISTKKSFAVYAATATEKAEWMAHINKCIQDLLAKTGKKA-GGVHAAVWVPDSEASTCMSCMKTKFTAINRRHHCRKCGAVVCGACSTKKFLLPAQSSKPLRVCNSCYNTL----SNTKPRAP 221          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Nematostella
Match: EDO48232 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKE8])

HSP 1 Score: 122.865 bits (307), Expect = 2.049e-31
Identity = 80/237 (33.76%), Postives = 118/237 (49.79%), Query Frame = 1
Query:   97 NSSDERIIEIENMFGLSGIPLSQVD-----RKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKK-------LVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKK--------RGLVGLS-----ATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGNEIIS 732
            N S +R+   E +  + G  +   +     R+ I +G L+K+CRK  +ER FFL +D+L+Y + V   +        L+G  +I  E  E  +          F + S  +SF + A ++ E+++W+  L++ I+  +KK         G+   S       K+PVWIPDA    CM+C    F V NRRHHCR CG VVC +CS     L Y      RVCD+CYE L  G E +S
Sbjct:  184 NESMKRVDNFEQVLRIQGSLVGHEEIVRPGREFIKQGNLLKLCRKDMQERTFFLLTDVLLYTAPVGGNQYKLRETLPLLGMKVILPESQEFVN---------EFSIISTTRSFTLSASTSAERDEWLEELERAINAMTKKKISFFKSKEGITQDSEDTKLGEKAPVWIPDARVTMCMLC-TDDFTVTNRRHHCRGCGKVVCGSCSDNLAPLTYLDYAQARVCDMCYEVLLRGKEQLS 410          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Nematostella
Match: EDO33626 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRN5])

HSP 1 Score: 63.1586 bits (152), Expect = 5.493e-11
Identity = 41/119 (34.45%), Postives = 66/119 (55.46%), Query Frame = 1
Query:  109 ERIIEIE-NMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVY---GSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQ 453
            ++IIE++ ++ G+    L Q  R+ I EG L KM RK P+ R FFLFSD+L+Y   G  + +  ++ GQ  I +  V++ D   ++   + F +    K   + A S EEK +W+  LQ
Sbjct:  895 QKIIELQRDLIGVDN--LVQQGREFIREGCLQKMTRKGPQPRMFFLFSDLLLYTCKGVTLTNQFRVRGQ--IPLHTVKLEDTGPELHGLFPFNINFSNKHMTVAAPSEEEKYKWLEDLQ 1009          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Nematostella
Match: EDO48184 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK38])

HSP 1 Score: 58.9214 bits (141), Expect = 7.530e-11
Identity = 30/72 (41.67%), Postives = 38/72 (52.78%), Query Frame = 1
Query:  502 ATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVG 717
             TK+P WI D     CM+C   +F +  RRHHCR CG + C+ CS  +  L Y+     RVC  C E L  G
Sbjct:    7 GTKAPAWIRDESVTMCMLCD-ALFTLTRRRHHCRACGGIYCNACSHNKAPLEYRDGKLCRVCRSCREILVHG 77          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Nematostella
Match: EDO39875 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S0])

HSP 1 Score: 57.3806 bits (137), Expect = 5.071e-10
Identity = 24/50 (48.00%), Postives = 37/50 (74.00%), Query Frame = 1
Query:  571 FAVLNRRHHCRHCGVVVCSTCSLKRW-LLPYQSPVPVRVCDLCYEQLKVG 717
            F++ +R+HHCRHCG ++C+ CS K+  ++ Y+   PVRVCD+C+E L  G
Sbjct:  122 FSIKHRKHHCRHCGRLLCAKCSCKQIPIIKYELAKPVRVCDVCFEMLTSG 171          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Medaka
Match: plekhf2 (pleckstrin homology and FYVE domain containing 2 [Source:NCBI gene;Acc:101160441])

HSP 1 Score: 214.157 bits (544), Expect = 5.587e-68
Identity = 105/209 (50.24%), Postives = 140/209 (66.99%), Query Frame = 1
Query:   94 SNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGN 720
            S ++ +RI  +E+ FG +G PL+   R LIGEG+L K+CRKKPK R FFLF+DILVYG+IV+  KK   QHII +E V I  + D+     G+ +K+P KSFA+YA +A EK +WMNH+ KC+ +  +K G    +   + VW+PD+ A  CM C    F  +NRRHHCR CG VVC+ CS K++LLP QS  PVRVC+ CY QL  G+
Sbjct:    8 SEANSKRIGMVESCFGAAGQPLAIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLESVTIDTVPDEGDLRNGWLIKTPTKSFAVYAATATEKCEWMNHIGKCVKDLLQKSGK-SPTGEHAAVWVPDSEASVCMRCLKVKFTAVNRRHHCRKCGYVVCNPCSEKKYLLPSQSSKPVRVCEFCYAQLTSGS 215          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Medaka
Match: ENSORLT00000018711.2 (pleckstrin homology domain-containing family F member 1-like [Source:NCBI gene;Acc:101175000])

HSP 1 Score: 148.288 bits (373), Expect = 2.584e-42
Identity = 82/215 (38.14%), Postives = 125/215 (58.14%), Query Frame = 1
Query:   79 PYKSMSNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSP-VPVRVCDLCYEQLKVGN 720
            PY    + +   I E++  F     PL Q  R L+G+G LMK  RKK   + FFLF+D+LVYGSI++  +    Q +I +E++++ DL D     + + + SP KSF + A+S EEK+ WM H+++C     +  G    S+  +P WIPD ++ +CM C  T+F++  R+HHCR CG +VCS CS  R ++    P   VRVC LC ++ +  N
Sbjct:    3 PYLVFDSENRRLIGELDKSFSPPRQPLLQPGRVLLGKGSLMKQGRKKWDLKAFFLFNDVLVYGSIIMKDRWFKKQKVIRLEDIKMEDLEDSEDFKHQWLICSPTKSFFVSALSLEEKKAWMEHIEECRRNLLQGGGCTP-SSRYAPTWIPDHVSQRCMRC-FTIFSLSKRKHHCRSCGFLVCSQCSKARAVIDALHPKKEVRVCKLCNKKGEEDN 215          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Medaka
Match: ENSORLT00000040317.1 (pleckstrin homology domain-containing family F member 1-like [Source:NCBI gene;Acc:101175000])

HSP 1 Score: 147.517 bits (371), Expect = 2.996e-42
Identity = 82/210 (39.05%), Postives = 126/210 (60.00%), Query Frame = 1
Query:   97 NSSDERII-EIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVP-VRVCDLCYEQLKVGN 720
            +S + R+I E++  F     PL Q  R L+G+G LMK  RKK   + FFLF+D+LVYGSI++  +    Q +I +E++++ DL D     + + + SP KSF + A+S EEK+ WM H+++C     +  G    S+  +P WIPD ++ +CM C  T+F++  R+HHCR CG +VCS CS  R ++    P   VRVC LC ++ +  N
Sbjct:    7 DSENRRLIGELDKSFSPPRQPLLQPGRVLLGKGSLMKQGRKKWDLKAFFLFNDVLVYGSIIMKDRWFKKQKVIRLEDIKMEDLEDSEDFKHQWLICSPTKSFFVSALSLEEKKAWMEHIEECRRNLLQGGGCTP-SSRYAPTWIPDHVSQRCMRC-FTIFSLSKRKHHCRSCGFLVCSQCSKARAVIDALHPKKEVRVCKLCNKKGEEDN 214          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Medaka
Match: fgd6 (FYVE, RhoGEF and PH domain-containing protein 6 [Source:NCBI gene;Acc:101165435])

HSP 1 Score: 119.783 bits (299), Expect = 1.934e-29
Identity = 69/200 (34.50%), Postives = 109/200 (54.50%), Query Frame = 1
Query:  163 QVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSA-----------------TKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLK 711
            Q  R  + EG LMK+ RK  + R FFLF+D L+Y + V  G+  +   ++ +  +++S  S +        ++S ++SF + A SA E+++W+  + K ID+ +KK+ +  +S+                 +K+P+WIPD  A  CM+C    F +  RRHHCR CG VVC  CS  ++ L Y    P RVCD C+ +LK
Sbjct:  938 QPGRVFLKEGTLMKLSRKVMQPRMFFLFNDALMYTTPVQSGQYKLNS-VLSLAGMKVSKPSQEAYQNE-LNIESVERSFILSASSATERDEWLEAIAKAIDDYTKKK-ITFISSRSQEEAEVFVDNGAPLGSKAPIWIPDLRATMCMICTCE-FTLTWRRHHCRACGKVVCQACSTNKYYLEYLKNQPARVCDHCFAKLK 1133          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Medaka
Match: FGD6 (FYVE, RhoGEF and PH domain-containing protein 6 [Source:NCBI gene;Acc:101155348])

HSP 1 Score: 114.775 bits (286), Expect = 1.118e-27
Identity = 67/198 (33.84%), Postives = 108/198 (54.55%), Query Frame = 1
Query:  163 QVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLS---------------ATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLK 711
            Q  R    EGILMK+ RK  + R FFLF+DIL+Y   V  G+  + ++++ +  +++S  + +        ++S ++SF + A SA E++ W+N +   I++ +KK+ +  LS                +K+P+WIPD     CM+C  + F +  RRHHCR CG V+C  CS  +  L Y      RVCDLC++ L+
Sbjct:  843 QPGRIFFKEGILMKLSRKVMQPRMFFLFNDILLYTKPVQTGQYKL-KNMLSLAGMKVSKPNQEAYQNE-LNIESVERSFILSASSATERDDWLNSISAAINDFTKKK-ITFLSGNPANEADLTDGTPLGSKAPIWIPDPRTTMCMICT-SEFTLTWRRHHCRACGKVICQGCSSNKHYLQYMKKSD-RVCDLCFQTLR 1035          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Planmine SMEST
Match: SMESG000038764.1 (SMESG000038764.1)

HSP 1 Score: 479.945 bits (1234), Expect = 1.320e-172
Identity = 261/261 (100.00%), Postives = 261/261 (100.00%), Query Frame = 1
Query:   91 MSNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGNEIISPRFPYPPIKNNXXXXXXXXXXXXXXXXXNQSINLLNLTNPNISQILE 873
            MSNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGNEIISPRFPYPPIKNNTEDYLSETSSEDSDYDENQSINLLNLTNPNISQILE
Sbjct:    1 MSNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGNEIISPRFPYPPIKNNTEDYLSETSSEDSDYDENQSINLLNLTNPNISQILE 261          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Planmine SMEST
Match: SMESG000038764.1 (SMESG000038764.1)

HSP 1 Score: 451.44 bits (1160), Expect = 1.346e-161
Identity = 247/247 (100.00%), Postives = 247/247 (100.00%), Query Frame = 1
Query:  133 MFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGNEIISPRFPYPPIKNNXXXXXXXXXXXXXXXXXNQSINLLNLTNPNISQILE 873
            MFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGNEIISPRFPYPPIKNNTEDYLSETSSEDSDYDENQSINLLNLTNPNISQILE
Sbjct:    1 MFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGNEIISPRFPYPPIKNNTEDYLSETSSEDSDYDENQSINLLNLTNPNISQILE 247          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Planmine SMEST
Match: SMESG000028452.1 (SMESG000028452.1)

HSP 1 Score: 206.068 bits (523), Expect = 3.280e-65
Identity = 101/215 (46.98%), Postives = 144/215 (66.98%), Query Frame = 1
Query:   91 MSNSS--DERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFFLFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPKKSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQ--LKVGNE 723
            M+N +  + RI  +EN+FG++G+PL   +R+LIGEG+L K+CR+KPK+RHFFLF+DILVYG+I+++ KKL  QHI E+E + + ++  +    + F V +PKKSF + AVS +E+ QW+ H++K   EC  K           PVWIPD  A KCM C LT F+ + RRHHCR CG VVC+ CS ++ +LP QS   +RVC  C+ Q  +K+ N 
Sbjct:    1 MANQTVIESRIKYVENLFGVNGMPLYNSNRELIGEGVLFKLCRRKPKQRHFFLFNDILVYGNIILYKKKLTSQHIFELESLTVEEVKGNENFPFQFKVMTPKKSFIICAVSEDERTQWILHIRKYSKECETKTLSRNKPVGFCPVWIPDTEAMKCMTCNLTEFSWIQRRHHCRSCGNVVCAKCSQQKIILPNQSHNALRVCVRCFLQNNIKIDNN 215          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Planmine SMEST
Match: SMESG000019696.1 (SMESG000019696.1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.128e-13
Identity = 33/73 (45.21%), Postives = 43/73 (58.90%), Query Frame = 1
Query:  520 WIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGNEIISPR 738
            WI D  AP CM C+  VF++ NRRHHCR CG VVC  CS  R ++     V VR+C  C++ +   N+  S R
Sbjct: 2282 WIQDRDAPVCMCCKKEVFSMFNRRHHCRKCGWVVCGVCSTHRTMI---KGVTVRICTKCHKSIH-DNQYFSSR 2350          
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Planmine SMEST
Match: SMESG000019696.1 (SMESG000019696.1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.128e-13
Identity = 33/73 (45.21%), Postives = 43/73 (58.90%), Query Frame = 1
Query:  520 WIPDALAPKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCDLCYEQLKVGNEIISPR 738
            WI D  AP CM C+  VF++ NRRHHCR CG VVC  CS  R ++     V VR+C  C++ +   N+  S R
Sbjct: 2283 WIQDRDAPVCMCCKKEVFSMFNRRHHCRKCGWVVCGVCSTHRTMI---KGVTVRICTKCHKSIH-DNQYFSSR 2351          
The following BLAST results are available for this feature:
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLEKHF21.263e-7051.20pleckstrin homology and FYVE domain containing 2 [... [more]
PLEKHF21.263e-7051.20pleckstrin homology and FYVE domain containing 2 [... [more]
PLEKHF11.895e-5947.52pleckstrin homology and FYVE domain containing 1 [... [more]
PLEKHF11.895e-5947.52pleckstrin homology and FYVE domain containing 1 [... [more]
PLEKHF13.857e-3046.61pleckstrin homology and FYVE domain containing 1 [... [more]
back to top
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZK632.122.237e-6346.34pep chromosome:WBcel235:III:9830802:9832378:1 gene... [more]
ZK632.122.237e-6346.34pep chromosome:WBcel235:III:9830792:9832430:1 gene... [more]
aka-11.539e-1243.66A Kinase Anchor protein [Source:UniProtKB/TrEMBL;... [more]
aka-11.539e-1243.66A Kinase Anchor protein [Source:UniProtKB/TrEMBL;... [more]
aka-16.498e-1150.00A Kinase Anchor protein [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rush8.792e-6947.57gene:FBgn0025381 transcript:FBtr0070259[more]
rush8.792e-6947.57gene:FBgn0025381 transcript:FBtr0339589[more]
Sara3.024e-1345.16gene:FBgn0026369 transcript:FBtr0071641[more]
CG60514.807e-1346.91gene:FBgn0039492 transcript:FBtr0339264[more]
CG60514.896e-1346.91gene:FBgn0039492 transcript:FBtr0305050[more]
back to top
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhf26.143e-6848.84pleckstrin homology domain containing, family F (w... [more]
plekhf26.143e-6848.84pleckstrin homology domain containing, family F (w... [more]
plekhf13.079e-4943.41pleckstrin homology domain containing, family F (w... [more]
plekhf13.079e-4943.41pleckstrin homology domain containing, family F (w... [more]
fgd63.801e-2834.85FYVE, RhoGEF and PH domain containing 6 [Source:ZF... [more]
back to top
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4g37.331e-6950.72eukaryotic translation initiation factor 4 gamma, ... [more]
plekhf11.043e-5648.00pleckstrin homology and FYVE domain containing 1 [... [more]
mc3r1.773e-2329.55melanocortin 3 receptor [Source:Xenbase;Acc:XB-GEN... [more]
FGD43.211e-1628.34FYVE, RhoGEF and PH domain containing 4 [Source:NC... [more]
FGD43.472e-1528.04FYVE, RhoGEF and PH domain containing 4 [Source:NC... [more]
back to top
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plekhf26.500e-7050.72pleckstrin homology domain containing, family F (w... [more]
Plekhf26.092e-6250.79pleckstrin homology domain containing, family F (w... [more]
Plekhf14.292e-5846.08pleckstrin homology domain containing, family F (w... [more]
Fgd66.930e-2730.30FYVE, RhoGEF and PH domain containing 6 [Source:MG... [more]
Fgd21.144e-2230.29FYVE, RhoGEF and PH domain containing 2 [Source:MG... [more]
back to top
BLAST of Pleckstrin homology domain-containing family F member 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H8W4|PKHF2_HUMAN6.064e-7051.20Pleckstrin homology domain-containing family F mem... [more]
sp|Q5ZLY5|PKHF2_CHICK1.716e-6951.44Pleckstrin homology domain-containing family F mem... [more]
sp|Q91WB4|PKHF2_MOUSE4.547e-6950.72Pleckstrin homology domain-containing family F mem... [more]
sp|O76902|PKHF1_DROME8.813e-6847.57Pleckstrin homology domain-containing family F mem... [more]
sp|Q7ZUV1|PKHF2_DANRE4.637e-6748.84Pleckstrin homology domain-containing family F mem... [more]
back to top
BLAST of Pleckstrin homology domain-containing family F member 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443RKS42.709e-7353.96Pleckstrin domain-containing family F member 2-lik... [more]
A0A1S3IFL52.749e-6951.71LOW QUALITY PROTEIN: pleckstrin homology domain-co... [more]
A0A433TXR73.398e-6948.29Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
T1G2W86.569e-6952.20Uncharacterized protein OS=Helobdella robusta OX=6... [more]
A0A087TG546.696e-6955.12Pleckstrin domain-containing family F member 2 (Fr... [more]
back to top
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhf24.603e-6950.73pleckstrin homology and FYVE domain containing 2 [... [more]
PLEKHF11.012e-5043.81pleckstrin homology and FYVE domain containing 1 [... [more]
ENSAMXT00000014177.21.993e-2733.50FYVE, RhoGEF and PH domain-containing protein 6-li... [more]
fgd66.564e-2734.67FYVE, RhoGEF and PH domain containing 6 [Source:NC... [more]
ENSAMXT00000054774.12.499e-1927.83FYVE, RhoGEF and PH domain-containing protein 4-li... [more]
back to top
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhf23.418e-5842.03pleckstrin homology domain containing, family F (w... [more]
ENSPMAT00000005437.13.747e-2427.88pep scaffold:Pmarinus_7.0:GL486528:10206:16522:1 g... [more]
ENSPMAT00000001934.15.987e-1445.45pep scaffold:Pmarinus_7.0:GL488632:1056:3278:1 gen... [more]
eea18.263e-1345.31early endosome antigen 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
zfyve9a1.754e-1142.03zinc finger, FYVE domain containing 9a [Source:ZFI... [more]
back to top
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
VPS277.158e-940.00Endosomal protein that forms a complex with Hse1p;... [more]
PIB11.530e-735.71RING-type ubiquitin ligase of the endosomal and va... [more]
FAB13.548e-737.101-phosphatidylinositol-3-phosphate 5-kinase; vacuo... [more]
back to top
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO385019.268e-6748.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482322.049e-3133.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336265.493e-1134.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481847.530e-1141.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398755.071e-1048.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhf25.587e-6850.24pleckstrin homology and FYVE domain containing 2 [... [more]
ENSORLT00000018711.22.584e-4238.14pleckstrin homology domain-containing family F mem... [more]
ENSORLT00000040317.12.996e-4239.05pleckstrin homology domain-containing family F mem... [more]
fgd61.934e-2934.50FYVE, RhoGEF and PH domain-containing protein 6 [S... [more]
FGD61.118e-2733.84FYVE, RhoGEF and PH domain-containing protein 6 [S... [more]
back to top
BLAST of Pleckstrin homology domain-containing family F member 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038764.11.320e-172100.00SMESG000038764.1[more]
SMESG000038764.11.346e-161100.00SMESG000038764.1[more]
SMESG000028452.13.280e-6546.98SMESG000028452.1[more]
SMESG000019696.11.128e-1345.21SMESG000019696.1[more]
SMESG000019696.11.128e-1345.21SMESG000019696.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003223 ID=SMED30003223|Name=Pleckstrin homology domain-containing family F member 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1007bp
GATTATTTGAATTATAATTTTTGGAATAATTAATTTAAAATTTATTTAAC
GTATAATTTATTAATAATTTAACAAATACCTTATAAATCGATGAGCAATA
GCAGTGATGAAAGGATAATAGAAATAGAAAATATGTTTGGTTTATCTGGA
ATCCCACTCAGTCAAGTCGACAGAAAACTAATAGGCGAAGGAATATTAAT
GAAAATGTGTAGGAAAAAACCAAAAGAACGCCATTTTTTCTTATTCTCAG
ACATCCTCGTTTACGGAAGTATAGTAGTTCACGGTAAAAAGTTAGTAGGC
CAACACATCATCGAAATAGAAGAGGTAGAAATCAGTGATCTCAGTGATGA
TATAATTCCTTATTATGGATTTTGTGTCAAAAGTCCAAAAAAATCTTTTG
CGATGTACGCTGTTTCAGCTGAAGAAAAAGAGCAGTGGATGAATCATTTA
CAAAAGTGTATTGATGAGTGTTCTAAAAAACGTGGTTTAGTCGGCTTATC
TGCCACAAAATCCCCAGTTTGGATTCCCGATGCCTTAGCTCCGAAATGTA
TGGTCTGTCGCCTTACAGTTTTCGCTGTATTGAATAGAAGACACCACTGC
AGACATTGTGGAGTCGTAGTATGCAGCACCTGTTCATTAAAGCGGTGGTT
ATTGCCATACCAGTCGCCTGTACCAGTAAGGGTCTGTGATTTGTGCTACG
AGCAACTGAAAGTTGGAAATGAGATTATCAGTCCCCGATTCCCGTATCCA
CCTATCAAAAACAATACGGAAGATTATTTATCAGAAACCTCAAGCGAGGA
TTCGGATTATGATGAGAATCAGTCTATCAATCTGCTCAATTTGACAAATC
CGAATATATCTCAAATTTTGGAATAAATAAAATGCAAATGTCCCGACTTG
TAAATGACAGATTTGATTGCCATTATTTCATTGGAAATGGAAATTTTATT
ATTTTACTTAATCCAAATTTTTTACCGAATCTTGTAACTTTTTACAATTA
TTTTTAT
back to top

protein sequence of SMED30003223-orf-1

>SMED30003223-orf-1 ID=SMED30003223-orf-1|Name=SMED30003223-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=262bp
MSNSSDERIIEIENMFGLSGIPLSQVDRKLIGEGILMKMCRKKPKERHFF
LFSDILVYGSIVVHGKKLVGQHIIEIEEVEISDLSDDIIPYYGFCVKSPK
KSFAMYAVSAEEKEQWMNHLQKCIDECSKKRGLVGLSATKSPVWIPDALA
PKCMVCRLTVFAVLNRRHHCRHCGVVVCSTCSLKRWLLPYQSPVPVRVCD
LCYEQLKVGNEIISPRFPYPPIKNNTEDYLSETSSEDSDYDENQSINLLN
LTNPNISQILE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005768endosome
GO:0005783endoplasmic reticulum
GO:0016020membrane
GO:0030133transport vesicle
GO:0031901early endosome membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR001849PH_domain
IPR000306Znf_FYVE
IPR011993PH-like_dom_sf
IPR013083Znf_RING/FYVE/PHD
IPR017455Znf_FYVE-rel
IPR011011Znf_FYVE_PHD
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0015031protein transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 30..127
e-value: 1.1E-13
score: 61.5
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 33..124
e-value: 2.7E-8
score: 34.2
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 29..125
score: 11.372
IPR000306FYVE zinc fingerSMARTSM00064fyve_4coord: 139..208
e-value: 3.6E-25
score: 99.6
IPR000306FYVE zinc fingerPFAMPF01363FYVEcoord: 143..207
e-value: 5.5E-18
score: 64.9
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 22..122
e-value: 3.4E-22
score: 80.8
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 134..216
e-value: 6.9E-23
score: 82.1
NoneNo IPR availablePANTHERPTHR46280FAMILY NOT NAMEDcoord: 6..218
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 11..127
IPR017455Zinc finger, FYVE-relatedPROSITEPS50178ZF_FYVEcoord: 147..207
score: 12.312
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 142..213