BTB domain-containing protein

Overview
NameBTB domain-containing protein
Smed IDSMED30003217
Length (bp)1661
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BTB domain-containing protein (SMED30003217) t-SNE clustered cells

Violin plots show distribution of expression levels for BTB domain-containing protein (SMED30003217) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003217

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30003217SMESG000068855.1 Contig3642_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: IPP (intracisternal A particle-promoted polypeptide [Source:HGNC Symbol;Acc:HGNC:6108])

HSP 1 Score: 71.633 bits (174), Expect = 1.868e-12
Identity = 46/186 (24.73%), Postives = 95/186 (51.08%), Query Frame = 3
Query:   57 EHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHEDLMILLNDDRL-VLRNGEMN 611
            +H   +L ++N+ R     CD  ++ G + FK+H+++L  SS  F  L   +  +++S    + I  +   +  F   L ++YTG ++I  +N+ +++  AD  ++  VV  CC+ +   +   N  GI+Q ++ +  + L+E   +Y         +FL+  S E+ + L  D  + +LR+ E++
Sbjct:   18 KHAQLILAQINKMRNGQHFCDVQLQVGQESFKAHRLVLAASSPYFAALF--TGGMKESSKDVVPILGIE--AGIFQILLDFIYTGIVNIGVNNVQELIIAADMLQLTEVVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFSENYIHV------HFLEVHSGEEFLALTKDQLIKILRSEELS 193          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: IPP (intracisternal A particle-promoted polypeptide [Source:HGNC Symbol;Acc:HGNC:6108])

HSP 1 Score: 71.2478 bits (173), Expect = 2.271e-12
Identity = 46/186 (24.73%), Postives = 95/186 (51.08%), Query Frame = 3
Query:   57 EHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHEDLMILLNDDRL-VLRNGEMN 611
            +H   +L ++N+ R     CD  ++ G + FK+H+++L  SS  F  L   +  +++S    + I  +   +  F   L ++YTG ++I  +N+ +++  AD  ++  VV  CC+ +   +   N  GI+Q ++ +  + L+E   +Y         +FL+  S E+ + L  D  + +LR+ E++
Sbjct:   18 KHAQLILAQINKMRNGQHFCDVQLQVGQESFKAHRLVLAASSPYFAALF--TGGMKESSKDVVPILGIE--AGIFQILLDFIYTGIVNIGVNNVQELIIAADMLQLTEVVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFSENYIHV------HFLEVHSGEEFLALTKDQLIKILRSEELS 193          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: ZBTB5 (zinc finger and BTB domain containing 5 [Source:HGNC Symbol;Acc:HGNC:23836])

HSP 1 Score: 68.5514 bits (166), Expect = 1.741e-11
Identity = 38/112 (33.93%), Postives = 64/112 (57.14%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFC 395
            H   + ++LN +R+  Q CDC I  GN+ FK+H+ +L   S+ F  L  + A+ +Q+ N+ I++DS V  +E F + +  +YT  + +   N+ DVL  A    ++ VVK C
Sbjct:    6 HFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALF-SVAEGDQTMNM-IQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNSVVKAC 115          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: ZBTB40 (zinc finger and BTB domain containing 40 [Source:HGNC Symbol;Acc:HGNC:29045])

HSP 1 Score: 68.1662 bits (165), Expect = 3.201e-11
Identity = 37/117 (31.62%), Postives = 64/117 (54.70%), Query Frame = 3
Query:   72 VLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLS 422
            +L++L     + Q CDCTI  G   F++HK++L  +S +F+ L++N+         TI ID+ V   E F   L  +YTGK+ +   N   ++ LAD+ ++  V   C + +T L++
Sbjct:   10 LLQQLYTLCKEQQFCDCTISIGTIYFRAHKLVLAAASLLFKTLLDNTD--------TISIDASVVSPEEFALLLEMMYTGKLPVGKHNFSKIISLADSLQMFDVAVSCKNLLTSLVN 118          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: ZBTB40 (zinc finger and BTB domain containing 40 [Source:HGNC Symbol;Acc:HGNC:29045])

HSP 1 Score: 68.1662 bits (165), Expect = 3.201e-11
Identity = 37/117 (31.62%), Postives = 64/117 (54.70%), Query Frame = 3
Query:   72 VLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLS 422
            +L++L     + Q CDCTI  G   F++HK++L  +S +F+ L++N+         TI ID+ V   E F   L  +YTGK+ +   N   ++ LAD+ ++  V   C + +T L++
Sbjct:   10 LLQQLYTLCKEQQFCDCTISIGTIYFRAHKLVLAAASLLFKTLLDNTD--------TISIDASVVSPEEFALLLEMMYTGKLPVGKHNFSKIISLADSLQMFDVAVSCKNLLTSLVN 118          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: kel-3 (KELch-repeat containing protein [Source:UniProtKB/TrEMBL;Acc:O18147])

HSP 1 Score: 58.151 bits (139), Expect = 9.825e-9
Identity = 48/179 (26.82%), Postives = 84/179 (46.93%), Query Frame = 3
Query:   87 NEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDL-QQNSLIEICYSYFGFEFYNL--DNFLQRISHEDLMILLNDDRLVLRNGEMNY 614
            NE R K Q CD  +   N+   +HK+IL  +   F  +   + D+ ++    I I+      E   + LS+ YTG++ IT  N+  ++  A+ F++  VV+ C + +   L   N   I +  K +  +  + E+   Y    F  +  D   +R+S ED + LL +D L + + E  Y
Sbjct:   42 NELRSKCQLCDVALLVENRKLSAHKVILAATIPYFRGMF--TLDLMEANMKEINIEDSDMNYETVDALLSFAYTGELRITTSNVQSIMLGANFFQMLEVVQHCGNFLLTRLHPSNALSIREFCKMMCVEEKITEMTDDYIQKHFMAVSKDEDFKRLSLEDAIELLRNDHLYVDSEEQVY 218          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: kel-3 (KELch-repeat containing protein [Source:UniProtKB/TrEMBL;Acc:O18147])

HSP 1 Score: 56.9954 bits (136), Expect = 2.274e-8
Identity = 48/179 (26.82%), Postives = 85/179 (47.49%), Query Frame = 3
Query:   87 NEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDL-QQNSLIEICYSYFGFEFYNL--DNFLQRISHEDLMILLNDDRLVLRNGEMNY 614
            NE R K Q CD  +   N+   +HK+IL  +   F  +   + D+ ++    I I+ +    E   + LS+ YTG++ IT  N+  ++  A+ F++  VV+ C + +   L   N   I +  K +  +  + E+   Y    F  +  D   +R+S ED + LL +D L + + E  Y
Sbjct:   42 NELRSKCQLCDVALLVENRKLSAHKVILAATIPYFRGMF--TLDLMEANMKEINIEDM--NYETVDALLSFAYTGELRITTSNVQSIMLGANFFQMLEVVQHCGNFLLTRLHPSNALSIREFCKMMCVEEKITEMTDDYIQKHFMAVSKDEDFKRLSLEDAIELLRNDHLYVDSEEQVY 216          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: kel-3 (KELch-repeat containing protein [Source:UniProtKB/TrEMBL;Acc:O18147])

HSP 1 Score: 56.9954 bits (136), Expect = 2.274e-8
Identity = 48/179 (26.82%), Postives = 85/179 (47.49%), Query Frame = 3
Query:   87 NEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDL-QQNSLIEICYSYFGFEFYNL--DNFLQRISHEDLMILLNDDRLVLRNGEMNY 614
            NE R K Q CD  +   N+   +HK+IL  +   F  +   + D+ ++    I I+ +    E   + LS+ YTG++ IT  N+  ++  A+ F++  VV+ C + +   L   N   I +  K +  +  + E+   Y    F  +  D   +R+S ED + LL +D L + + E  Y
Sbjct:   42 NELRSKCQLCDVALLVENRKLSAHKVILAATIPYFRGMF--TLDLMEANMKEINIEDM--NYETVDALLSFAYTGELRITTSNVQSIMLGANFFQMLEVVQHCGNFLLTRLHPSNALSIREFCKMMCVEEKITEMTDDYIQKHFMAVSKDEDFKRLSLEDAIELLRNDHLYVDSEEQVY 216          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: W07A12.4 (pep chromosome:WBcel235:II:9148356:9152311:1 gene:WBGene00012322.1 transcript:W07A12.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07A12.4)

HSP 1 Score: 56.225 bits (134), Expect = 3.806e-8
Identity = 38/144 (26.39%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  108 QNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCD----TITELLSLDNIFGIY-QIAKDLQQNSLIEICYSYFGFEFYNL 524
            Q  D  +K G + + +H++IL  SS VF++++    + ++ +   +E D L +  + F  FL ++Y+  + +  DN   +L LAD + +  + K C D     I  ++ L  +F ++   A      SLI+ C      EF  L
Sbjct:   43 QFSDVNMKVGEESYPAHRLILSKSSDVFDRMMSQKWNGDKFDLELVE-DELCQ--KAFAPFLRFMYSNHVVLHKDNCLPLLVLADKYNVTTLKKVCLDFAQSEILPVIDLKELFSVWFSYATKAYHPSLIKSCMQAIALEFETL 183          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: W07A12.4 (pep chromosome:WBcel235:II:9146280:9152311:1 gene:WBGene00012322.1 transcript:W07A12.4c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07A12.4)

HSP 1 Score: 55.8398 bits (133), Expect = 4.820e-8
Identity = 38/144 (26.39%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  108 QNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCD----TITELLSLDNIFGIY-QIAKDLQQNSLIEICYSYFGFEFYNL 524
            Q  D  +K G + + +H++IL  SS VF++++    + ++ +   +E D L +  + F  FL ++Y+  + +  DN   +L LAD + +  + K C D     I  ++ L  +F ++   A      SLI+ C      EF  L
Sbjct:   43 QFSDVNMKVGEESYPAHRLILSKSSDVFDRMMSQKWNGDKFDLELVE-DELCQ--KAFAPFLRFMYSNHVVLHKDNCLPLLVLADKYNVTTLKKVCLDFAQSEILPVIDLKELFSVWFSYATKAYHPSLIKSCMQAIALEFETL 183          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: CG9426 (gene:FBgn0032485 transcript:FBtr0080484)

HSP 1 Score: 68.9366 bits (167), Expect = 5.989e-12
Identity = 47/192 (24.48%), Postives = 91/192 (47.40%), Query Frame = 3
Query:   72 VLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNL---DNFLQRISHEDLMILLNDDRLVLRNGEMNYFFVGLNYI 638
            VL  LN+ R +++ CD  I  G     +H+ +L  +S+ FE +      + + +  ++ + ++     H    L ++YTG+ +IT  N+ ++L  AD  +++ VV  CC+ +   L   N  GI + A+     SL +   ++    F  +   D FL+  + + L+  L +  L+  + E   F   L +I
Sbjct:   69 VLSNLNQLREQSRFCDVEIIAGMATLSAHRAVLSAASAYFEAMFRPELGLNEVKQKSVVLHTIDGDILHI--LLDFIYTGRCEITQSNVQELLAAADMLQLNEVVDGCCEFLCRELHASNALGILRFAEAHNCESLAKSALNFVHANFPAVTLEDEFLE--TPQTLLSQLLNSELLRVDSESQVFQAALRWI 256          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: kel (gene:FBgn0001301 transcript:FBtr0081043)

HSP 1 Score: 63.1586 bits (152), Expect = 4.943e-10
Identity = 46/189 (24.34%), Postives = 83/189 (43.92%), Query Frame = 3
Query:   57 EHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEF---YNLDNFLQRISHEDLMILLNDDRLVLRNGEMNY 614
            +H     + +NE R + Q CD  +   +    +H+++L   S  F  +  +    E+S    I + S+   +      + Y+YT  +++  DN+  +L  A+  ++  V   CCD +   L   N  GI + A       L+    +Y    F      D FL  +SHE ++ L+ +DR+ + N E  Y
Sbjct:  138 QHTARSFDAMNEMRKQKQLCDVILVADDVEIHAHRMVLASCSPYFYAMFTS---FEESRQARITLQSVD--ARALELLIDYVYTATVEVNEDNVQVLLTAANLLQLTDVRDACCDFLQTQLDASNCLGIREFADIHACVELLNYAETYIEQHFNEVIQFDEFLN-LSHEQVISLIGNDRISVPNEERVY 320          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: kel (gene:FBgn0001301 transcript:FBtr0081042)

HSP 1 Score: 58.9214 bits (141), Expect = 7.987e-9
Identity = 46/189 (24.34%), Postives = 83/189 (43.92%), Query Frame = 3
Query:   57 EHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEF---YNLDNFLQRISHEDLMILLNDDRLVLRNGEMNY 614
            +H     + +NE R + Q CD  +   +    +H+++L   S  F  +  +    E+S    I + S+   +      + Y+YT  +++  DN+  +L  A+  ++  V   CCD +   L   N  GI + A       L+    +Y    F      D FL  +SHE ++ L+ +DR+ + N E  Y
Sbjct:  138 QHTARSFDAMNEMRKQKQLCDVILVADDVEIHAHRMVLASCSPYFYAMFTS---FEESRQARITLQSV--DARALELLIDYVYTATVEVNEDNVQVLLTAANLLQLTDVRDACCDFLQTQLDASNCLGIREFADIHACVELLNYAETYIEQHFNEVIQFDEFLN-LSHEQVISLIGNDRISVPNEERVY 320          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: Keap1 (gene:FBgn0038475 transcript:FBtr0083423)

HSP 1 Score: 58.5362 bits (140), Expect = 1.308e-8
Identity = 30/124 (24.19%), Postives = 62/124 (50.00%), Query Frame = 3
Query:  117 DCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEI 488
            D  ++   +LF +HK++L  +S  F+ +   +  +++SE   +++  +   +      L ++YTG+I +T   +C +L  A  F++  V+  CC  +   L   N  GI   A   +Q+  +E+
Sbjct:   91 DVVLEVKKELFPAHKVVLSAASPYFKAMF--TGGLKESEMSRVQLQGVCPTA--MSRILYFMYTGQIRVTEVTVCQLLPAATMFQVPNVIDACCAFLERQLDPTNAIGIAHFA---EQHGCVEL 207          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: Keap1 (gene:FBgn0038475 transcript:FBtr0083424)

HSP 1 Score: 58.151 bits (139), Expect = 1.581e-8
Identity = 30/124 (24.19%), Postives = 62/124 (50.00%), Query Frame = 3
Query:  117 DCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEI 488
            D  ++   +LF +HK++L  +S  F+ +   +  +++SE   +++  +   +      L ++YTG+I +T   +C +L  A  F++  V+  CC  +   L   N  GI   A   +Q+  +E+
Sbjct:   59 DVVLEVKKELFPAHKVVLSAASPYFKAMF--TGGLKESEMSRVQLQGVCPTA--MSRILYFMYTGQIRVTEVTVCQLLPAATMFQVPNVIDACCAFLERQLDPTNAIGIAHFA---EQHGCVEL 175          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: klhl6 (kelch-like family member 6 [Source:ZFIN;Acc:ZDB-GENE-030616-325])

HSP 1 Score: 65.0846 bits (157), Expect = 1.431e-10
Identity = 46/155 (29.68%), Postives = 73/155 (47.10%), Query Frame = 3
Query:  117 DCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIE-IDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHEDLMILLND 578
            D  +   +Q FK H+++L  +S  F  +  N    +  EN+ I+ ID+     +     L Y YT K+ IT DN+  +L+ A  F+  R+V  C   + E L  +N  GI  +A      SL    +SY       + NF Q + HE+++ L  D
Sbjct:   66 DVILNVQSQSFKCHRVVLAAASHYFRAMFCNDLREKHEENVNIKGIDA-----DTMRILLDYTYTSKVTITKDNVQRMLEAACLFQFPRIVDACASYLAEALHPENCVGILHLADVHSLESLKTQVHSYI------VQNFSQVVDHEEILELPAD 209          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: klhl41b (kelch-like family member 41b [Source:NCBI gene;Acc:321064])

HSP 1 Score: 64.6994 bits (156), Expect = 1.792e-10
Identity = 45/184 (24.46%), Postives = 86/184 (46.74%), Query Frame = 3
Query:   45 DTRIEHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNL---DNFLQRISHEDLMILLNDDRL 587
            + R+     + + L E   +N+  DCT+K G++ F  H++I+   S  F +L  +    E+     + +D +          L YLY+ +ID+ +DN+ ++  +A+ F+I  V   C + + + LS+ N   ++++   L    L      +    F  +   + FLQ   HE L+ L+  D L
Sbjct:    9 ELRLFQSTLLQDGLKELLNENKFVDCTLKIGDRCFPCHRLIMAACSPYFRELFFSEDGKEKDIGKEVVLDDVD--PNIMDMILQYLYSAEIDLVDDNVQEIFAVANRFQIPSVFTVCVNYLQQKLSMANCLAVFRLGLVLSVPRLAIAARDFIADRFETVSSEEEFLQLAPHE-LLALIGGDML 189          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: zbtb8b (zinc finger and BTB domain containing 8B [Source:ZFIN;Acc:ZDB-GENE-050417-42])

HSP 1 Score: 63.929 bits (154), Expect = 2.593e-10
Identity = 35/112 (31.25%), Postives = 65/112 (58.04%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFC 395
            +++ +L +LNE+R +N  CDC+I    ++FK+H+ IL  SS  F  L+ +        + T  +D  +  +E F   L +LY+G++D+ +DN+ +++  A   ++  VV FC
Sbjct:    6 YLSRLLSELNEQRKRNFFCDCSIIVEGRVFKAHRNILFASSGYFRALLVHYLQDNGQRHSTASLD--IVTAEAFSFILDFLYSGRLDLRSDNVIEIMSAASYLQMTDVVNFC 115          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: klhl24b (kelch-like family member 24b [Source:ZFIN;Acc:ZDB-GENE-040426-1185])

HSP 1 Score: 62.3882 bits (150), Expect = 1.004e-9
Identity = 46/174 (26.44%), Postives = 76/174 (43.68%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHEDLMILLNDD 581
            H + +L+  NE R      D  I    + F  H+ +L   SS F  +  N  D  +S  + +EI+ +   +E   +FL Y+YTG+  IT DN+  + + +  F+I  +   C   + + L   N  GI + A       L   C S      Y L +F     HE+ + L  ++
Sbjct:   48 HSDSILQMFNEFRDGRLFTDVVISVEGREFPCHRAVLSACSSYFRAMFCN--DHRESREMLVEINGIR--AEAMDTFLQYVYTGRARITTDNVQFLFETSSLFQISTLRDACAKFLEDQLDPCNCLGIQRFADAHSLKQLASRCRS------YALQSFADVAQHEEFLDLRKEE 211          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: klhl24b (kelch-like family member 24b [Source:ZFIN;Acc:ZDB-GENE-040426-1185])

HSP 1 Score: 62.3882 bits (150), Expect = 1.004e-9
Identity = 46/174 (26.44%), Postives = 76/174 (43.68%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHEDLMILLNDD 581
            H + +L+  NE R      D  I    + F  H+ +L   SS F  +  N  D  +S  + +EI+ +   +E   +FL Y+YTG+  IT DN+  + + +  F+I  +   C   + + L   N  GI + A       L   C S      Y L +F     HE+ + L  ++
Sbjct:   48 HSDSILQMFNEFRDGRLFTDVVISVEGREFPCHRAVLSACSSYFRAMFCN--DHRESREMLVEINGIR--AEAMDTFLQYVYTGRARITTDNVQFLFETSSLFQISTLRDACAKFLEDQLDPCNCLGIQRFADAHSLKQLASRCRS------YALQSFADVAQHEEFLDLRKEE 211          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: ipp (intracisternal A particle-promoted polypeptide [Source:NCBI gene;Acc:100327249])

HSP 1 Score: 84.3445 bits (207), Expect = 1.294e-16
Identity = 55/181 (30.39%), Postives = 89/181 (49.17%), Query Frame = 3
Query:   57 EHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSY---------FGFEFYNL--DNFLQRISHEDLMI 566
            +H   +L ++N  R + + CD  I+ G+  F  HK++L  SS  F  L+  +  +++S    ++I  L   S  F   L ++YTG + I+ DN+ D++  AD  ++  VV+ CCD + E     N  G +Q A+ L    L+E   SY          G EF  L  D  +Q +  E+L I
Sbjct:   18 KHAQLILAQMNRMRHQLEFCDVQIQIGDVKFGVHKLVLAASSPYFAALL--AGGMKESLTEVVQIQGLNPNS--FQLILDFIYTGSVKISTDNVEDLMTAADMLQLSHVVELCCDFLKEHTEPANCIGFFQFAEHLSCQPLLEYTESYIHTHFTEVQIGDEFPTLTKDQLVQILQSEELSI 194          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: ipp (intracisternal A particle-promoted polypeptide [Source:NCBI gene;Acc:100327249])

HSP 1 Score: 84.3445 bits (207), Expect = 1.304e-16
Identity = 55/181 (30.39%), Postives = 89/181 (49.17%), Query Frame = 3
Query:   57 EHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSY---------FGFEFYNL--DNFLQRISHEDLMI 566
            +H   +L ++N  R + + CD  I+ G+  F  HK++L  SS  F  L+  +  +++S    ++I  L   S  F   L ++YTG + I+ DN+ D++  AD  ++  VV+ CCD + E     N  G +Q A+ L    L+E   SY          G EF  L  D  +Q +  E+L I
Sbjct:   18 KHAQLILAQMNRMRHQLEFCDVQIQIGDVKFGVHKLVLAASSPYFAALL--AGGMKESLTEVVQIQGLNPNS--FQLILDFIYTGSVKISTDNVEDLMTAADMLQLSHVVELCCDFLKEHTEPANCIGFFQFAEHLSCQPLLEYTESYIHTHFTEVQIGDEFPTLTKDQLVQILQSEELSI 194          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: ipp (intracisternal A particle-promoted polypeptide [Source:NCBI gene;Acc:100327249])

HSP 1 Score: 84.3445 bits (207), Expect = 1.458e-16
Identity = 55/181 (30.39%), Postives = 89/181 (49.17%), Query Frame = 3
Query:   57 EHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSY---------FGFEFYNL--DNFLQRISHEDLMI 566
            +H   +L ++N  R + + CD  I+ G+  F  HK++L  SS  F  L+  +  +++S    ++I  L   S  F   L ++YTG + I+ DN+ D++  AD  ++  VV+ CCD + E     N  G +Q A+ L    L+E   SY          G EF  L  D  +Q +  E+L I
Sbjct:   25 KHAQLILAQMNRMRHQLEFCDVQIQIGDVKFGVHKLVLAASSPYFAALL--AGGMKESLTEVVQIQGLNPNS--FQLILDFIYTGSVKISTDNVEDLMTAADMLQLSHVVELCCDFLKEHTEPANCIGFFQFAEHLSCQPLLEYTESYIHTHFTEVQIGDEFPTLTKDQLVQILQSEELSI 201          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: zbtb5 (zinc finger and BTB domain containing 5 [Source:NCBI gene;Acc:550088])

HSP 1 Score: 68.1662 bits (165), Expect = 2.015e-11
Identity = 39/112 (34.82%), Postives = 63/112 (56.25%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFC 395
            H     ++LN +R++ Q CDC I  G++ FK+H+ +L   S+ F  L    A+ +QS N+ I++DS V  SE F + +  +YT  + +   N+ DVL  A    ++ VVK C
Sbjct:    6 HFEQTFQQLNYQRLQGQLCDCVIVVGSRHFKAHRSVLAACSTHFRALF-TVAEGDQSMNM-IQLDSEVVTSEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNSVVKAC 115          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: nphp4.2 (nephronophthisis 4, gene 2 [Source:Xenbase;Acc:XB-GENE-487536])

HSP 1 Score: 67.0106 bits (162), Expect = 4.751e-11
Identity = 50/200 (25.00%), Postives = 93/200 (46.50%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFE-----KLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNF--LQRISHEDLMILLNDDRLVLRNGEMNYFFVGLNYI 638
            H   +L  +NE R + +  D T+  G Q F  H+ +L  +S+ F      +L E+  D  +  ++T  I SL+         L + YTG++ +T +N+  +LQ AD F+   V + CC  + + L + N   I   A+      L E    +       L     ++R++ + ++  ++DDRL + + E   F + L ++
Sbjct:   54 HALHLLRGINELRAEQKFFDMTVSAGGQDFPCHRTVLAAASNYFRAMFAGRLRESHVDRVELHDVTGPILSLL---------LDFCYTGRVTVTLENVEPLLQAADLFQFPSVKEACCAYLEQQLDVSNCLEIQDFAEAYACQGLAESTKRFILAHMAQLAQAHEVERLTFKRMLEYISDDRLCV-DKEEAAFQIALQWV 243          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Zbtb5 (zinc finger and BTB domain containing 5 [Source:MGI Symbol;Acc:MGI:1924601])

HSP 1 Score: 71.633 bits (174), Expect = 4.961e-14
Identity = 39/117 (33.33%), Postives = 66/117 (56.41%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTIT 410
            H   + ++LN +R+  Q CDC I  GN+ FK+H+ +L   S+ F  L  + A+ +Q+ N+ I++DS V  +E F + +  +YT  + +   N+ DVL  A    ++ VVK C   +T
Sbjct:    6 HFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALF-SVAEGDQTMNM-IQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNSVVKACKHYLT 120          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Ipp (IAP promoted placental gene [Source:MGI Symbol;Acc:MGI:96581])

HSP 1 Score: 74.7146 bits (182), Expect = 1.336e-13
Identity = 49/202 (24.26%), Postives = 95/202 (47.03%), Query Frame = 3
Query:   57 EHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLI-----ENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNL---DNFLQRISHEDLMILLNDDRLVLRNGEMNYFFVGLNYI 638
            +H   +L ++N+ R     CD  ++ G + F+ H+++L  SS  F  L      E+S DV Q   +   I         F   L ++YTG ++I   N+ +++  AD  ++  VV  CCD +   +   N  G++Q ++ +  + L+E   +Y    F  +   + FL  ++ + L+ +L  + L + + E   F   + +I
Sbjct:   18 KHAQLILAQMNKMRSGQHFCDVQLQVGKETFQVHRLVLAASSPYFAALFTGGMKESSKDVVQILGVEAGI---------FQLLLDFIYTGVVNIAVTNVQELIVAADMLQLTEVVNLCCDFLKGQIDPQNCIGLFQFSEQIACHDLLEFTENYIHVHFLEVHTGEEFLG-LTKDQLIKILRSEELSIED-EYQVFLAAMQWI 208          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Ipp (IAP promoted placental gene [Source:MGI Symbol;Acc:MGI:96581])

HSP 1 Score: 74.7146 bits (182), Expect = 1.336e-13
Identity = 49/202 (24.26%), Postives = 95/202 (47.03%), Query Frame = 3
Query:   57 EHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLI-----ENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNL---DNFLQRISHEDLMILLNDDRLVLRNGEMNYFFVGLNYI 638
            +H   +L ++N+ R     CD  ++ G + F+ H+++L  SS  F  L      E+S DV Q   +   I         F   L ++YTG ++I   N+ +++  AD  ++  VV  CCD +   +   N  G++Q ++ +  + L+E   +Y    F  +   + FL  ++ + L+ +L  + L + + E   F   + +I
Sbjct:   18 KHAQLILAQMNKMRSGQHFCDVQLQVGKETFQVHRLVLAASSPYFAALFTGGMKESSKDVVQILGVEAGI---------FQLLLDFIYTGVVNIAVTNVQELIVAADMLQLTEVVNLCCDFLKGQIDPQNCIGLFQFSEQIACHDLLEFTENYIHVHFLEVHTGEEFLG-LTKDQLIKILRSEELSIED-EYQVFLAAMQWI 208          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Zbtb5 (zinc finger and BTB domain containing 5 [Source:MGI Symbol;Acc:MGI:1924601])

HSP 1 Score: 68.5514 bits (166), Expect = 1.060e-11
Identity = 38/112 (33.93%), Postives = 64/112 (57.14%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFC 395
            H   + ++LN +R+  Q CDC I  GN+ FK+H+ +L   S+ F  L  + A+ +Q+ N+ I++DS V  +E F + +  +YT  + +   N+ DVL  A    ++ VVK C
Sbjct:    6 HFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALF-SVAEGDQTMNM-IQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNSVVKAC 115          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Zbtb5 (zinc finger and BTB domain containing 5 [Source:MGI Symbol;Acc:MGI:1924601])

HSP 1 Score: 68.5514 bits (166), Expect = 1.060e-11
Identity = 38/112 (33.93%), Postives = 64/112 (57.14%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFC 395
            H   + ++LN +R+  Q CDC I  GN+ FK+H+ +L   S+ F  L  + A+ +Q+ N+ I++DS V  +E F + +  +YT  + +   N+ DVL  A    ++ VVK C
Sbjct:    6 HFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALF-SVAEGDQTMNM-IQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNSVVKAC 115          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|P28575|IPP_MOUSE (Actin-binding protein IPP OS=Mus musculus OX=10090 GN=Ipp PE=2 SV=3)

HSP 1 Score: 74.7146 bits (182), Expect = 9.343e-13
Identity = 49/202 (24.26%), Postives = 95/202 (47.03%), Query Frame = 3
Query:   57 EHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLI-----ENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNL---DNFLQRISHEDLMILLNDDRLVLRNGEMNYFFVGLNYI 638
            +H   +L ++N+ R     CD  ++ G + F+ H+++L  SS  F  L      E+S DV Q   +   I         F   L ++YTG ++I   N+ +++  AD  ++  VV  CCD +   +   N  G++Q ++ +  + L+E   +Y    F  +   + FL  ++ + L+ +L  + L + + E   F   + +I
Sbjct:   18 KHAQLILAQMNKMRSGQHFCDVQLQVGKETFQVHRLVLAASSPYFAALFTGGMKESSKDVVQILGVEAGI---------FQLLLDFIYTGVVNIAVTNVQELIVAADMLQLTEVVNLCCDFLKGQIDPQNCIGLFQFSEQIACHDLLEFTENYIHVHFLEVHTGEEFLG-LTKDQLIKILRSEELSIED-EYQVFLAAMQWI 208          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y573|IPP_HUMAN (Actin-binding protein IPP OS=Homo sapiens OX=9606 GN=IPP PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.090e-11
Identity = 46/186 (24.73%), Postives = 95/186 (51.08%), Query Frame = 3
Query:   57 EHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHEDLMILLNDDRL-VLRNGEMN 611
            +H   +L ++N+ R     CD  ++ G + FK+H+++L  SS  F  L   +  +++S    + I  +   +  F   L ++YTG ++I  +N+ +++  AD  ++  VV  CC+ +   +   N  GI+Q ++ +  + L+E   +Y         +FL+  S E+ + L  D  + +LR+ E++
Sbjct:   18 KHAQLILAQINKMRNGQHFCDVQLQVGQESFKAHRLVLAASSPYFAALF--TGGMKESSKDVVPILGIE--AGIFQILLDFIYTGIVNIGVNNVQELIIAADMLQLTEVVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFSENYIHV------HFLEVHSGEEFLALTKDQLIKILRSEELS 193          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7TQG0|ZBTB5_MOUSE (Zinc finger and BTB domain-containing protein 5 OS=Mus musculus OX=10090 GN=Zbtb5 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 7.417e-11
Identity = 38/112 (33.93%), Postives = 64/112 (57.14%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFC 395
            H   + ++LN +R+  Q CDC I  GN+ FK+H+ +L   S+ F  L  + A+ +Q+ N+ I++DS V  +E F + +  +YT  + +   N+ DVL  A    ++ VVK C
Sbjct:    6 HFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALF-SVAEGDQTMNM-IQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNSVVKAC 115          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|O15062|ZBTB5_HUMAN (Zinc finger and BTB domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZBTB5 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 8.360e-11
Identity = 38/112 (33.93%), Postives = 64/112 (57.14%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFC 395
            H   + ++LN +R+  Q CDC I  GN+ FK+H+ +L   S+ F  L  + A+ +Q+ N+ I++DS V  +E F + +  +YT  + +   N+ DVL  A    ++ VVK C
Sbjct:    6 HFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALF-SVAEGDQTMNM-IQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNSVVKAC 115          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5U575|KLH21_XENLA (Kelch-like protein 21 OS=Xenopus laevis OX=8355 GN=klhl21 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.426e-10
Identity = 50/200 (25.00%), Postives = 95/200 (47.50%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFE-----KLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNF--LQRISHEDLMILLNDDRLVLRNGEMNYFFVGLNYI 638
            H   +L  +NE R + +  D T+  G Q F  H+ +L  +S+ F      +L E+ AD  +  +++  I SL+         L + YTG++ +T +N+  +LQ AD F+   V + CC  + + L + N   I   A+      L E    +       L     ++R++ + ++  ++DDRL + + E + F + L ++
Sbjct:   28 HALHLLRGINELRSEQKFFDMTVSAGGQDFPCHRTVLAAASNYFRAMFAGRLRESHADRVELHDVSGPILSLL---------LDFCYTGRVTVTLENVEPLLQAADLFQFPSVKQACCAYLEQQLDVSNCLEIQDFAEAYACQGLAESTKRFILGHIAQLAQAHEVERLTFKRMLEYISDDRLCV-DKEESAFQIALQWV 217          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A0R3T8N5 (BTB domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS3422 PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.191e-23
Identity = 101/400 (25.25%), Postives = 172/400 (43.00%), Query Frame = 3
Query:   66 NFVLEKLN---EKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFS-EHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHEDLMILLNDDRLVLRNGEMNYFFVGLNYIAELCRIIEKLVAINSNFRQNFDENSFHKILERIQNSLGNSEIKSNRFISSKCFSVPHINTCPID---RYFPFGMHPLQFKNLPYRTSLCSQTVFNTIQDCNPNEWKIQIITFYIIPKWNNICQVIAGIDVTYQKIWDNNERKKIKCHISQ--PDKYKKKQMKLKPSENXXXXXXHHSWTVNSLSFETDQGNIFGPFGDPNPPQCS 1238
             F+ EK N   + + + Q C+CTI  G +LFK H  IL  SS  F+ +I   +D E       ++ SL   + E F S L+YLYTG ++I + NI D+   AD   ++ V+  C D   +              KD++  + +   Y          D  + R   E    +   D+  LR    +YFF  L +I     I + ++ + S + Q   ++ F  I       +   + +SN            +  CP D     F  G   +   ++ +      +T ++  ++  P+ W I  + FYI+P W +   +I G+DV Y+ IW  +ER+      +   P  Y +K ++L+  E +    ++  W V+ ++F T  G   GPFG      C+
Sbjct:   25 TFMKEKANYFQQLQRQGQFCNCTISVGGELFKVHLEILCASSEYFDSIIRRDSDFE-------DVVSLHNMTPETFQSMLNYLYTGSVEINSSNIVDIYIAADFLILNAVLDRCRDFFRD-----------NKDKDIEAGATLVSLYD---------DEIIFRHIIEKRNFIKKKDQ--LRQLGPSYFFKMLRHITRPLFIDKGIMYMGSYYIQRL-QDLFSDIFPEETRKITKEDCESN------------LTACPRDIAMTRFLAGCMYIHDSSVDF----VDETEYSPWENFPPDTWTISKMVFYILPNWGDTVGLIGGVDVEYRNIW-TSERRMASSPFTDLIPSDYDRKILELEVGETVNGFTVNSGWLVDKMTFTTSYGRKLGPFGRSGGGNCA 377          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A564YN51 (BTB domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS7886 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 3.326e-20
Identity = 105/417 (25.18%), Postives = 172/417 (41.25%), Query Frame = 3
Query:   84 LNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHEDLMILLNDDRLVLRNGEMNYFFVGLNYIAELCRIIEKLVAINSNFRQNFDENSFHKILERIQNSLGNSEIKSNRFISSKCFSVPHINTCPIDRYFPFGMHPLQFKNLPYRTSLCSQTVFNTIQDCNPNEWKIQIITFYIIPKWNNICQVIAGIDVTYQKIWDNNERKKIKCHISQ--PDKYKKKQMKLKPSENXXXXXXHHSWTVNSLSFETDQGNIFGPFG-DPNPPQCSVQTTR-IDIRTHKSGM-----LYLHGFYY 1307
            L + + K   C+ TI  G +LF  H  +L  SS  F+++I + +D E      + + ++    E F   L YLYTG +++ + NI D+   AD   +  ++  C      +   D   G+  ++  L  + +I          F NL      I   +L       R +LR    +YFF  L Y   +  + E ++ +  N+ Q   +N F  +       +   + +S+ F   +      +    I  ++    H                T ++  +D  P+ W I  I FYIIP W +   +I G +V Y+ IW   ERK          P  Y K+ +KL+  E I    I+  W V+ ++F T +G   GPFG      + SVQ  R      H++G      L LHGF +
Sbjct:   29 LKQLQSKGLFCNNTIDVGGELFNVHLEVLCASSQYFDRIIRHDSDFED----VVTLHNMT--PETFRIILDYLYTGCVELNSSNIVDIYIAADFLILSLLLDRCRAFFRNINDEDLEAGVTIVS--LYDDEII----------FRNL------IEKHNLF----KKRDLLRQLGSSYFFKILQYKRYVLFVDEGIIHMGLNYVQRL-QNIFSDVFPEETRKVTREDCESSLFFVPRDTVTSSLLVAKIPSFYASVEH-------------VDNTWYSPWEDLPPDTWTISKIIFYIIPTWGDTKGLIGGAEVEYRNIW-TGERKMDSSPFKDFLPSDYTKEILKLEEGETINGFTINSGWLVDQMTFTTSKGRRLGPFGHSGGGDRVSVQIPRERKFEPHENGAEDFKCLALHGFSF 402          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A158QVC2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7637 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 4.589e-18
Identity = 55/146 (37.67%), Postives = 78/146 (53.42%), Query Frame = 3
Query:  912 NTIQDCNPNEWKIQIITFYIIPKWNNICQVIAGIDVTYQKIWDNNERKKIKCHIS--QPDKYKKKQMKLKPSENXXXXXXHHSWTVNSLSFETDQGNIFGPFG-DPNPPQCSVQTTRIDIRTHKSGM----LYLHGFYYIDIMSCG 1328
             T +D  P EW I  ITFY+IP W     +I G+DV Y+ IW + ER+K  C ++   P  Y+ + +KL+ SE I  +E+H  W V+S+ F T QG + GPFG      +  +   R+   THK       L LHGF Y  + + G
Sbjct:  194 TTCEDFPPGEWTISEITFYLIPSWGGTPGLIGGVDVEYRNIW-SEERRKFLCDLASRHPAPYEVQSLKLEDSETIRSVEMHSGWLVDSMKFMTSQGRVLGPFGRSKGGGKREIDPGRMKRFTHKFDTDITPLALHGFSYCLVRTLG 338          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A068Y9Z8 (BTB:POZ domain containing protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000765900 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.065e-17
Identity = 104/434 (23.96%), Postives = 180/434 (41.47%), Query Frame = 3
Query:  114 CDCTIKYGNQLFKSHKIILQISSSVFEKLIENSA---DVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHEDLMILLNDDRLVLRNGEMNYFFVGLNYIAELCRIIEKLVAINSNFRQNFDENSFHKILERIQNSLGNSEIKSNRFISS-KCFSVPHIN-TCPIDRYFPFGMHPLQFKNLPYRTSLCSQTVFNTIQDCNPNEWKIQIITFYIIPKWNNICQVIAGIDVTYQKIWDNNERKKIKCHIS-QPDKYKKKQMKLKPSENXXXXXXHHSWTVNSLSFETDQGNIFGPFGDPNPPQCSVQTTRIDIRTHK----SGMLY----LHGFYYIDIMSCGFQLCNQISFECAAFD 1373
            C+C I     LF  H  +L  SS  F+ +I   +   DV    N+T         S  F + L+YLYTG +++   N  D+   AD   ++  + +C   + E          + +A D+  +    I +  F             ++H +L    +    +L+   +NYFF  L+Y   +  +  + V +   F            +E++Q  L     +  R I+   C  +  ++ T  I   +     P+  +++ +         + T ++  P +W I  I FYIIP W +   ++ G DV Y+ IW    +      I   P  YK ++++L+  E +  I++H  W V+ L+F T  G   GPFG  N     V+   ++ + H     SG++Y    LHGF Y  I + G      + F  AA +
Sbjct:   18 CNCIISVDGTLFNVHLEVLCASSEYFDNIIRRDSVIDDVVTLHNIT---------SSTFSTLLNYLYTGHMELNMSNFLDIYVAADFLILNSALDYCRKMLCENFQGKMSSEAFDVALDILGHYDDGIIFEGF-------------VAHRNLFKRAD----ILQRLGVNYFFKYLHYKKRISLVDGRTVLMGRYF------------IEKLQKILVEIFPEERRLITKVDCEDLIFLHPTAAIQSNYAIATMPIYDRSVEH----VGVATYVTCENYPPTDWTICKIKFYIIPMWGDTPGLVGGADVEYRNIWTGERQMAPSPLIDWMPSSYKVEELELEEGETLSSIKVHSGWLVDKLAFVTSTGRHVGPFGHSN--GGGVRNFVVN-KNHSPRSDSGLIYSCLALHGFSYSLIRTLGCPSWFNVHFLYAAVE 406          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A5K3EZE3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.194e-17
Identity = 47/122 (38.52%), Postives = 67/122 (54.92%), Query Frame = 3
Query:  912 NTIQDCNPNEWKIQIITFYIIPKWNNICQVIAGIDVTYQKIWDNNERKKIKCHIS--QPDKYKKKQMKLKPSENXXXXXXHHSWTVNSLSFETDQGNIFGPFG----------DPNPPQCSV 1241
             T +D  P EW I  ITFY+IP W     +I G+DV Y+ IW + ER+K  C ++   P  Y+ + +KL+ SE I  +E+H  W V+S+ F T QG + GPFG          DP    C++
Sbjct:  207 TTCEDFPPGEWTISEITFYLIPSWGGTPGLIGGVDVEYRNIW-SEERRKFLCDLASRHPAPYEVQSLKLEDSETIRSVEMHSGWLVDSMKFMTSQGRVLGPFGRSKGGGKREIDPATASCAL 327          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: IPP (intracisternal A particle-promoted polypeptide [Source:NCBI gene;Acc:103038808])

HSP 1 Score: 82.8037 bits (203), Expect = 2.574e-16
Identity = 50/196 (25.51%), Postives = 91/196 (46.43%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIE-IDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYN--LDNFLQRISHEDLMILLNDDRLVLRNGEMNYFFVGLNYI 638
            H   +L  +N  R+++  CD  +  G Q+F+ H+++L  S   F  L        + E + I  +D+     E F   L ++YTG ID+T +N+ +++  AD  ++  VV  C D +   +   N  GIYQ  + +    L+E   +Y    F    +      +S + L+ LL  + L + + E   F   +N++
Sbjct:   38 HARLLLSHMNRLRLRSDFCDVRLLVGGQVFQVHRLVLAASGPYFSALFSGGMSEAREEEVQITGVDA-----EVFQVLLEFIYTGSIDVTVENVQELMVAADMLQLSEVVAICGDFLRSHMEASNCVGIYQFLEQIGCLDLLEFTENYIHVHFLEVCVSEEFSSLSKDQLVRLLRSEELRIED-EYQVFTAAMNWL 227          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: ZBTB5 (zinc finger and BTB domain containing 5 [Source:NCBI gene;Acc:103027366])

HSP 1 Score: 66.6254 bits (161), Expect = 4.304e-11
Identity = 37/112 (33.04%), Postives = 62/112 (55.36%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFC 395
            H   + ++LN +R+  Q CDC I  GN+ FK+H+ +L   S+ F  L    A+ + S ++ I++DS V  +E F + +  +YT  + +   N+ DVL  A    ++ VVK C
Sbjct:    6 HFEQIFQQLNYQRVHGQLCDCVIVVGNRHFKAHRAVLAACSTHFRALF-TVAEGDASMSM-IQLDSEVVTAEAFAALVDMMYTSTLMLGESNVMDVLLAASHLHLNTVVKAC 115          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: keap1b (kelch like ECH associated protein 1 [Source:NCBI gene;Acc:103045265])

HSP 1 Score: 65.0846 bits (157), Expect = 1.158e-10
Identity = 59/195 (30.26%), Postives = 85/195 (43.59%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCT--IKYGNQL----FKSHKIILQISSSVFEKLIENSADVEQSENLTIE-IDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEIC--YSYFGF-------EFYNLDNFLQRISHEDLMILLNDDRLVLR 596
            H       +NE R++ Q CD T  +KY N L    F +HK++L  SS VF  +  N       E + IE I   V         + + YT  I +    +  V+  A  ++ID VVK CCD + + L   N  GI   A+ +    L +    Y Y  F       EF+NL       SH  L+ L++ D L +R
Sbjct:   32 HTGAAFAIMNELRLERQLCDVTLRVKY-NDLEAVDFVAHKVVLASSSPVFRAMFTNGLKECGMEVVPIEGIHPRV-----MGRLIEFAYTASISVGEKCVIHVMNGAVMYQIDSVVKACCDFLVQQLDPSNAIGIANFAEQIGCTELHQKAREYIYMNFSQVATQEEFFNL-------SHCQLVTLISRDELNVR 213          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: keap1b (kelch like ECH associated protein 1 [Source:NCBI gene;Acc:103045265])

HSP 1 Score: 64.6994 bits (156), Expect = 1.320e-10
Identity = 59/195 (30.26%), Postives = 85/195 (43.59%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCT--IKYGNQL----FKSHKIILQISSSVFEKLIENSADVEQSENLTIE-IDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEIC--YSYFGF-------EFYNLDNFLQRISHEDLMILLNDDRLVLR 596
            H       +NE R++ Q CD T  +KY N L    F +HK++L  SS VF  +  N       E + IE I   V         + + YT  I +    +  V+  A  ++ID VVK CCD + + L   N  GI   A+ +    L +    Y Y  F       EF+NL       SH  L+ L++ D L +R
Sbjct:   32 HTGAAFAIMNELRLERQLCDVTLRVKY-NDLEAVDFVAHKVVLASSSPVFRAMFTNGLKECGMEVVPIEGIHPRV-----MGRLIEFAYTASISVGEKCVIHVMNGAVMYQIDSVVKACCDFLVQQLDPSNAIGIANFAEQIGCTELHQKAREYIYMNFSQVATQEEFFNL-------SHCQLVTLISRDELNVR 213          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: klhl24b (kelch-like protein 24 [Source:NCBI gene;Acc:103026629])

HSP 1 Score: 62.3882 bits (150), Expect = 6.731e-10
Identity = 47/174 (27.01%), Postives = 75/174 (43.10%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHEDLMILLNDD 581
            H   VL+  +E R      D  I    + F  H+ +L   SS F  +  N  D  +S  + +EI+ +   SE   +FL Y+YTG+  IT DN+  + + +  F+I  +   C   + + L   N  GI + A       L   C +      Y L +F     HE+ + L  D+
Sbjct:   48 HSESVLQMFDEFRNGRLFTDVVISVEGREFPCHRAVLSACSSYFRAMFCN--DHRESREMLVEINGIR--SEAMDTFLQYVYTGRARITTDNVQFLFETSSLFQIGALRDACAKFLEDQLDPCNCLGIQRFADAHSLKQLASRCRA------YALQSFADVAQHEEFLDLQRDE 211          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: IPP (intracisternal A particle-promoted polypeptide [Source:HGNC Symbol;Acc:HGNC:6108])

HSP 1 Score: 69.707 bits (169), Expect = 6.817e-13
Identity = 39/136 (28.68%), Postives = 66/136 (48.53%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQ 467
            H   +L  LN  R     CD  +  G   F +H  +L  +S  F+ +   ++ V +SE L ++I  +   +E F   L+Y+YTG + ++  N+ DV   AD   +  VV+ C D + E +S +N  G+   A  + 
Sbjct:   20 HAVRLLRSLNALRKDATLCDARLSVGGAQFCAHSAVLAAASPYFQAMFAGASKVVESEPL-VQIGGI--DAETFEILLNYVYTGSLKLSESNVQDVAIAADMLSLAGVVRICSDFLREHISAENCLGVMMFATAIS 152          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: zbtb49 (zinc finger and BTB domain containing 49 [Source:ZFIN;Acc:ZDB-GENE-070209-170])

HSP 1 Score: 61.2326 bits (147), Expect = 2.261e-10
Identity = 33/113 (29.20%), Postives = 65/113 (57.52%), Query Frame = 3
Query:   57 EHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFC 395
            EH +++L++L+++RI+   CDCT+      FK+HK +L   S  F  L +NS+  ++ +   I+IDS+    +     L ++YT  ++++ +N   +L+LA   ++  +V  C
Sbjct:    6 EHGSYLLQQLHDQRIQGLLCDCTLMVRGVCFKAHKNVLAAFSGHFRNLFQNSSS-QRRDVFHIQIDSVGGIGQ----ILDFMYTSHLELSQENAHTMLELATNLQVQNIVNVC 113          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007946.1 (pep scaffold:Pmarinus_7.0:GL477137:5731:11302:-1 gene:ENSPMAG00000007181.1 transcript:ENSPMAT00000007946.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 8.199e-10
Identity = 47/188 (25.00%), Postives = 78/188 (41.49%), Query Frame = 3
Query:   84 LNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAK-----DLQQNSLIEICYSYFGFEFYNLDNFLQ------RISHEDLMILLNDDRLVLRNGEMNY 614
             NE R++ + CD  I+  ++ F +HK IL   S  F  L   S         TI         E     + Y Y   + +T  N+  +L  AD F +  +V+ CC  + E +S D+   +Y+ +      DLQQ        S F F   N +           ++ ++L ++L+ D L +R+    Y
Sbjct:   13 FNELRLEGKLCDAVIRVKDREFNAHKNILCSCSPYFRALFTGSWSDAGRRKFTIPGVE----PEAMELIIEYAYMRTLPVTCANVERLLVAADQFNVMGIVRLCCAFLREHISFDSCVEVYRFSGFYALHDLQQ--------SAFAFMLQNFEALAGSREQFCELTADELELMLSQDELTVRSEHTAY 188          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007942.1 (pep scaffold:Pmarinus_7.0:GL477137:5731:11302:-1 gene:ENSPMAG00000007181.1 transcript:ENSPMAT00000007942.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 8.778e-10
Identity = 47/188 (25.00%), Postives = 78/188 (41.49%), Query Frame = 3
Query:   84 LNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAK-----DLQQNSLIEICYSYFGFEFYNLDNFLQ------RISHEDLMILLNDDRLVLRNGEMNY 614
             NE R++ + CD  I+  ++ F +HK IL   S  F  L   S         TI         E     + Y Y   + +T  N+  +L  AD F +  +V+ CC  + E +S D+   +Y+ +      DLQQ        S F F   N +           ++ ++L ++L+ D L +R+    Y
Sbjct:   13 FNELRLEGKLCDAVIRVKDREFNAHKNILCSCSPYFRALFTGSWSDAGRRKFTIPGVE----PEAMELIIEYAYMRTLPVTCANVERLLVAADQFNVMGIVRLCCAFLREHISFDSCVEVYRFSGFYALHDLQQ--------SAFAFMLQNFEALAGSREQFCELTADELELMLSQDELTVRSEHTAY 188          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: klhl22 (kelch-like family member 22 [Source:ZFIN;Acc:ZDB-GENE-081104-154])

HSP 1 Score: 55.0694 bits (131), Expect = 3.447e-8
Identity = 33/150 (22.00%), Postives = 66/150 (44.00%), Query Frame = 3
Query:   57 EHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCD---------TITELLSLDNIFGIYQIAKDLQQNSL 479
            +H   +L  L+E R  N   D T++   +   +H+++L  S   F  +        Q + + I   + V         ++Y+YT +++++ DN+ D+L  A   ++   +  CCD         ++ EL  L   +G+  +A  L  + L
Sbjct:   26 DHSKLLLVGLSELRRNNSLYDITLRAEGRKICAHRVVLAASCDYFRGMFARGLREAQQDEVEIHGVTYVALER----LVAYIYTAELEVSQDNVQDILSAAVLLQMSAAIDCCCDFLVSRVEAESVPELYMLAEAYGLTDLADKLDAHLL 171          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO34872 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN17])

HSP 1 Score: 80.1073 bits (196), Expect = 7.052e-16
Identity = 81/280 (28.93%), Postives = 123/280 (43.93%), Query Frame = 3
Query:   57 EHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIE-IDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAK-----DLQQNSL-------IEICYSYFGFEFYNLDNF--LQRISHEDLMILLNDDRLVLRNGEMNYFFVGLNYIAE-LCRIIE--KLVAINSNFRQNF----DENSFHKILE------RIQNSLGNSEIKS---NRFISSKCFSV 803
            EH   +L +L   R  N  CD  +K   + F  HKI++  SS  FE L          + +TI+ IDS     E F + L ++YTG I++  +N+  +L  A   ++D V K CCD +   L   N  GIY  A+     DL  N+L       + +C S    E+  LD +  LQ +  EDL I   +    +    M +    +    E L +I+E  +L  I+  + + F       S H++L       R   SL +S +K     R  S KCF +
Sbjct:   15 EHAIGILNRLQHLRRLNTMCDAVLKVEEKQFPIHKIVVSASSPYFEVLFSGGLRESYLDTVTIQGIDS-----ETFSALLDFIYTGVINVNEENVQQLLPAAKMLQLDAVEKCCCDFLMRQLEHANCLGIYLFAEAHSCADLSTNALEFIHRNFVLVCESE---EYLELDRWHLLQLLDSEDLKI---ESECQVFEAAMRWVMFDMRSRREALGKILERIRLPLISPKYFEKFLSECQNESLHRMLGNILEGYRSYQSLAHSAVKGIVQPRRASRKCFYI 283          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO44601 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV90])

HSP 1 Score: 58.5362 bits (140), Expect = 3.986e-10
Identity = 41/139 (29.50%), Postives = 68/139 (48.92%), Query Frame = 3
Query:   36 SIGDTRIEHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQI 452
            S+ +  + H    L+ L++ R+  + CD T+K  NQ F  HK++L  +S+ F  +      VE S+N  +  D   K      + +SY Y  KI+I  DN   V  +A+ + +  V+  C + +   LS  N  G +QI
Sbjct:    7 SVAEENVLHPLEFLQTLDKMRVSGEGCDVTLKVTNQSFPGHKLVLAANSTYFRAMF-GEGFVESSKNDVVLHDLDPK---GVNAVISYFYNSKIEINADNFGAVFAVANMWDVKFVLTACENYLRVHLSASNCLG-FQI 140          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO31299 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYB7])

HSP 1 Score: 61.2326 bits (147), Expect = 6.792e-10
Identity = 44/186 (23.66%), Postives = 84/186 (45.16%), Query Frame = 3
Query:   48 TRIEHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTI-EIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYN-------LDNFLQRISHEDLMILLNDD 581
            T + H + +L  LN  R +   CD  +  G     +HK++L   S  F  +        + + +T+ E+D      +   + + + Y+GKI+I+  N+ +VL +A   ++  V + CC+ +   LS +N  GI   A       L++   ++    F +       +D  L+++S     IL+ DD
Sbjct:   35 TDVAHSSNILCSLNSLRQQEDLCDMVLVVGGSTISAHKVVLASGSPYFRAMFTGGMSESRQDTVTLQELDE-----KAMQNMIDFFYSGKIEISELNVQEVLPIACLLQVQSVQEACCEFLKRQLSPENCLGICAFADSHSCTELVKFSDAFARLHFVDVVQSEEFMDVPLKQLSR----ILVEDD 211          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO36180 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJH4])

HSP 1 Score: 59.3066 bits (142), Expect = 7.481e-10
Identity = 44/186 (23.66%), Postives = 84/186 (45.16%), Query Frame = 3
Query:   48 TRIEHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTI-EIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYN-------LDNFLQRISHEDLMILLNDD 581
            T + H + +L  LN  R +   CD  +  G     +HK++L   S  F  +        + + +T+ E+D      +   + + + Y+GKI+I+  N+ +VL +A   ++  V + CC+ +   LS +N  GI   A       L++   ++    F +       +D  L+++S     IL+ DD
Sbjct:   14 TDVAHSSNILCSLNSLRQQEDLCDMVLVVGGSTISAHKVVLASGSPYFRAMFTGGMSESRQDTVTLQELDE-----KAMQNMIDFFYSGKIEISELNVQEVLPIACLLQVQSVQEACCEFLKRQLSPENCLGICAFADSHSCTELVKFSDAFARLHFVDVVQSEEFMDVPLKQLSR----ILVEDD 190          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO33787 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR72])

HSP 1 Score: 60.8474 bits (146), Expect = 8.852e-10
Identity = 46/176 (26.14%), Postives = 77/176 (43.75%), Query Frame = 3
Query:   84 LNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIE-IDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNL---DNFLQRISHEDLMILLNDDRLVLRN 599
            +NE R K + CD  +  G + F+ H+I+L  +SS    +  N        ++ ++ ID  V         L ++YTG +DI+ +N+  +L  A    +  + + CC  +   L   N  GI   A       L    + Y    F ++   D FLQ + + DL  LL  D + +R 
Sbjct:    2 MNELRKKRELCDVLLHVGGREFRGHRIVLAGASSYLRAMFTNGMLESGMRDIKLQGIDPAV-----MEILLDFVYTGIVDISVENVQALLSGATLLNLQTLSQACCSFLQTHLDASNCLGIRAFADLYSCTELENAAFKYICQHFLDVIKCDEFLQ-LPYRDLKSLLESDLIQVRT 171          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: IPP (intracisternal A particle-promoted polypeptide [Source:NCBI gene;Acc:101156438])

HSP 1 Score: 81.6481 bits (200), Expect = 6.039e-16
Identity = 49/197 (24.87%), Postives = 99/197 (50.25%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSA-DVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNL---DNFLQRISHEDLMILLNDDRLVLRNGEMNYFFVGLNYI 638
            H   +L ++N+ R++   CD  +  G ++F+ H+++L  SS  F  L      + ++ E   I +D +V     F S L ++YTG I++T DN+ +++  AD   ++ VV  C + +   +   N  GI+Q ++ +    ++E   +Y    F  +   D F + +S + L+ LL  + L + + E   F   ++++
Sbjct:   32 HARLMLAQMNKLRLRTDFCDVGLNVGGRVFRVHRLVLAASSPYFSALFSGGMKEADKEEVHIIGVDPVV-----FESLLEFVYTGAINVTVDNVQELMVAADMLHLNEVVSVCGEFLKSHMDSSNCVGIFQFSEQIGCLEMLEFTENYIYVHFLEVCVTDEF-RSLSKDQLVRLLRSEELRIED-EYQVFTAAMDWV 221          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: IPP (intracisternal A particle-promoted polypeptide [Source:NCBI gene;Acc:101156438])

HSP 1 Score: 81.6481 bits (200), Expect = 6.039e-16
Identity = 49/197 (24.87%), Postives = 99/197 (50.25%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSA-DVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNL---DNFLQRISHEDLMILLNDDRLVLRNGEMNYFFVGLNYI 638
            H   +L ++N+ R++   CD  +  G ++F+ H+++L  SS  F  L      + ++ E   I +D +V     F S L ++YTG I++T DN+ +++  AD   ++ VV  C + +   +   N  GI+Q ++ +    ++E   +Y    F  +   D F + +S + L+ LL  + L + + E   F   ++++
Sbjct:   32 HARLMLAQMNKLRLRTDFCDVGLNVGGRVFRVHRLVLAASSPYFSALFSGGMKEADKEEVHIIGVDPVV-----FESLLEFVYTGAINVTVDNVQELMVAADMLHLNEVVSVCGEFLKSHMDSSNCVGIFQFSEQIGCLEMLEFTENYIYVHFLEVCVTDEF-RSLSKDQLVRLLRSEELRIED-EYQVFTAAMDWV 221          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000004416.2 (kelch-like protein 41b [Source:NCBI gene;Acc:111949086])

HSP 1 Score: 73.559 bits (179), Expect = 2.698e-13
Identity = 54/197 (27.41%), Postives = 100/197 (50.76%), Query Frame = 3
Query:   45 DTRIEHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKL--IENSADVEQSENLTIEIDSLVKFSEHFPSFL----SYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFG--FEF-YNLDNFLQRISHEDLMILLNDDRLVLRNGEM 608
            + R+     + + L E   +N+  DCT+K G++ F  H++I+   S  F ++   E+  +VE ++ + +E        +  PS L     YLY+ +ID+T+DN+ D++ +A+ F+I  V   C + + + LSL N   I+++   L    L     +Y    FEF +  + FL+  +HE +  ++  D L +   EM
Sbjct:   51 ELRLFQSTLLQDGLKELLNENKFVDCTLKVGDRSFPCHRLIIAACSPYFREIFFTEDGKEVEDTKEVILE--------DVNPSILDMIIQYLYSAEIDLTDDNVQDIIAVANRFQIPSVFTVCVNYLQKKLSLSNCMAIFRMGLVLGCPRLAVSARNYIADRFEFLHKEEEFLKLAAHE-MFAIVGGDSLNVEKEEM 238          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: klhl7 (kelch like family member 7 [Source:NCBI gene;Acc:101172001])

HSP 1 Score: 64.3142 bits (155), Expect = 1.524e-10
Identity = 43/184 (23.37%), Postives = 85/184 (46.20%), Query Frame = 3
Query:   57 EHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEF---YNLDNFLQRISHEDLMILLNDDRLVLRN 599
              ++ ++  +N  R +   CD T+    + F +H+++L  +S VF  +          E+++ E++      E     + ++YT +I + + N+  +L  A+ ++I+ V K C + +   +   N  GI  +A  +    L      +F   F   Y LD FLQ +    L  LL+ D+L +R+
Sbjct:   25 RQLSSIMGVMNNLRKQGTLCDVTLVVQGKHFPAHRVVLAAASHVFSLMFTT----RMMESMSHEVELRSAEPEIIELLIDFIYTARISVNSSNVQSLLDAANQYQIEPVKKMCVEFLKGQIDPTNCLGISALADCMDCPELKSAAEDFFQLHFTEVYKLDEFLQ-LDVSQLTHLLHQDKLTVRS 203          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: klhl24b (kelch like family member 24 [Source:NCBI gene;Acc:101156920])

HSP 1 Score: 64.3142 bits (155), Expect = 1.881e-10
Identity = 51/191 (26.70%), Postives = 83/191 (43.46%), Query Frame = 3
Query:   60 HINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHEDLMIL--------LNDDRLVLRNGEM 608
            H   +L+  NE R      D  I    + F  H+ +L  SSS F  +  N  D  +S  + +EI+ ++  +E   SFL+Y+YTG+  IT +N+  + + +  F+I  +   C   + + L   N  GI + A       L   C +      Y L NF +   H + + L        +N D L +   EM
Sbjct:   48 HSEGILQVFNEFRDSRLFTDVVISVQGREFPCHRAVLSASSSYFRAMFCN--DHRESREMLVEINGIL--AEAMDSFLTYVYTGRAKITTENVQFLFETSSLFQISTLRDACAKFLEDQLDPCNCLGIQRFADAHSLKQLASRCRT------YALANFSEVAQHAEFLDLRKEELEEYINSDDLSVSKEEM 228          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000068855.1 (SMESG000068855.1)

HSP 1 Score: 1014.6 bits (2622), Expect = 0.000e+0
Identity = 502/502 (100.00%), Postives = 502/502 (100.00%), Query Frame = 3
Query:   33 MSIGDTRIEHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHEDLMILLNDDRLVLRNGEMNYFFVGLNYIAELCRIIEKLVAINSNFRQNFDENSFHKILERIQNSLGNSEIKSNRFISSKCFSVPHINTCPIDRYFPFGMHPLQFKNLPYRTSLCSQTVFNTIQDCNPNEWKIQIITFYIIPKWNNICQVIAGIDVTYQKIWDNNERKKIKCHISQPDKYKKKQMKLKPSENXXXXXXHHSWTVNSLSFETDQGNIFGPFGDPNPPQCSVQTTRIDIRTHKSGMLYLHGFYYIDIMSCGFQLCNQISFECAAFDIDKLESQYKNISYLIDMKLESNISKDFSENERHHSNVNILNMRPLGFPNVKREIL 1538
            MSIGDTRIEHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHEDLMILLNDDRLVLRNGEMNYFFVGLNYIAELCRIIEKLVAINSNFRQNFDENSFHKILERIQNSLGNSEIKSNRFISSKCFSVPHINTCPIDRYFPFGMHPLQFKNLPYRTSLCSQTVFNTIQDCNPNEWKIQIITFYIIPKWNNICQVIAGIDVTYQKIWDNNERKKIKCHISQPDKYKKKQMKLKPSENIIIIEIHHSWTVNSLSFETDQGNIFGPFGDPNPPQCSVQTTRIDIRTHKSGMLYLHGFYYIDIMSCGFQLCNQISFECAAFDIDKLESQYKNISYLIDMKLESNISKDFSENERHHSNVNILNMRPLGFPNVKREIL
Sbjct:    1 MSIGDTRIEHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHEDLMILLNDDRLVLRNGEMNYFFVGLNYIAELCRIIEKLVAINSNFRQNFDENSFHKILERIQNSLGNSEIKSNRFISSKCFSVPHINTCPIDRYFPFGMHPLQFKNLPYRTSLCSQTVFNTIQDCNPNEWKIQIITFYIIPKWNNICQVIAGIDVTYQKIWDNNERKKIKCHISQPDKYKKKQMKLKPSENIIIIEIHHSWTVNSLSFETDQGNIFGPFGDPNPPQCSVQTTRIDIRTHKSGMLYLHGFYYIDIMSCGFQLCNQISFECAAFDIDKLESQYKNISYLIDMKLESNISKDFSENERHHSNVNILNMRPLGFPNVKREIL 502          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000078467.1 (SMESG000078467.1)

HSP 1 Score: 65.0846 bits (157), Expect = 9.840e-11
Identity = 48/179 (26.82%), Postives = 96/179 (53.63%), Query Frame = 3
Query:   81 KLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHEDLMILLNDDRLVLRNGEMNYF 617
            K+NE R++N+ CD  +K  ++ F +HKI+L  +S  F  +   S  + +SE   IE+ S+     +    L Y+YTG I +TN+N+ ++L  A+  ++  + + CC  +   +   N+ GI + A ++    L+E     F    +N++  LQ+ S E + +  ++ R +++  ++N +
Sbjct:   30 KINEFRLQNRLCDVVLKVQDKEFPAHKIVLAAASDFFSAMF--SCGMAESEQSVIELKSISIDIIN--DILEYVYTGNIVVTNENVQELLPAANLTQLIGLKQACCIYLMRQIDPSNVLGIRRFA-EIHDCHLLEKFARKFA--AHNMEAVLQQ-SEEFVQLSRSELRQLIKMTDLNIY 200          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000045114.1 (SMESG000045114.1)

HSP 1 Score: 63.929 bits (154), Expect = 2.077e-10
Identity = 51/177 (28.81%), Postives = 84/177 (47.46%), Query Frame = 3
Query:   33 MSIGDTRIEHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISSSVF-EKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHEDL 560
            +S+ D R  H + +L +LN+ RI    CD T+   N+ F +HK+IL  SS  F  K  E+      S N+  +I         F   L Y YT  + ++ + +  +   A   K+ RVVK C   +T++LSLDNI  + +    +  N   ++C +   F   N+D  +  +  + L
Sbjct:    9 LSLIDDRSRH-SELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSINMNKDI---------FNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRE---SVALNDSEDLCQAANAFIKENMDKIISNVKIQKL 172          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000008374.1 (SMESG000008374.1)

HSP 1 Score: 60.077 bits (144), Expect = 3.228e-9
Identity = 41/164 (25.00%), Postives = 76/164 (46.34%), Query Frame = 3
Query:  117 DCTIKYGNQLFKSHKIILQISSSVFEKLIENSA-DVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEICYSYFGFEFYNLDNFLQRISHE--DLMILLNDDRLVLRN 599
            D T+K G +LF  HK++L  +S+ F  +  +   +V   E     I  +V         + ++YTG+I I   N+C++L  A   ++  VV+ CC+ + +     N+ GI++ A       L E    +    F  +  + + +S +   LM  +  D L +R+
Sbjct:   78 DITLKVGTELFPCHKVVLAGASAYFRAMFTSGMREVNMHEIPIHGISPMV-----INRLIHFIYTGEILIGESNVCELLAAATMLQMHHVVEACCEFLEKQFHPSNVIGIFEFASSNGCKKLAEKAQRFIDKNFNEIGRYDEFLSLKPCQLMEFIKRDELNVRS 236          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000077860.1 (SMESG000077860.1)

HSP 1 Score: 53.5286 bits (127), Expect = 3.309e-7
Identity = 47/170 (27.65%), Postives = 80/170 (47.06%), Query Frame = 3
Query:   93 KRIKNQN--CDCTIKYGNQLFKSHKIILQISSSVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITNDNICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLIEIC--YSYFGF-EFYNLDNFLQRISHEDLMILLNDDRL 587
            +RI+NQ   CD T+      F +HKI+L  S   F  +  N  D+ +S    I++  L   S    + +++ Y G++ IT +N+  +   A+  +I  V   CC+ +   +S   +  +   AK L  + L+     Y Y  F    NL+ F   +S EDL+ ++  D L
Sbjct:   51 ERIRNQGKFCDVTLIVDGHQFSAHKIVLAASIPYFNGMFMN--DMVESSEKNIKLHGLDPNS--LEALINFAYRGEVYITPNNVQSIFMGANFLQISSVRVACCEFMKNRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFD-LSFEDLLEIICKDEL 215          
The following BLAST results are available for this feature:
BLAST of BTB domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IPP1.868e-1224.73intracisternal A particle-promoted polypeptide [So... [more]
IPP2.271e-1224.73intracisternal A particle-promoted polypeptide [So... [more]
ZBTB51.741e-1133.93zinc finger and BTB domain containing 5 [Source:HG... [more]
ZBTB403.201e-1131.62zinc finger and BTB domain containing 40 [Source:H... [more]
ZBTB403.201e-1131.62zinc finger and BTB domain containing 40 [Source:H... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kel-39.825e-926.82KELch-repeat containing protein [Source:UniProtKB... [more]
kel-32.274e-826.82KELch-repeat containing protein [Source:UniProtKB... [more]
kel-32.274e-826.82KELch-repeat containing protein [Source:UniProtKB... [more]
W07A12.43.806e-826.39pep chromosome:WBcel235:II:9148356:9152311:1 gene:... [more]
W07A12.44.820e-826.39pep chromosome:WBcel235:II:9146280:9152311:1 gene:... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG94265.989e-1224.48gene:FBgn0032485 transcript:FBtr0080484[more]
kel4.943e-1024.34gene:FBgn0001301 transcript:FBtr0081043[more]
kel7.987e-924.34gene:FBgn0001301 transcript:FBtr0081042[more]
Keap11.308e-824.19gene:FBgn0038475 transcript:FBtr0083423[more]
Keap11.581e-824.19gene:FBgn0038475 transcript:FBtr0083424[more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klhl61.431e-1029.68kelch-like family member 6 [Source:ZFIN;Acc:ZDB-GE... [more]
klhl41b1.792e-1024.46kelch-like family member 41b [Source:NCBI gene;Acc... [more]
zbtb8b2.593e-1031.25zinc finger and BTB domain containing 8B [Source:Z... [more]
klhl24b1.004e-926.44kelch-like family member 24b [Source:ZFIN;Acc:ZDB-... [more]
klhl24b1.004e-926.44kelch-like family member 24b [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ipp1.294e-1630.39intracisternal A particle-promoted polypeptide [So... [more]
ipp1.304e-1630.39intracisternal A particle-promoted polypeptide [So... [more]
ipp1.458e-1630.39intracisternal A particle-promoted polypeptide [So... [more]
zbtb52.015e-1134.82zinc finger and BTB domain containing 5 [Source:NC... [more]
nphp4.24.751e-1125.00nephronophthisis 4, gene 2 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zbtb54.961e-1433.33zinc finger and BTB domain containing 5 [Source:MG... [more]
Ipp1.336e-1324.26IAP promoted placental gene [Source:MGI Symbol;Acc... [more]
Ipp1.336e-1324.26IAP promoted placental gene [Source:MGI Symbol;Acc... [more]
Zbtb51.060e-1133.93zinc finger and BTB domain containing 5 [Source:MG... [more]
Zbtb51.060e-1133.93zinc finger and BTB domain containing 5 [Source:MG... [more]
back to top
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P28575|IPP_MOUSE9.343e-1324.26Actin-binding protein IPP OS=Mus musculus OX=10090... [more]
sp|Q9Y573|IPP_HUMAN1.090e-1124.73Actin-binding protein IPP OS=Homo sapiens OX=9606 ... [more]
sp|Q7TQG0|ZBTB5_MOUSE7.417e-1133.93Zinc finger and BTB domain-containing protein 5 OS... [more]
sp|O15062|ZBTB5_HUMAN8.360e-1133.93Zinc finger and BTB domain-containing protein 5 OS... [more]
sp|Q5U575|KLH21_XENLA1.426e-1025.00Kelch-like protein 21 OS=Xenopus laevis OX=8355 GN... [more]
back to top
BLAST of BTB domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3T8N51.191e-2325.25BTB domain-containing protein OS=Rodentolepis nana... [more]
A0A564YN513.326e-2025.18BTB domain-containing protein OS=Hymenolepis dimin... [more]
A0A158QVC24.589e-1837.67Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068Y9Z82.065e-1723.96BTB:POZ domain containing protein OS=Echinococcus ... [more]
A0A5K3EZE32.194e-1738.52Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IPP2.574e-1625.51intracisternal A particle-promoted polypeptide [So... [more]
ZBTB54.304e-1133.04zinc finger and BTB domain containing 5 [Source:NC... [more]
keap1b1.158e-1030.26kelch like ECH associated protein 1 [Source:NCBI g... [more]
keap1b1.320e-1030.26kelch like ECH associated protein 1 [Source:NCBI g... [more]
klhl24b6.731e-1027.01kelch-like protein 24 [Source:NCBI gene;Acc:103026... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IPP6.817e-1328.68intracisternal A particle-promoted polypeptide [So... [more]
zbtb492.261e-1029.20zinc finger and BTB domain containing 49 [Source:Z... [more]
ENSPMAT00000007946.18.199e-1025.00pep scaffold:Pmarinus_7.0:GL477137:5731:11302:-1 g... [more]
ENSPMAT00000007942.18.778e-1025.00pep scaffold:Pmarinus_7.0:GL477137:5731:11302:-1 g... [more]
klhl223.447e-822.00kelch-like family member 22 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO348727.052e-1628.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446013.986e-1029.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312996.792e-1023.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361807.481e-1023.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337878.852e-1026.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IPP6.039e-1624.87intracisternal A particle-promoted polypeptide [So... [more]
IPP6.039e-1624.87intracisternal A particle-promoted polypeptide [So... [more]
ENSORLT00000004416.22.698e-1327.41kelch-like protein 41b [Source:NCBI gene;Acc:11194... [more]
klhl71.524e-1023.37kelch like family member 7 [Source:NCBI gene;Acc:1... [more]
klhl24b1.881e-1026.70kelch like family member 24 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of BTB domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068855.10.000e+0100.00SMESG000068855.1[more]
SMESG000078467.19.840e-1126.82SMESG000078467.1[more]
SMESG000045114.12.077e-1028.81SMESG000045114.1[more]
SMESG000008374.13.228e-925.00SMESG000008374.1[more]
SMESG000077860.13.309e-727.65SMESG000077860.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003217 ID=SMED30003217|Name=BTB domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1661bp
CTTTAACACGCCAATTTTGAAATTTCTATTGAATGTCGATAGGCGATACG
AGAATTGAACATATCAATTTCGTGCTTGAGAAATTGAACGAAAAACGAAT
AAAGAACCAGAATTGTGACTGTACGATCAAGTACGGCAATCAACTGTTTA
AAAGCCACAAAATAATTCTGCAAATCTCCAGTTCGGTTTTTGAAAAATTA
ATTGAAAACTCGGCTGACGTTGAGCAGTCTGAAAATCTGACAATAGAAAT
CGATTCTCTCGTTAAATTTTCCGAACATTTCCCATCATTTCTCAGCTATT
TATATACTGGAAAAATCGATATTACCAATGATAATATTTGCGACGTTTTG
CAATTGGCTGATGCCTTCAAAATCGATCGAGTTGTCAAATTCTGCTGCGA
TACAATCACCGAACTGTTGTCATTGGATAATATTTTTGGAATTTATCAAA
TCGCAAAAGATCTACAACAAAATTCGTTGATTGAGATTTGTTATTCATAT
TTCGGATTCGAATTTTACAATTTGGATAATTTTCTCCAAAGAATTTCCCA
CGAAGATTTGATGATTTTACTGAATGATGATCGACTGGTTTTGCGGAATG
GAGAAATGAACTATTTCTTTGTCGGATTGAATTACATTGCTGAACTGTGT
AGAATTATTGAAAAATTGGTCGCTATTAATTCAAATTTTCGACAAAATTT
TGACGAAAATTCTTTCCATAAAATACTCGAACGTATTCAAAATTCACTCG
GAAACTCCGAAATAAAATCGAACAGATTTATCTCATCAAAATGCTTTTCA
GTTCCTCACATCAATACCTGCCCGATAGACCGCTACTTCCCATTCGGAAT
GCATCCTCTTCAATTTAAAAATCTACCTTACAGAACTTCCCTGTGTTCAC
AGACGGTATTCAATACAATTCAAGACTGCAACCCGAACGAATGGAAAATA
CAGATTATCACATTTTATATCATTCCGAAATGGAACAATATATGCCAAGT
AATAGCAGGAATAGATGTAACTTATCAAAAGATCTGGGACAATAATGAAA
GAAAGAAAATCAAATGTCACATTAGTCAACCAGATAAATATAAAAAGAAA
CAGATGAAATTGAAGCCATCGGAAAATATAATCATAATAGAAATTCATCA
CTCTTGGACAGTGAATAGTTTATCATTTGAAACTGATCAAGGTAATATCT
TCGGACCATTTGGTGATCCGAATCCACCTCAGTGCTCGGTTCAAACAACG
AGAATCGACATTCGAACTCACAAATCAGGAATGCTATATTTGCACGGGTT
CTATTACATTGACATCATGAGTTGTGGGTTCCAATTATGCAATCAAATTA
GTTTCGAGTGCGCCGCCTTCGACATTGATAAGTTGGAGAGTCAATACAAG
AACATTTCATATCTCATAGACATGAAATTGGAATCGAATATATCGAAAGA
TTTCTCAGAAAATGAACGACATCATTCAAATGTTAATATTTTGAATATGA
GGCCCCTCGGATTCCCCAATGTCAAGAGAGAAATTTTATAAATAAATCAT
CGTAAACTCAAATATTTATTTCCAGTTTTTAAAATTGACGATTTTATTTT
TAATGTGTGAAATTTTGCAAATCATATGTGCAAGAATATCAAATATAACA
TTTATCTGAAA
back to top

protein sequence of SMED30003217-orf-1

>SMED30003217-orf-1 ID=SMED30003217-orf-1|Name=SMED30003217-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=503bp
MSIGDTRIEHINFVLEKLNEKRIKNQNCDCTIKYGNQLFKSHKIILQISS
SVFEKLIENSADVEQSENLTIEIDSLVKFSEHFPSFLSYLYTGKIDITND
NICDVLQLADAFKIDRVVKFCCDTITELLSLDNIFGIYQIAKDLQQNSLI
EICYSYFGFEFYNLDNFLQRISHEDLMILLNDDRLVLRNGEMNYFFVGLN
YIAELCRIIEKLVAINSNFRQNFDENSFHKILERIQNSLGNSEIKSNRFI
SSKCFSVPHINTCPIDRYFPFGMHPLQFKNLPYRTSLCSQTVFNTIQDCN
PNEWKIQIITFYIIPKWNNICQVIAGIDVTYQKIWDNNERKKIKCHISQP
DKYKKKQMKLKPSENIIIIEIHHSWTVNSLSFETDQGNIFGPFGDPNPPQ
CSVQTTRIDIRTHKSGMLYLHGFYYIDIMSCGFQLCNQISFECAAFDIDK
LESQYKNISYLIDMKLESNISKDFSENERHHSNVNILNMRPLGFPNVKRE
IL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007010cytoskeleton organization
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036404Jacalin-like_lectin_dom_sf
IPR000210BTB/POZ_dom
IPR001229Jacalin-like_lectin_dom
IPR011333SKP1/BTB/POZ_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 28..129
e-value: 1.1E-17
score: 74.7
IPR000210BTB/POZ domainPFAMPF00651BTBcoord: 18..126
e-value: 5.5E-21
score: 74.9
IPR000210BTB/POZ domainPROSITEPS50097BTBcoord: 28..99
score: 16.59
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 10..151
e-value: 6.1E-28
score: 99.6
NoneNo IPR availablePANTHERPTHR24412:SF172KELCH-LIKE PROTEIN 10coord: 14..191
NoneNo IPR availablePANTHERPTHR24412FAMILY NOT NAMEDcoord: 14..191
NoneNo IPR availableCDDcd18186BTB_POZ_ZBTB_KLHL-likecoord: 28..112
e-value: 1.66366E-18
score: 77.9793
IPR036404Jacalin-like lectin domain superfamilyGENE3DG3DSA:2.100.10.30coord: 305..435
e-value: 1.2E-8
score: 37.2
IPR036404Jacalin-like lectin domain superfamilySUPERFAMILYSSF51101Mannose-binding lectinscoord: 322..404
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 10..126