Transposon Ty3-I Gag-Pol polyprotein

Overview
NameTransposon Ty3-I Gag-Pol polyprotein
Smed IDSMED30003204
Length (bp)3277
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transposon Ty3-I Gag-Pol polyprotein (SMED30003204) t-SNE clustered cells

Violin plots show distribution of expression levels for Transposon Ty3-I Gag-Pol polyprotein (SMED30003204) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transposon Ty3-I Gag-Pol polyprotein (SMED30003204) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transposon Ty3-I Gag-Pol polyprotein (SMED30003204) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003204

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30003204 dd_Smed_v4_24988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Match: RTL1 (retrotransposon Gag like 1 [Source:HGNC Symbol;Acc:HGNC:14665])

HSP 1 Score: 110.538 bits (275), Expect = 1.045e-23
Identity = 89/329 (27.05%), Postives = 156/329 (47.42%), Query Frame = 2
Query:  437 NQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKV---KEEDKGKTAFSDGKGLYEF-NVLSFALTGAPATFQRGMNFVLRDIP--HALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQ-QVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAAS 1402
            + +T +  Y   +P E+FD++  ++ FT ++L     +  V   + ED  K AF  G  L E  +   FAL+  P   Q  ++F+L+D+     L Y  +++I+S    EH+  V  V  + R  N+     K ++ +  V ++G +++ KG++ N + +  I  YPTP +  ++R F+     YR F++ F+ IA+PL   L  + +F W   +Q  F+  K+     P+L +P     F + T  +  AL A L Q   +  K     + SR++ P E  YS  E + L +      + +YL   +        P+  L+   D AS
Sbjct:  638 DMLTNRQDYIQMIP-ELFDQLHGAEWFTKLELRGTIVEESVNGHRTEDVWKAAF--GLELEEMKSYQPFALSPDPIIPQNVIHFILKDMLGFFVLSYGQEVLIYSMSQEEHLHHVRQVLVRFRHHNVYCSLDKSQFHRQTVEFLGFVVTPKGVKLNKNVMTIITGYPTPGSKLSLRNFIEFVFPYRHFVERFSIIAEPLVRQLLSSYQFYWGVEEQEAFECLKRAFRKAPLLHHPKPQNPFYLETGVTGTALHASLIQIDDQTGKRACCAFYSRNISPIEVEYSQAEMKILPIRAAFMVWCRYLENTE-------EPIMILLNTEDLAS 956          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Match: RTL1 (retrotransposon Gag like 1 [Source:HGNC Symbol;Acc:HGNC:14665])

HSP 1 Score: 110.538 bits (275), Expect = 1.045e-23
Identity = 89/329 (27.05%), Postives = 156/329 (47.42%), Query Frame = 2
Query:  437 NQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKV---KEEDKGKTAFSDGKGLYEF-NVLSFALTGAPATFQRGMNFVLRDIP--HALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQ-QVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAAS 1402
            + +T +  Y   +P E+FD++  ++ FT ++L     +  V   + ED  K AF  G  L E  +   FAL+  P   Q  ++F+L+D+     L Y  +++I+S    EH+  V  V  + R  N+     K ++ +  V ++G +++ KG++ N + +  I  YPTP +  ++R F+     YR F++ F+ IA+PL   L  + +F W   +Q  F+  K+     P+L +P     F + T  +  AL A L Q   +  K     + SR++ P E  YS  E + L +      + +YL   +        P+  L+   D AS
Sbjct:  638 DMLTNRQDYIQMIP-ELFDQLHGAEWFTKLELRGTIVEESVNGHRTEDVWKAAF--GLELEEMKSYQPFALSPDPIIPQNVIHFILKDMLGFFVLSYGQEVLIYSMSQEEHLHHVRQVLVRFRHHNVYCSLDKSQFHRQTVEFLGFVVTPKGVKLNKNVMTIITGYPTPGSKLSLRNFIEFVFPYRHFVERFSIIAEPLVRQLLSSYQFYWGVEEQEAFECLKRAFRKAPLLHHPKPQNPFYLETGVTGTALHASLIQIDDQTGKRACCAFYSRNISPIEVEYSQAEMKILPIRAAFMVWCRYLENTE-------EPIMILLNTEDLAS 956          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Match: NYNRIN (NYN domain and retroviral integrase containing [Source:HGNC Symbol;Acc:HGNC:20165])

HSP 1 Score: 90.1225 bits (222), Expect = 2.033e-17
Identity = 53/177 (29.94%), Postives = 92/177 (51.98%), Query Frame = 2
Query: 1712 EGILKYIHYNELRI-VVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKV-----PLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKS 2224
             G+L +    + R+ VVP + R  L+   HD  LG H    +T  +L+L  +W  M++ VK +C SC  C+ R+  G ++KV     PL+      AP     +++VGP+  +  G+K++++  D  T+W EA+ +       VAQ+ ++++  R+G P +L   QG  F   +  S
Sbjct: 1520 SGLLMFKGDKKPRVWVVPTQLRRDLIFSVHDIPLGAHQRPEETYKKLRLLGWWPGMQEHVKDYCRSCLFCIPRNLIGSELKVIESPWPLR----STAPWSNLQIEVVGPVTISEEGHKHVLIVADPNTRWVEAFPLKPYTHTAVAQVLLQHVFARWGVPVRLEAAQGPQFARHVLVS 1692          

HSP 2 Score: 55.8398 bits (133), Expect = 6.201e-7
Identity = 48/180 (26.67%), Postives = 79/180 (43.89%), Query Frame = 2
Query:  923 PKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYS--TIEKETLALVYGITTFRQYLVGRKFIVY-------TDHNPLQWLMKHRDAASKLIRWSLALQE 1435
            P N   +  F+G    +R  I  +  +  PL  LLK+   + W Q  +  F   K+ L+    L  P+    F +    S+ AL A+L Q+  G K H I Y S+ L P E++    +      A+ + +  F +  +G   +V        T  +P +     R + + LIRWSL +Q+
Sbjct: 1088 PSNFTALSFFMGFMDSHRDAIPDYEALVGPLHSLLKQKPDWQWDQEHEEAFLALKRALVSALCLMAPNSQLPFRLEVTVSHVALTAILHQEHSGRK-HPIAYTSKPLLPDEESQGPQSGGDSPYAVAWALKHFSR-CIGDTPVVLDLSYASRTTADP-EVREGRRVSKAWLIRWSLLVQD 1264          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Match: GIN1 (gypsy retrotransposon integrase 1 [Source:HGNC Symbol;Acc:HGNC:25959])

HSP 1 Score: 88.5817 bits (218), Expect = 2.194e-17
Identity = 69/273 (25.27%), Postives = 120/273 (43.96%), Query Frame = 2
Query: 1664 SELKQIIDERHKYVIHEGILKYIHYNELR---IVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLV---ERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMP 2464
            SE   I     K+V  E  L Y+  +  +   ++V  + +  +L + H+   G H    +TL+ ++  Y+W ++  DVK+W  +C+ C    NT   I  P +       P  +  +D++GP   +   + Y I+  D  TKW     + +  A  V++  I NI F YG P+K++ DQ   F  ++   +  LF I ++  S     T G V   E    T+   +S +      +W   + +  F       E T  TP++ M+ +   MP
Sbjct:   31 SERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVIVSEEEKKKVLRECHENDSGAHHGISRTLTLVESNYYWTSVTNDVKQWVYACQHCQVAKNT--VIVAPKQHLLKVENPWSLVTVDLMGPFHTSNRSHVYAIIMTDLFTKWIVILPLCDVSASEVSKAII-NIFFLYGPPQKIIMDQRDEFIQQINIELYRLFGIKQIVIS----HTSGTVNPTESTPNTIKAFLSKHCADHPNNWDDHLSAVSFAFNVTHLEPTKNTPYFQMFSRNPYMP 296          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Match: GIN1 (gypsy retrotransposon integrase 1 [Source:HGNC Symbol;Acc:HGNC:25959])

HSP 1 Score: 76.6406 bits (187), Expect = 6.580e-15
Identity = 53/191 (27.75%), Postives = 91/191 (47.64%), Query Frame = 2
Query: 1664 SELKQIIDERHKYVIHEGILKYIHYNELR---IVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNF-QSELFKS 2224
            SE   I     K+V  E  L Y+  +  +   ++V  + +  +L + H+   G H    +TL+ ++  Y+W ++  DVK+W  +C+ C    NT   I  P +       P  +  +D++GP   +   + Y I+  D  TKW     + +  A  V++  I NI F YG P+K++ DQ   F Q ++F S
Sbjct:   31 SERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVIVSEEEKKKVLRECHENDSGAHHGISRTLTLVESNYYWTSVTNDVKQWVYACQHCQVAKNT--VIVAPKQHLLKVENPWSLVTVDLMGPFHTSNRSHVYAIIMTDLFTKWIVILPLCDVSASEVSKAII-NIFFLYGPPQKIIMDQRDEFIQQKVFIS 218          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: BX511082.1 (pep chromosome:GRCz11:9:14291932:14297132:1 gene:ENSDARG00000113678.1 transcript:ENSDART00000183119.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511082.1)

HSP 1 Score: 360.918 bits (925), Expect = 7.576e-105
Identity = 244/804 (30.35%), Postives = 398/804 (49.50%), Query Frame = 2
Query:  242 LMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPHAL--VYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGE-KDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGR--KFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDEELKQIIRHTVIIQKDSELKQIIDERHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPN-QKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSPTSQYLD----IPNYKVIMQERLQSAWIKA-------GLKIKYRQEQYKE 2602
            L   +P K + Y +    ++  ++ I       IIR S SP  +    VKKKDG LR C+DYR LN +T K+TYP+P+    F+R+  +  FT +DL   Y+  +++E D+ KTAF+  +G +E+ VL F L+ APA FQ  +N VLRD+      VY+DDI+IFS    EH++ V  V ++L E  L +K  KC +    V ++GHI+S +G++ +P+ V+ + ++PTP +   +++FLG A++YR+FI++F+ +A PLT L    T F W  A Q  FD  K   +  PIL  PD ++ F+V  DAS   +GA+L Q+   + K H   Y S  L   E+NY    +E LA+   +  +R +L G    FIV+TDH  L+++   +   S+  RW+L    +DF I YR G  N + DALSR                  IF   + A++ PE             I+   + I   S +   I+ R +  + EG+         R+ VP + R  ++   H   L  H    +TL  +K +++W  M +D++ +  +C +C     + +     L+P  +P+ P    A+D V  LP  +NGN  I+   D  +K      +P    A   A   I+++   +G P  +++D+G  F S+ ++    L       +S +HPQ++G  ER N  L  M+   V++    W   +    + H +    +TG +PF             L +Q P    L+    +P+    +Q R +  W +A       GL+ K + ++++ 
Sbjct:  519 LPGTSPPKGKLYSLSVPEREAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNAITVKNTYPLPLMSSAFERLQGASFFTKLDLRNAYHLVRIREGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMLDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGMRMDPEKVQAVVDWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTALTSLKTPFRWSNAAQVAFDRLKSCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQRSSSDGKMHPCAYFSHRLNNAEQNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEYIQSAKRLNSRQARWALFFGRFDFSISYRPGSKNVKPDALSR------------------IFDHSERASS-PE------------TIVPRRLFI---SAVTWEIESRVRMAL-EGVTPPPGCPPSRLFVPEELRSDVIRWGHSSKLACHPGVSRTLYLIKQRFWWPVMARDIRNFVLACSVCAVSKTSNRPPAGLLQPLSVPSRPWSHIALDFVTGLPP-SNGNTVILTVVDRFSKATHFIPLPKLPSARETAAAVIDHVFRIHGLPTDVVSDRGPQFISKFWREFCHLMGATVSLSSGFHPQSNGQTERANQDLERMLRCLVSQNPSSWSQQLSWVEYAHNSLPVSATGLSPFE----------CSLGYQPPAFPSLESEVAVPSAHAFVQ-RCRRTWNRARQTLLQVGLRTKAKADRHRS 1275          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: BX546500.1 (pep chromosome:GRCz11:23:12926092:12931693:-1 gene:ENSDARG00000086495.3 transcript:ENSDART00000122176.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX546500.1)

HSP 1 Score: 354.369 bits (908), Expect = 6.262e-103
Identity = 232/805 (28.82%), Postives = 396/805 (49.19%), Query Frame = 2
Query:  242 LMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPHAL--VYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGE-KDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGR--KFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDEELKQ-IIRHTVIIQKDSELKQIIDERHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFR-YGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSPTSQYLD----IPNYKVIMQERLQSAW-------IKAGLKIKYRQEQYKE 2602
            L   +P K + Y +    ++  ++ I       IIR S SP  +    VKKKDG LR C+DYR LN +T K+TYP+P+    F+R+  +  FT +DL   Y+  +++  D+ KTAF+  +G +E+ VL F L+ APA FQ  +N VLRD+      VY+DDI+IFS    EH++ V  V ++L E  L +K  KC +    V ++GHI+S +G++ +P+ ++ + ++PTP +   +++FLG A++YR+FI++F+ +A PLT L      F W  A +  F   K   +  PIL  PD ++ F+V  DAS   +GA+L Q+   + K H   Y S  L P E+NY    +E LA+   +  +R +L G    FIV+TDH  L+++   +   S+  RW+L    ++F I YR G  N + DALSR                     L   ++      R    D  L Q I+   +  + +S ++  ++         G+   I     R+ VP + R  ++   H   +  H    +TL  +K +++W TM +DV+ +  +C +C    ++ +     L+P  +P+ P    ++D V  LP ++NGN  ++   D  +K     ++P   +     + + + +FR +G P  +++D+G  F S  ++    L       +S +HPQ++G  ER N  L   +   V++    W   +    + H +    STG +PF             L +Q P    L+    +P+    +Q R +  W       ++ G + K + ++++ 
Sbjct:  493 LPGTSPPKGKLYSLSVPEREAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVDWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTSLTSSKMPFRWSSAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQRSSSDGKIHPCAYFSHRLSPAERNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEYIRSAKRLNSRQARWALFFGRFNFTISYRPGSKNIKPDALSR---------------------LFDPSD------RLSSPDPVLPQGIVVANISWEIESRVRTALN---------GVTPPIGCPPSRLFVPEELRSDVVRWGHSSKVACHPGVSRTLFVIKQRFWWPTMARDVRDFVLACSVCAVSKSSNRPPAGLLQPLSVPSRPWSHISLDFVTGLP-SSNGNTVVLTVVDRFSKAAHFISLPKLPSARETAVAVIDHVFRIHGLPTDVVSDRGPQFVSRFWREFCRLLGATVSLSSGFHPQSNGQTERANQDLERTLRCLVSQNPSSWSQQLSWVEYAHNSLPVSSTGLSPFQ----------CSLGYQPPVFPSLESEVAVPSVHAFVQ-RCRRTWNRARQTLLRVGTRTKAKADRHRS 1249          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: CR855320.1 (pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENSDARG00000099359.2 transcript:ENSDART00000159655.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855320.1)

HSP 1 Score: 354.369 bits (908), Expect = 1.267e-102
Identity = 233/805 (28.94%), Postives = 395/805 (49.07%), Query Frame = 2
Query:  242 LMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPHAL--VYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGE-KDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGR--KFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDEEL-KQIIRHTVIIQKDSELKQIIDERHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFR-YGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSPTSQYLD----IPNYKVIMQERLQSAWIKA-------GLKIKYRQEQYKE 2602
            L   +P K + Y +    ++   + I       IIR S SP  +    VKKKDG LR C+DYR LN +T K+TYP+P+    F+R+  +  FT +DL   Y+  +++  D+ K+AF+  +G +E+ VL F L+ APA FQ  +N VLRD+      VY+DDI+IFS    EH++ +  V ++L E  L +K  KC +    V ++GHI+S +GL+ +P+ +K + N+PTP +   +++FLG A++YR+FI++F+ +A PLT L    T F W  A +  F   K   +  PIL  PD ++ F+V  DAS   +GA+L Q+   + K H   Y S  L   E NY    +E LA+   +  +R +L G    FIV+TDH  L+++   +   S+  RW+L    ++F I YR G  N + DALSR              L D+              +R   ++  + K+I+   +  + +S+++  +D         G+   I     R+ VP K R  ++   H   +  H    +T   +K +++W  + +DV+ +  +C +C     + +     L+P  +P+ P    ++D V  LP  +NGN  I+   D  +K      +P   +     + + N +FR +G P  +++D+G  F S+ ++    L       +S +HPQ++G  ER N  L   +   V++    W   +    + H +    +TG +PF             L +Q P    L+    +P+    +Q R +  W +A       G++ K + ++++ 
Sbjct:  521 LPGTSPPKGKLYSLSAPEREAMGKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNNITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRAGDEWKSAFNTPRGHFEYCVLPFGLSNAPAVFQAFVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHIRRVLQRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGLRMDPEKIKAVVNWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTALTSSKTPFRWSSAAEAAFSKLKGCFVSAPILITPDPSRQFVVEVDASEVGVGAILSQRSSSDGKIHPCAYYSHRLSAAESNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEYIKSAKRLNSRQARWALFFGRFNFTISYRPGSKNIKPDALSR--------------LFDS-------------SERTSSLEPVVPKRIVISNITWEIESKVRAALD---------GVTPPIGCPPSRLFVPEKLRSDVIRWGHSSKVACHPGVSRTSFVIKQRFWWPALARDVRDFVLACSVCAVSKTSNRPPAGLLQPLSVPSRPWSHISLDFVTGLPP-SNGNTVILTVVDRFSKAAHFVPLPKLPSARETAVAVINHVFRIHGLPTDVVSDRGPQFISKFWREFCRLLGATVSLSSGFHPQSNGQTERANQDLERTLRCLVSQNPSSWSQQLSWVEYAHNSLPVSATGLSPFQ----------CSLGYQPPVFPSLESEVAVPSVHAFVQ-RCRRTWSRARQTLLQVGVRTKAKADRHRS 1277          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: BX511224.1 (pep chromosome:GRCz11:2:18017000:18022765:1 gene:ENSDARG00000113243.1 transcript:ENSDART00000186877.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511224.1)

HSP 1 Score: 350.903 bits (899), Expect = 2.145e-101
Identity = 234/805 (29.07%), Postives = 394/805 (48.94%), Query Frame = 2
Query:  242 LMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPHAL--VYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGE-KDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGR--KFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDEELKQ-IIRHTVIIQKDSELKQIIDERHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFR-YGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSPTSQYLD----IPNYKVIMQERLQSAW-------IKAGLKIKYRQEQYKE 2602
            L   +P K + Y +    ++  ++ I       IIR S SP  +    VKKKDG LR C+DYR LN +T K+TYP+P+    F+R+  +  FT +DL   Y+   ++  D+ KTAF+  +G +E+ VL F L+ APA FQ  +N VLRD+      VY+DDI+IFS    EH++ V  V ++L E  L +K  KC +    V ++GHI+S +G++ +P+ ++ + N+PTP +   +++FLG A++YR+FI +F+ +A PLT L    T F W  A +  F   K   +  PIL  PD ++ F+V  DAS   +GA+L Q+   + K H   Y S  L   E+NY    +E LA+   +  +R +L G    FIV+TDH  L+++   +   S+  RW+L    ++F I YR G  N + DALSR                     L   ++      R    D  L Q I+   +  + +S ++  +D         G+   I     R+ VP + R  ++   H   +  H    +TL  +K +++W  M +DV+ +  +C +C    ++ +     L+P  +P+ P    ++D V  LP ++NGN  I+   D  +K     ++P   +     + + + +FR +G P  +++D+G  F S+ ++    L       +S +HPQ++G  ER N  L   +   V++    W   +    + H +    +TG + F             L +Q P    LD    +P+    +Q R +  W       ++AG + K + ++++ 
Sbjct:  519 LPGTSPPKGKLYSLSVPEREAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVCIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHIQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVNWPTPDSRKALQRFLGFANFYRRFIHNFSQLAAPLTSLTSSKTPFRWSSAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQRSASDGKVHPCAYFSHRLSSAERNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEYIKSAKRLNSRQARWALFFGRFNFTISYRPGSKNIKPDALSR---------------------LFDPSD------RTSSPDPVLPQRIVVANISWEIESRVRTALD---------GVTPPIGCPPNRLFVPEELRSDVVRWGHSSKVACHPGVSRTLFVVKQRFWWPAMARDVRDFVLACSVCAVSKSSNRPPAGLLQPLSVPSRPWSHISLDFVTGLP-SSNGNTVILTVVDRFSKAAHFISLPKLPSARETAVAVIDHVFRIHGLPTDVVSDRGPQFVSKFWREFCRLLGATVSLSSGFHPQSNGQTERANQDLERTLRCLVSQNPSSWSQQLSWVEYAHNSLPVSATGLSSFQ----------CSLGYQPPVFPSLDSEVAVPSVHAFVQ-RCRRTWNRARQTLLQAGTRTKAKADRHRS 1275          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: CR925755.2 (pep chromosome:GRCz11:17:42486740:42492668:-1 gene:ENSDARG00000116402.1 transcript:ENSDART00000183946.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR925755.2)

HSP 1 Score: 344.354 bits (882), Expect = 3.224e-99
Identity = 231/803 (28.77%), Postives = 387/803 (48.19%), Query Frame = 2
Query:  242 LMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPHAL--VYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQ--VEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGR--KFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDEELKQ-IIRHTVIIQKDSELKQIIDERHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFR-YGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSPTSQYLD----IPNYKVIMQERLQSAWIKAGLKIKYRQEQYKETYDK 2614
            L   +P K + Y +    ++  ++ I       IIR S SP  +    VKKKDG LR C+DYR LN +T K+TYP+P+    F+R+  +  FT +DL   Y+  +++  D+ KTAF+  +G +E+ VL F L+ APA FQ  +N VLRD+      VY+DDI+IFS    EH++ V  V ++L E  L +K  KC +    V ++GH +S +G++ +P+ ++ + N+PTP +   +++FLG A++YR+FI++F  +A PLT L    T F W  A +  F   K   +  PIL  PD ++ F+V  D S   +GA+L Q+  ++G K H   Y S  L   E+NY    +E LA+   +  +R +L G    FIV TDH  L+++   +   S+  RW+L    ++F I YR G  N + DALSR+                                R    D  L Q +    +  + +S ++  +D         G+   I     R+ VP   R  ++   H   +  H    +TL  +K +++W  M +DV+ +  +C +C    ++ +     L+P  +P+ P    ++D V  LP ++NGN  ++   D  +K      +P   +     + + + +FR +G P  +++D+G  F S+ ++    L       +S +HPQ++G  ER N  L   +   V++    W   +    + H +    +TG +PF             L +Q P    L+    +P+    +Q R +  W +A   +    E+ K   D+
Sbjct:  492 LPGTSPPKGKLYSLSVPEREAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHTVSVEGMRMDPEKIQAVVNWPTPDSRKALQRFLGFANFYRRFIRNFRQLAAPLTNLTSSKTPFRWSNAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDVSEVGVGAILSQRSALDG-KIHPCAYFSHRLSAAERNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVSTDHKNLEYIKSAKRLNSRQARWALFFGRFNFSISYRPGSKNIKPDALSRLFDRS---------------------------DRTSSPDPVLPQRVFVANISWEIESRVRTALD---------GVTPPIGCPPSRLFVPEDLRSDVIWWGHSSKVACHPGVSRTLFVIKQRFWWPVMARDVRDFVLACSVCAASKSSNRPPAGLLQPLSVPSRPWSHISLDFVTGLP-SSNGNTVVLTVVDRFSKAAHFVPLPKLPSARETAVAVIDHVFRIHGLPTDVVSDRGPQFVSKFWREFCRLLGATVSLSSGFHPQSNGQTERANQDLERTLRCLVSQNPSSWSQQLSWVEYAHNSLPVSATGLSPFQ----------CSLGYQPPVFPSLESEVAVPSIHAFVQ-RCRRTWNRARQTLLQVGERTKAKADR 1245          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Match: ENSXETT00000006041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:37317867:37322724:1 gene:ENSXETG00000003070.1 transcript:ENSXETT00000006041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 416.387 bits (1069), Expect = 1.321e-125
Identity = 267/905 (29.50%), Postives = 452/905 (49.94%), Query Frame = 2
Query:  158 KLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIP--HALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKF------------------------VW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGIT-TFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADA-------------------------LSRXXXXXXXXXXXXXKLRDTIFALIKAANNVP-------------EFQREQEMDEELKQII-----RHTVIIQKDSE--LKQIIDERHKYVIHEGIL-----KYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEF-----QSPTSQYLDIPNYKVIMQERLQSAWIKAGLKIKYRQEQYKETYDKKARM 2626
            K L ++  +F+ ++ D+G ++  +H+I L ++ P + R  RI     ++  + ++ +K   II++S SP++S IVVV+KK+G +R CVDYR LNQ T  D Y  P  ++  + +  S+ F+V+DL  GY Q  +  EDK KTAF    G +EFN +   L GAPATFQR M   + D+     LVY+DD+I+F     EH + +  VF +L +  LK+ P KC++ +  V YVGH++S +G+  +P  ++ + ++P P+ +  +R FLG   YYR+F+K F+ +AQPL  LL+  T+                          W +     FD  K  L   P+L Y D TK + +  DAS   LG +L Q+   E    + + SRSL P E+NY   + E LAL + +     +YL G +F V TD+NPL +++      +   RW  AL  Y F ++YR G+ N +AD                          + +  +    +     K+  T+  + K   NV              + +R+Q  D   +  +     +   I++ DS      ++ E  +  + +G++           + ++++P KHRD++L+  HD    GHL   KTL  ++ +++W  M+QDV+ +C SC  C+ R     +   PL      +    +   D +   P+   G   ++V  D+ T++ +A+   +Q+A  VA++ +E     YG PK++ +DQG +F+S+L   +  +  + K  T+PYHPQ D   ERFN TL++M+ +    K+  W   I + +  + +  N +TG +P++LM+ +   +PID  F      +P   +    +Y   ++  LQ A+ +A   +  +  Q K  YDKK ++
Sbjct:  293 KHLNEHSALFSRNDLDMGCSTSTKHKIRLREDKPFRERSRRIAPGDLEDLRKHLEELKAAGIIKESRSPYASPIVVVRKKNGSIRMCVDYRTLNQRTIPDQYTTPRIEDALNCLVGSKWFSVLDLRSGYYQLPMHPEDKEKTAFICPLGFFEFNRMPQGLCGAPATFQRLMERTVGDMHLLEVLVYLDDLIVFGRTLEEHEQRLLKVFDRLEKEGLKLSPEKCQFCQPSVNYVGHVVSAEGIATDPSKIEAVSSWPKPRTITELRSFLGFCGYYRRFVKGFSKVAQPLNQLLQSNTEVEGSDRDILAKRLRGQGWTRESIEDFWTEECDKAFDQLKYCLTHAPVLAYADATKPYTLHIDASREGLGGILYQEYNKEL-RPVAFISRSLSPSERNYPAHKLEFLALKWAVVDKLHEYLYGAEFEVQTDNNPLTYILTTAKLDATGHRWLAALAHYKFSLRYRPGRDNRDADGLSRRPHGDLHPDDEWIEIPAPGVRTMCQGITGRCQSGNFAEKIGMTVRGIPKLYCNVTSVGTSTMPALNKGDIKRDQSEDPLCQMAMEALRKKQVQILKTDSHPLASLLVKEWDRLRLRDGLVYRRAPSATDSEKWQLMLPQKHRDSVLMALHDE--HGHLGYDKTLGLVRDRFYWPCMKQDVEDYCRSCLRCIQRKTLPSR-AAPLSHMESHSPLDLVCI-DFLSIEPDE-GGTSNVLVVTDHYTRYAQAFPTKDQRAITVAKVLVERFFIHYGLPKRIHSDQGRDFESKLVHELMSMLGVLKSRTTPYHPQGDPQPERFNRTLLDMLGTLPKEKKTHWSRHIATVVHAYNSTKNGATGYSPYFLMFGREARLPIDTVFGVTADDTPVKSH---SSYVDRLKRDLQRAYKRAQEAVGKKNMQNKTLYDKKVKI 1188          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Match: anxa6 (annexin A6 [Source:Xenbase;Acc:XB-GENE-989741])

HSP 1 Score: 357.451 bits (916), Expect = 2.212e-108
Identity = 191/463 (41.25%), Postives = 276/463 (59.61%), Query Frame = 2
Query:  119 SKELSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPH-ALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLL--KKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSR 1498
            S  L   Q     K+L  Y  +F+    + G     EH++    + PI+   YR+  A + E   QI  M  F +I  S SP++S +V+V KKDG  RFCVDYR+LN VT  D YP+P   E+ DR+G ++  T +DL++GY Q  +    + K+AF    GLY+F V+ F +  APATFQR +N +L  +   A  Y+DDI +FS  + EH++ ++ VF Q+++A L +KP KC    +EV Y+GH +    L+P+P  V+ I  +P PK    V  FLG + YYRKFI +++ +A+PLT L   +++   VW    ++  +  KQ L  +P+L  PDF++ F++ TDASN  LGAVL Q     ++H + Y SR L P E  Y+TIEKE LA+V+ +   + YL GR+F V TDHNPL WL +      KL+RWSL LQ+Y+F I++R GK +  AD LSR
Sbjct:  294 SDHLHLSQQDQLRKILRSYSPMFS---ANPGRTHWAEHKVDTGTQLPIRSPAYRVAEAVRPEMKSQIDEMLAFGVITPSHSPWASPVVLVPKKDGSTRFCVDYRRLNDVTTTDAYPMPRVDELLDRLGNAKYLTTLDLSRGYWQIPLAPSAQEKSAFLTPFGLYQFTVMPFGMRNAPATFQRLVNRLLEGMQDFAQAYLDDIAVFSQTWEEHLQHLQRVFAQIQDAGLTLKPEKCHLAMAEVQYLGHRVGGGQLRPDPAKVEAICQWPIPKTQKQVLAFLGTSGYYRKFIPNYSTVAKPLTDLTSRQRSRTIVWTPECESAMNALKQALASSPVLAAPDFSRRFILQTDASNFGLGAVLSQVNTYGEEHPVAYLSRKLLPREAAYATIEKECLAIVWALQKLQPYLYGREFTVVTDHNPLSWLQRVSGDNGKLLRWSLLLQQYNFTIQHRKGKEHHNADGLSR 753          

HSP 2 Score: 132.109 bits (331), Expect = 8.671e-31
Identity = 72/190 (37.89%), Postives = 111/190 (58.42%), Query Frame = 2
Query: 2066 DYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQ----SPTSQYLDIPNYKVIMQERLQSAWIKAGLKIKYRQEQYKETYDKKAR 2623
            DY T++PEA A+    A  VA   I+ I  R G P ++L+DQG  F S+L + + +   +  +++SPYHPQT+GL ERFNGTL  M+ ++V   ++DW  ++   LF +R    ESTG +PF L+Y +R   P+DL  +    +P SQ + I  Y +  ++RL+     A   +   Q++ K  YD+KAR
Sbjct:    2 DYATRYPEAVALRKIDAPTVADALIQ-IFSRVGFPSEILSDQGPQFTSQLLQCLWQRCGVRAIHSSPYHPQTNGLCERFNGTLKTMLRTFVESGEKDWERYLPHLLFAYREVPQESTGFSPFELLYGRRVRGPLDLLCEYWEGAPQSQEVPIIPYVLKFRQRLEQMTSLAHDHLSAAQQRQKVWYDRKAR 190          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Match: ENSXETT00000035398.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:9869556:9871940:-1 gene:ENSXETG00000011182.1 transcript:ENSXETT00000035398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 339.347 bits (869), Expect = 2.881e-102
Identity = 230/729 (31.55%), Postives = 365/729 (50.07%), Query Frame = 2
Query:  305 SDRQIKAMKEF-------NIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDI--PHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTK-FVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGE-KDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVG--RKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDEELKQIIRHTVIIQKDSELKQIIDERHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQK---AEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMY 2443
            S  +  AMKE+         IR S SP  +    V+KKDG LR C+DYR LN++T K+ YP+P+  E+FD++  ++ F+ +DL   YN  +++E D+ KTAF+   G YE+ V+ F L  APA FQ  +N + RD+     +VY+DDI+IFS     H   V+    +LRE +L  K  KC +   +++++G+IIS +G + +P  V  I+ +P P++   +++F+G A+YYR+FIK F+    P+  L++K  +   W       F + K   I   +LR+P+    F +  DAS+   GA+L Q+   + K H   Y S+     E+NY    +E LA+   +  +R  L G      +YTDH  L++L   +    +  RWSL    + F + YR G  N +ADALSR                               F  E  +  E + II  + II   S L Q  ++    ++                VP + R  +L Q H     GH  + KTL  L+   +W T+ +DV+ +  +C +C T   +  +    L P P+P+ P     MD +  LP +  GN  I V  D  +K   A+ +P +K   A  +AQ+FI++I   +G P ++++D+G+ F S  ++S+ +   +    +S YHPQT+G  ER N  L   + ++V+  Q DW   +    F H NA + STG +PF  +Y
Sbjct:   11 SPAETAAMKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENSLFAKLEKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKGFSSRIAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDASDVGAGAILSQRHSADGKLHPCAYFSKKFSSAEQNYDIGNRELLAVKLALEEWRHLLEGASHPVTIYTDHKNLEFLQSLKRQNPRQARWSLFFSRFHFVLTYRPGTKNRKADALSR------------------------------SFSPEDRLPIEREPIIPPSRIIA--SVLPQFAEQ----ILLSQSAAPPDTPIGMAFVPPELRLPILQQTHSSKQAGHPGSEKTLELLQRLVWWPTIRKDVRDFVAACTVCATTKASHSRPCGLLHPLPVPSRPWTHLGMDFIVELPPSC-GNTVIWVVIDRFSKM--AHFVPLRKLPSAVELAQLFIQHIFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERVNQALEQFLRNHVSLCQDDWSDLLPWAEFAHNNARHSSTGRSPFLSVY 700          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Match: castor1 (cytosolic arginine sensor for mTORC1 subunit 1 [Source:Xenbase;Acc:XB-GENE-960689])

HSP 1 Score: 342.813 bits (878), Expect = 3.262e-98
Identity = 235/749 (31.38%), Postives = 374/749 (49.93%), Query Frame = 2
Query:  251 ETPIKLRPYRIPYAHQDE--SDRQIKAMKEF-------NIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDI--PHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKF-VW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGE-KDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVG--RKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDEELKQIIRHTVIIQKDSELKQIIDERHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQK---AEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMY 2443
            + PI L P  +P   +    S  +  AMKE+         IR S SP  +    V+KKDG LR C+DYR LN++T K+ YP+P+  E+FD++  ++ F+ +DL   YN  +++E D+ KTAF+   G YE+ V+ F L  APA FQ  +N + RD+     +VY+DDI+IFS     H   V+    +LRE +L  K  KC +   +++++G+IIS +G + +P  V  I+ +P P++   +++F+G A+YYR+FIK F+    P+  L++K  +   W       F + K   I   +LR+P+    F +  DAS+   GA+L Q+   + K H   Y S+     E+NY    +E LA+   +  +R  L G      +YTDH  L++L   +    + +RWSL    + F + YR G  N +ADALSR                               F  E  +  E + II  + II   S L Q  ++    ++                VP + R  +L Q H     GH  + KTL  L+   +W T+ +DV+ +  +C +C T   +  +    L P P+P+ P     MD +  LP +  GN  I V  D  +K   A+ +P +K   A  +AQ+FI++I   +G P ++++D+G+ F S  ++S+ +   +    +S YHPQT+G  ER N  L   + ++V+  Q DW   +    F H NA + STG +PF  +Y
Sbjct:  509 DCPIDLLPGIMPPRGRTYPLSPAETAAMKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENSLFAKLDKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKGFSSRIAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDASDVGAGAILSQRHSADGKLHPCAYFSKKFSSAEQNYDIGNRELLAVKLALEEWRHLLEGASHPVTIYTDHKNLEFLQSLKRQNPRQVRWSLFFSRFHFVLTYRPGTKNRKADALSR------------------------------SFSPEDRLPIEREPIIPPSRIIA--SVLPQFAEQ----ILLSQSAAPPDTPIGMAFVPPELRLPILQQTHSSKQAGHPGSEKTLELLQRLVWWPTIRKDVRDFVAACTVCATTKASHSRPCGLLHPLPVPSRPWTHLGMDFIVELPPSC-GNTVIWVVIDRFSKM--AHFVPLRKLPSAVELAQLFIQHIFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERVNQALEQFLRNHVSLCQDDWSDLLPWAEFAHNNASHSSTGRSPFLSVY 1218          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Match: ENSXETT00000042189.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460667.1:82848:87648:1 gene:ENSXETG00000017765.1 transcript:ENSXETT00000042189.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 341.658 bits (875), Expect = 6.272e-98
Identity = 237/749 (31.64%), Postives = 377/749 (50.33%), Query Frame = 2
Query:  251 ETPIKLRPYRIPYAHQDE--SDRQIKAMKEF-------NIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDI--PHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHF-AHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGE-KDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVG--RKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDEELKQIIRHTVIIQKDSELKQIIDERHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQK---AEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMY 2443
            + PI L P  +P   +    S  +  AMKE+         IR S SP  +    V+KKDG LR C+DYR LN++T K+ YP+P+  E+FD++  ++ F+ +DL   YN  +++E D+ KTAF+   G YE+ V+ F L  APA FQ  +N + RD+     +VY+DDI+IFS     H   V+    +LRE  L  K  KC +   +++++G+IIS +G + +P  V  I+ +P P++   +++F+G A+YYR+FIK F +HIA  L+++ K      W       F + K   I   +LR+P+    F +  DAS+   GA+L Q+   + K H   Y S+     E+NY    +E LA+   +  +R  L G      +YTDH  L++L   +    +  RWSL    ++F + YR G  N +ADALSR  S +     E+  +    F +I  A+ +P+F          +QI+        D+ +                            VP + R  +L Q H     GH  + KTL  L+   +W T+ +DV+ +  +C +C T   +  +    L P PIP+ P     MD +  LP +  GN  I V  D  +K   A+ +P +K   A  +A +FI++I   +G P ++++D+G+ F S  ++S+ +   +    +S YHPQT+G  ER N  L   + ++V+  Q DW   +    F H NA + STG +PF  +Y
Sbjct:  509 DCPIDLLPGTMPPRGRTYPLSPAETAAMKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENFLFAKLEKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKDFSSHIAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDASDVGAGAILSQRHSADGKLHPCAYFSKKFSSAEQNYDIGNRELLAVKLALEEWRHLLEGASHPVTIYTDHKNLEFLQSLKRQNPRQARWSLFFTRFNFVLTYRPGTKNRKADALSRSFSPKDRLPIEQEPIIPP-FRII--ASVLPQFA---------EQILLSQSAAPSDTPIGMAF------------------------VPPELRLPILQQTHSSKQAGHPGSEKTLELLRRLVWWPTIRKDVRDFVAACTVCATTKASHSRPCGLLHPLPIPSRPWTHLGMDFIVELPPSC-GNTVIWVVIDRFSKM--AHFIPLRKLPSAVELAHLFIQHIFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERVNQALEQFLRNHVSLCQDDWSDLLPWAEFAHNNASHSSTGRSPFLSVY 1218          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Mouse
Match: Nynrin (NYN domain and retroviral integrase containing [Source:MGI Symbol;Acc:MGI:2652872])

HSP 1 Score: 84.7297 bits (208), Expect = 6.357e-16
Identity = 53/200 (26.50%), Postives = 94/200 (47.00%), Query Frame = 2
Query: 1640 HTVIIQKDSELKQIIDERHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKV-----PLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKS 2224
            +++ + +DS L     ERH  V                VVP + R  L+   HD  +G H     T   ++L  +W  M+  V+ +C SC  C+ R+  G ++KV     PL+ T   ++       ++VGP+  +  G+K++++  D  T+W EA+ +       VAQ+ ++++  R+G P +L   QG  F   +  S
Sbjct: 1455 NSLSLDQDSGLLMFKGERHPRVW---------------VVPRQLRRDLIFSVHDSPIGEHQGLEDTYKTVRLLGWWPGMQDHVRDYCRSCLFCIPRNLIGGELKVIESPWPLRSTAPWSSLQI----EVVGPVTVSEEGHKHVLIVADANTRWVEAFPLKPYTHVAVAQVLLQHVFARWGVPIRLEAAQGPQFARHVLVS 1635          

HSP 2 Score: 55.0694 bits (131), Expect = 6.523e-7
Identity = 49/180 (27.22%), Postives = 76/180 (42.22%), Query Frame = 2
Query:  923 PKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHE--KNYSTIEKETLALVYGITTFRQYLVGRKFIVY-------TDHNPLQWLMKHRDAASKLIRWSLALQE 1435
            P N   +  F+G    +R  I  +  +  PL  LLK+   + W Q  +  F   K+ L+    L  P+    F +    S  +L A L Q+  G K H I Y S+ L P E  +   +      A+ + +  F +  VG   +V        T  +   W  + R + + LIRWSL LQ+
Sbjct: 1031 PSNFTALSFFMGFMDSHRDVISDYEDLVGPLHGLLKQKPDWQWNQEHEKSFLALKRALVCALCLSTPNPNLPFYLEVTVSQVSLTASLHQEHSGRK-HPIAYTSKPLLPDEDSEGPQSGGDSPYAVAWALKHFAR-CVGDNPVVLRLSYASRTTVDNEAWDSR-RASKAWLIRWSLLLQD 1207          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Mouse
Match: Nynrin (NYN domain and retroviral integrase containing [Source:MGI Symbol;Acc:MGI:2652872])

HSP 1 Score: 84.7297 bits (208), Expect = 6.357e-16
Identity = 53/200 (26.50%), Postives = 94/200 (47.00%), Query Frame = 2
Query: 1640 HTVIIQKDSELKQIIDERHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKV-----PLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKS 2224
            +++ + +DS L     ERH  V                VVP + R  L+   HD  +G H     T   ++L  +W  M+  V+ +C SC  C+ R+  G ++KV     PL+ T   ++       ++VGP+  +  G+K++++  D  T+W EA+ +       VAQ+ ++++  R+G P +L   QG  F   +  S
Sbjct: 1455 NSLSLDQDSGLLMFKGERHPRVW---------------VVPRQLRRDLIFSVHDSPIGEHQGLEDTYKTVRLLGWWPGMQDHVRDYCRSCLFCIPRNLIGGELKVIESPWPLRSTAPWSSLQI----EVVGPVTVSEEGHKHVLIVADANTRWVEAFPLKPYTHVAVAQVLLQHVFARWGVPIRLEAAQGPQFARHVLVS 1635          

HSP 2 Score: 55.0694 bits (131), Expect = 6.523e-7
Identity = 49/180 (27.22%), Postives = 76/180 (42.22%), Query Frame = 2
Query:  923 PKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHE--KNYSTIEKETLALVYGITTFRQYLVGRKFIVY-------TDHNPLQWLMKHRDAASKLIRWSLALQE 1435
            P N   +  F+G    +R  I  +  +  PL  LLK+   + W Q  +  F   K+ L+    L  P+    F +    S  +L A L Q+  G K H I Y S+ L P E  +   +      A+ + +  F +  VG   +V        T  +   W  + R + + LIRWSL LQ+
Sbjct: 1031 PSNFTALSFFMGFMDSHRDVISDYEDLVGPLHGLLKQKPDWQWNQEHEKSFLALKRALVCALCLSTPNPNLPFYLEVTVSQVSLTASLHQEHSGRK-HPIAYTSKPLLPDEDSEGPQSGGDSPYAVAWALKHFAR-CVGDNPVVLRLSYASRTTVDNEAWDSR-RASKAWLIRWSLLLQD 1207          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Mouse
Match: Rtl1 (retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:MGI:2656842])

HSP 1 Score: 84.3445 bits (207), Expect = 7.430e-16
Identity = 80/331 (24.17%), Postives = 145/331 (43.81%), Query Frame = 2
Query:  437 NQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKE-----EDKGKTAFSDGKGLYEFNVL-SFALTGAPATFQRGMNFVLRDIPHALVYID--DIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQ-QVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAAS 1402
            + +T +  Y   VP E+FD++  +  FT ++L  G  + +++      ED  + +F  G GL++      F +          ++F+L+DI    V     +++++S    EH + V  V  + R  N+     K ++ +     +G  IS KG++ N + +  I   P P +   ++  + L   YR F+++FA IA PL   L  +  + W + +Q   ++ K+    +P+L +P     F + TD +   L A L Q   E  K     + SR L   E  Y  +E   L +      + +YL   +        P+  L+   D AS
Sbjct:  898 DMLTDRQDYTQMVP-ELFDQLHGAAWFTKLEL-LGIKESEMRHTVTHTEDTWRASF--GFGLHQMRCYRPFTMNSYSDEGNNIVHFILKDILGLFVICHGREVLVYSMSQEEHSQHVRQVLVRFRYHNIYCSLDKTQFHRQTAEILGFNISPKGVKLNKNLMNLIVGCPVPGSRRCLQSVIDLVYPYRHFVENFAVIAAPLVRQLLSSEPYYWGEEEQEALESLKRAFRKSPVLYHPKPQNPFYLETDITGSFLSASLVQTDDETGKKSTCAFYSRPLSTMEVEYPRVEMRILPIRAAFMVWCRYLENTE-------EPIMILLNTEDLAS 1217          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Mouse
Match: Rtl1 (retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:MGI:2656842])

HSP 1 Score: 84.3445 bits (207), Expect = 7.430e-16
Identity = 80/331 (24.17%), Postives = 145/331 (43.81%), Query Frame = 2
Query:  437 NQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKE-----EDKGKTAFSDGKGLYEFNVL-SFALTGAPATFQRGMNFVLRDIPHALVYID--DIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQ-QVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAAS 1402
            + +T +  Y   VP E+FD++  +  FT ++L  G  + +++      ED  + +F  G GL++      F +          ++F+L+DI    V     +++++S    EH + V  V  + R  N+     K ++ +     +G  IS KG++ N + +  I   P P +   ++  + L   YR F+++FA IA PL   L  +  + W + +Q   ++ K+    +P+L +P     F + TD +   L A L Q   E  K     + SR L   E  Y  +E   L +      + +YL   +        P+  L+   D AS
Sbjct:  898 DMLTDRQDYTQMVP-ELFDQLHGAAWFTKLEL-LGIKESEMRHTVTHTEDTWRASF--GFGLHQMRCYRPFTMNSYSDEGNNIVHFILKDILGLFVICHGREVLVYSMSQEEHSQHVRQVLVRFRYHNIYCSLDKTQFHRQTAEILGFNISPKGVKLNKNLMNLIVGCPVPGSRRCLQSVIDLVYPYRHFVENFAVIAAPLVRQLLSSEPYYWGEEEQEALESLKRAFRKSPVLYHPKPQNPFYLETDITGSFLSASLVQTDDETGKKSTCAFYSRPLSTMEVEYPRVEMRILPIRAAFMVWCRYLENTE-------EPIMILLNTEDLAS 1217          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Mouse
Match: Gin1 (gypsy retrotransposon integrase 1 [Source:MGI Symbol;Acc:MGI:2182036])

HSP 1 Score: 78.9518 bits (193), Expect = 1.668e-14
Identity = 69/277 (24.91%), Postives = 120/277 (43.32%), Query Frame = 2
Query: 1664 SELKQIIDERHKYVIHEGILKYIHYNELR---IVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLV---ERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLE 2476
            SE   I     K+V  E  L Y+  +  +   +VV  + +  +L + H+   G H    +TL+ ++  Y+W ++  DVK+W  +C+ C    NT   I  P +  P+   P  +  +D++GP   +   + Y I+  D  TKW     + +  A  +++  I NI F YG P+K++ DQ   F  ++   +  LF   ++  S    +  G V   E    T+   +S +       W   + +  F       E    TP++ M+   N  P  LE
Sbjct:   31 SERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVVVSEEEKKKVLRECHENGPGVHHGISRTLTLVESGYYWTSVTNDVKQWVYACQHCQVAKNT--VIVAPQQHLPMVGNPWSVVTVDLMGPFHTSNRSHVYAIIMTDLFTKWVMILPLCDVSASEISKAII-NIFFLYGPPQKIIMDQRDEFIEQINVELYRLFGAKEIVIS----RASGSVNPAENTPSTIKTFLSKHCADHPNSWDEHLPALSFAFNVTHLEPNKNTPYFQMF---NRNPCVLE 297          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|P20825|POL2_DROME (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 1.041e-109
Identity = 200/465 (43.01%), Postives = 284/465 (61.08%), Query Frame = 2
Query:  128 LSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXX-----XXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDI--PHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQ-NVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSR 1498
            L++E+      LL K++++       L   + I+H +     +PI  + Y +   H+ E + Q++ M    +IR+S SP++S                 R  +DYRKLN++T  D YPIP   E+  ++G+ Q FT IDL KG++Q ++ EE   KTAFS   G YE+  + F L  APATFQR MN +LR +   H LVY+DDIIIFS+   EH+  +++VF +L +ANLK++  KCE+ K E  ++GHI++  G++PNP  VK I +YP P     +R FLGL  YYRKFI ++A IA+P+T  LKK TK    + +    F+  K  +I +PIL+ PDF K F++ TDASN ALGAVL Q       H I++ SR+L  HE NYS IEKE LA+V+   TFR YL+GR+F++ +DH PL+WL   ++  +KL RW + L EY F+I Y  GK N+ ADALSR
Sbjct:  163 LNQEETFKLKGLLNKFRNLEYKEGEKLTFTNTIKHVLNTTHNSPIYSKQYPLAQTHEIEVENQVQEMLNQGLIRESNSPYNSPTWVVPKKPDASGANKYRVVIDYRKLNEITIPDRYPIPNMDEILGKLGKCQYFTTIDLAKGFHQIEMDEESISKTAFSTKSGHYEYLRMPFGLRNAPATFQRCMNNILRPLLNKHCLVYLDDIIIFSTSLTEHLNSIQLVFTKLADANLKLQLDKCEFLKKEANFLGHIVTPDGIKPNPIKVKAIVSYPIPTKDKEIRAFLGLTGYYRKFIPNYADIAKPMTSCLKKRTKIDTQKLEYIEAFEKLKALIIRDPILQLPDFEKKFVLTTDASNLALGAVLSQN-----GHPISFISRTLNDHELNYSAIEKELLAIVWATKTFRHYLLGRQFLIASDHQPLRWLHNLKEPGAKLERWRVRLSEYQFKIDYIKGKENSVADALSR 622          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|P04323|POL3_DROME (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 1.747e-109
Identity = 205/466 (43.99%), Postives = 282/466 (60.52%), Query Frame = 2
Query:  128 LSEEQIQIFTKLLIKYQDIFA*HEYD-LGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXX-----XXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDI--PHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQ-QNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSR 1498
            L+ E+ Q    LL KY DI   HE D L   +  +H I      P+  + Y  P A++ E + QI+ M    IIR S SP++S                 R  +DYRKLN++T  D +PIP   E+  ++G    FT IDL KG++Q ++  E   KTAFS   G YE+  + F L  APATFQR MN +LR +   H LVY+DDII+FS+  +EH++ + +VF++L +ANLK++  KCE+ K E T++GH+++  G++PNP+ ++ I+ YP P     ++ FLGL  YYRKFI +FA IA+P+T  LKK  K      +  + F   K  +  +PIL+ PDFTK F + TDAS+ ALGAVL Q       H ++Y SR+L  HE NYSTIEKE LA+V+   TFR YL+GR F + +DH PL WL + +D  SKL RW + L E+DF+IKY  GK N  ADALSR
Sbjct:  165 LNNEEKQRLCALLQKYHDI-QYHEGDKLTFTNQTKHTINTKHNLPLYSK-YSYPQAYEQEVESQIQDMLNQGIIRTSNSPYNSPIWVVPKKQDASGKQKFRIVIDYRKLNEITVGDRHPIPNMDEILGKLGRCNYFTTIDLAKGFHQIEMDPESVSKTAFSTKHGHYEYLRMPFGLKNAPATFQRCMNDILRPLLNKHCLVYLDDIIVFSTSLDEHLQSLGLVFEKLAKANLKLQLDKCEFLKQETTFLGHVLTPDGIKPNPEKIEAIQKYPIPTKPKEIKAFLGLTGYYRKFIPNFADIAKPMTKCLKKNMKIDTTNPEYDSAFKKLKYLISEDPILKVPDFTKKFTLTTDASDVALGAVLSQD-----GHPLSYISRTLNEHEINYSTIEKELLAIVWATKTFRHYLLGRHFEISSDHQPLSWLYRMKDPNSKLTRWRVKLSEFDFDIKYIKGKENCVADALSR 623          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|Q7LHG5|YI31B_YEAST (Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2)

HSP 1 Score: 333.569 bits (854), Expect = 3.212e-94
Identity = 227/756 (30.03%), Postives = 381/756 (50.40%), Query Frame = 2
Query:  263 KLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKD--HVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDE----------------ELKQIIRHTVI---------IQKDSELKQIIDERHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVL-GGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRY-----GAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPF 2431
            +L+PY +   ++ E ++ ++ + +   I  S SP SS +V+V KKDG  R CVDYR LN+ T  D +P+P    +  R+G +Q FT +DL+ GY+Q  ++ +D+ KTAF    G YE+ V+ F L  AP+TF R M    RD+    VY+DDI+IFS    EH K ++ V ++L+  NL +K  KC++   E  ++G+ I  + + P       I ++PTPK V   ++FLG+ +YYR+FI + + IAQP+ + +    K  W + Q    +  K  L  +P+L   +    + + TDAS   +GAVL ++V+ +     V+ Y S+SL+  +KNY   E E L ++  +  FR  L G+ F + TDH  L  L    + A ++ RW   L  YDF ++Y  G  N  ADA+SR                  I+ +       PE  R  + +                  +K++ +H V           QK  EL +    R  Y + + ++ Y    + R+VVP K ++A++  YHD  L GGH     TL+++   Y+W  ++  + ++  +C  C    +   ++   L+P PI        +MD V  LP T+N    I+V  D  +K   A+ +  +K     Q+   +++FRY     G P+ + +D+     ++ ++ +T+   I    +S  HPQTDG  ER   TL  ++ +YV+   ++W++++    FV+ +    + G++PF
Sbjct:  624 RLQPYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPIQLFI--CDKSQWTEKQDKAIEKLKAALCNSPVLVPFNNKANYRLTTDASKDGIGAVL-EEVDNKNKLVGVVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPARRVQRWLDDLATYDFTLEYLAGPKNVVADAISR-----------------AIYTI------TPETSRPIDTESWKSYYKSDPLCSAVLIHMKELTQHNVTPEDMSAFRSYQKKLELSETF--RKNYSLEDEMIYY----QDRLVVPIKQQNAVMRLYHDHTLFGGHFGVTVTLAKISPIYYWPKLQHSIIQYIRTCVQCQLIKSHRPRLHGLLQPLPIAEGRWLDISMDFVTGLPPTSNNLNMILVVVDRFSK--RAHFIATRKTLDATQLI--DLLFRYIFSYHGFPRTITSDRDVRMTADKYQELTKRLGIKSTMSSANHPQTDGQSERTIQTLNRLLRAYVSTNIQNWHVYLPQIEFVYNSTPTRTLGKSPF 1343          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|Q99315|YG31B_YEAST (Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3)

HSP 1 Score: 333.569 bits (854), Expect = 3.425e-94
Identity = 226/747 (30.25%), Postives = 379/747 (50.74%), Query Frame = 2
Query:  263 KLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKD--HVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDE-------ELKQIIRHTVI---------IQKDSELKQIIDERHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVL-GGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRY-----GAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPF 2431
            +L+PY +   ++ E ++ ++ + +   I  S SP SS +V+V KKDG  R CVDYR LN+ T  D +P+P    +  R+G +Q FT +DL+ GY+Q  ++ +D+ KTAF    G YE+ V+ F L  AP+TF R M    RD+    VY+DDI+IFS    EH K ++ V ++L+  NL +K  KC++   E  ++G+ I  + + P       I ++PTPK V   ++FLG+ +YYR+FI + + IAQP+ + +    K  W + Q    D  K  L  +P+L   +    + + TDAS   +GAVL ++V+ +     V+ Y S+SL+  +KNY   E E L ++  +  FR  L G+ F + TDH  L  L    + A ++ RW   L  YDF ++Y  G  N  ADA+SR                 TI        +   ++   + D         +K++ +H V           QK  EL +    R  Y + + ++ Y    + R+VVP K ++A++  YHD  L GGH     TL+++   Y+W  ++  + ++  +C  C    +   ++   L+P PI        +MD V  LP T+N    I+V  D  +K   A+ +  +K     Q+   +++FRY     G P+ + +D+     ++ ++ +T+   I    +S  HPQTDG  ER   TL  ++ +Y +   ++W++++    FV+ +    + G++PF
Sbjct:  598 RLQPYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPIQLFI--CDKSQWTEKQDKAIDKLKDALCNSPVLVPFNNKANYRLTTDASKDGIGAVL-EEVDNKNKLVGVVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPARRVQRWLDDLATYDFTLEYLAGPKNVVADAISRAVY--------------TITPETSRPIDTESWKSYYKSDPLCSAVLIHMKELTQHNVTPEDMSAFRSYQKKLELSETF--RKNYSLEDEMIYY----QDRLVVPIKQQNAVMRLYHDHTLFGGHFGVTVTLAKISPIYYWPKLQHSIIQYIRTCVQCQLIKSHRPRLHGLLQPLPIAEGRWLDISMDFVTGLPPTSNNLNMILVVVDRFSK--RAHFIATRKTLDATQLI--DLLFRYIFSYHGFPRTITSDRDVRMTADKYQELTKRLGIKSTMSSANHPQTDGQSERTIQTLNRLLRAYASTNIQNWHVYLPQIEFVYNSTPTRTLGKSPF 1317          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|P0CT39|TF26_SCHPO (Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-6 PE=3 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 9.963e-89
Identity = 229/764 (29.97%), Postives = 397/764 (51.96%), Query Frame = 2
Query:  224 IEHEIPLMDET-PIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDI--PHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVG--RKFIVYTDHNPLQWLMKHRDAAS--KLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIK-AANNVPEFQREQEMDEELK-QIIRHTVIIQKDSELKQIIDERHKYV-----IHEGILKYIHYNELRIVVPNKHR--DALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQK---AEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLN-----TSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMY 2443
            +E E+ L  E   + +R Y +P       + +I    +  IIR+S +  +  ++ V KK+G LR  VDY+ LN+  + + YP+P+ +++  ++  S  FT +DL   Y+  +V++ D+ K AF   +G++E+ V+ + ++ APA FQ  +N +L +    H + Y+DDI+I S   +EH+K V+ V ++L+ ANL I  +KCE+ +S+V ++G+ IS KG  P  +N+ K+  +  PKN   +RQFLG  +Y RKFI   + +  PL  LLKK  ++ W   Q    +  KQ L+  P+LR+ DF+K  ++ TDAS+ A+GAVL Q+ + +K + + Y S  +   + NYS  +KE LA++  +  +R YL      F + TDH  L   + +       +L RW L LQ+++FEI YR G +N  ADALSR              + D    + K + +N   F  +  + ++ K Q++        D++L  +++   K V     + +G+L  I+  + +I++PN  +    ++ +YH+     H       + +  ++ W+ + + ++++  +C  C    +   K   PL+P P    P E  +MD +  LPE++ G   + V  D  +K   A  +P  K   AE  A++F + +I  +G PK+++ D    F S+ +K        HK N     + PY PQTDG  ER N T+  ++    +     W   I      + NA++ +T  TPF +++
Sbjct:  400 LEFEVELTQENYRLPIRNYPLPPGKMQAMNDEINQGLKSGIIRESKAINACPVMFVPKKEGTLRMVVDYKPLNKYVKPNIYPLPLIEQLLAKIQGSTIFTKLDLKSAYHLIRVRKGDEHKLAFRCPRGVFEYLVMPYGISTAPAHFQYFINTILGEAKESHVVCYMDDILIHSKSESEHVKHVKDVLQKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFLGSVNYLRKFIPKTSQLTHPLNNLLKKDVRWKWTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQKHDDDKYYPVGYYSAKMSKAQLNYSVSDKEMLAIIKSLKHWRHYLESTIEPFKILTDHRNLIGRITNESEPENKRLARWQLFLQDFNFEINYRPGSANHIADALSR--------------IVDETEPIPKDSEDNSINFVNQISITDDFKNQVVTEYT---NDTKLLNLLNNEDKRVEENIQLKDGLL--INSKD-QILLPNDTQLTRTIIKKYHEEGKLIHPGIELLTNIILRRFTWKGIRKQIQEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPWESLSMDFITALPESS-GYNALFVVVDRFSKM--AILVPCTKSITAEQTARMFDQRVIAYFGNPKEIIADNDHIFTSQTWKDFA-----HKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCSTHPNTWVDHISLVQQSYNNAIHSATQMTPFEIVH 1135          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A355ABF2 (Uncharacterized protein OS=Flavobacteriaceae bacterium OX=1871037 GN=DDZ39_05755 PE=4 SV=1)

HSP 1 Score: 837.41 bits (2162), Expect = 0.000e+0
Identity = 428/831 (51.50%), Postives = 568/831 (68.35%), Query Frame = 2
Query:  128 LSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVP--EFQREQEMDEELKQIIRHTVIIQKDSELKQIIDERHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSPTSQYLDIPNYKVIMQERLQSAWIKAGLKIKYRQEQYKETYDK 2614
            L+ EQ Q    +  KY  +FA  ++DLG  +II+H IPL  + PIK RPY+  YA + E  +Q++ MK   +IR+SFSP++S IV+VKKKDG +RFCVDYRKLN VTRKDTYP+P   EM D++  S+ FT +DL  GY Q ++ EEDK KTAF+ G+GLYEFNVL F LTGAPATFQR M+ +L D  HA+VYIDDI+I+S  F+EH+ D+ MV ++L  A LKIKP KCEW KS VT++GH++S +G++P+P NV+KI+N+  P  V  +++FLG+A YYRKFI +FA IA PL  L KK    +W +  Q  F+  K +LI  P+LR+PD  K F++MTDAS  A+GAVLGQ+ E  KDHVI YASR LK HE NYS IEKE LA+VY +  F  Y+  RK I+YTD  PLQWLM H+D++S+LIRWSL LQEYD +IKYR GK+NA AD LSR              + + +  ++    N    E  + Q  D+ L  II  T  IQ +S          +Y +   ILKY+  N++  V+P+K ++ ++ +YHDG +GGHLSA+KT+S +  +Y+W+ ++ DVK+WC +C ICL R       +  LKP   P+ PME  AMDI+GPLPETT GNKYI+VF DY TKWPEA A+P+QKA+ +A++FIE+IIF+YGAP KL+TDQGTNF SE+   + E F I K  TS YHPQ+DGLVERFN TL  M+S+Y N +Q DW  +I  CLF +RN V+EST +TPF+LM+L+   +PIDL      + Y+D  NY   M+E+L+  W  A L + + QE YKE YD+
Sbjct: 1308 LNNEQNQAMENIFQKYSKVFATDDFDLGKTNIIKHFIPLDKDNPIKQRPYKAAYALKGEIKKQVEDMKHNKVIRNSFSPWASPIVMVKKKDGTMRFCVDYRKLNTVTRKDTYPLPRIDEMLDKLNNSKFFTSLDLQSGYWQIEISEEDKYKTAFTTGEGLYEFNVLPFGLTGAPATFQRCMSHILMDASHAMVYIDDILIYSIDFDEHLHDITMVLQRLELAGLKIKPRKCEWAKSMVTFLGHLVSSEGIKPDPKNVEKIKNFEKPVKVKGIQRFLGMAGYYRKFIPNFAKIASPLFDLTKKNDNTLWTEKHQESFEELKNRLIHFPVLRFPDMNKDFIIMTDASGYAIGAVLGQKDEMLKDHVIAYASRILKSHEVNYSVIEKEALAIVYSVKQFHHYIWSRKIILYTDQRPLQWLMTHKDSSSRLIRWSLLLQEYDIDIKYRQGKANANADFLSR--------------MDEPVQCMVSMLANFDKNELLQAQRADKGLFYIIEDTANIQNNSFANP------RYELQSRILKYVTGNKVLTVIPDKLQEKIIKEYHDGPMGGHLSAKKTISAIGNRYYWKNLKDDVKEWCKTCNICLRRKGRAPS-RALLKPISSPSTPMETTAMDIMGPLPETTKGNKYILVFSDYFTKWPEAKALPDQKAQTIAKVFIEDIIFKYGAPSKLITDQGTNFLSEVMSEVNEFFKIDKHTTSAYHPQSDGLVERFNRTLEQMLSAYTNERQTDWDEYIAPCLFAYRNTVHESTKQTPFFLMFLREPKLPIDLTLVETKTCYMDEYNYVQDMKEKLKDVWTTAKLNMNFYQESYKEYYDR 2117          

HSP 2 Score: 65.0846 bits (157), Expect = 1.175e-6
Identity = 31/74 (41.89%), Postives = 47/74 (63.51%), Query Frame = 1
Query: 2632 GITIGDLVYLNRPEPVKGLSTKLQRPFKGPYIVCDSTATNLKLRPINNKRAETIVVHSNRCKKIPKSE-YPLRS 2850
               +GD V L+ P   KGL+ KL +P+ GPY V + T  NLK++    ++A+ ++VH NRC+K   S+ YPLR+
Sbjct: 2123 SFMVGDFVLLHTPLHEKGLTNKLYKPYDGPYKVIEVTPQNLKIQNTKKRQAKIMIVHKNRCRKFHASDRYPLRN 2196          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A147BAZ1 (Putative retrovirus-related pol polyprotein from transposon (Fragment) OS=Ixodes ricinus OX=34613 PE=4 SV=1)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 334/828 (40.34%), Postives = 488/828 (58.94%), Query Frame = 2
Query:  161 LLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDI--PHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQR-----EQEMDEELKQIIRHTVIIQKDSELKQIIDERHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSPTSQYLDIPNYKVIMQERLQSAWIKAGLKIKYRQEQYKETYDKKAR 2623
            LL  Y  +FA  + DLG   +I+H I    + P+  R YRIPY+ +DE  +QI+ ++E  I+  S SP+ +  ++V+K DG  R  VDYR+LN VTR D YPIP  QE   ++G ++ F+V+DL  G+ Q ++   DK KTAF+   G YE+N +   L  +PA +QR  + +L  +      VY+DDI+I+S  F+ H++D+E V K+LR A LK+KPSKC++ +SEV Y+GHI+S  G++P+P+  + I N+P P  V  +R+FLGL  YYR+FI +FA IA+PLT L  K   F W  +++  +   +  L+  P+L YPDF   F++ TDAS  ALGAVL  QV+   +  + +ASR L   E NYS  EKE LA+++    FR YL GR+F + TD  PL+WLM  RD  S+L RW+L LQEYD+EI ++ G  +  ADALSR               RD    +    + VP F+      EQE D EL++I     +   DS+ +    +R   +   G  +       R V+P    + +L  YH+    GH   +KTL ++  KY WR M +DVK +C SC+ C  R  +G++ + PL+       P E  A+DIVGPLP TT GNKY++VF D+ TK+ EA  + +QKAE VA+ F+E I+ R+G P++LLTDQGTNF S L K    L  + KL T+ YHP+++G VER N T+  ++S  V R QRDW L++   LF +  AV+EST ETPFYL + +   +P ++       +Y  + +Y+  +  R+++A    G  ++  Q   K  YD+K +
Sbjct:  211 LLNGYSAVFARSKLDLGRCDVIKHRINTTSDAPVYQRAYRIPYSQRDEMAKQIRDLEEEGIVEPSKSPWGAPALLVEKPDGSSRLVVDYRRLNAVTRVDPYPIPDIQETLAQLGSARYFSVVDLAAGFWQIEMDPRDKNKTAFNTPSGHYEWNRMPMGLVNSPAVWQRTADVILEGLIGQSCHVYMDDIVIYSRDFDSHLRDIERVLKRLRAAGLKLKPSKCQFLRSEVKYLGHIVSADGVRPDPEKEEAIRNFPRPTKVREIREFLGLVGYYRRFIDNFAKIAKPLTTLTSKYATFRWGDSEEGAYCKLRDMLLTAPVLGYPDFGSPFILATDASQYALGAVL-SQVKNGIERPMAFASRQLNKAEVNYSATEKECLAVIWATRHFRCYLYGRRFKIITDCRPLRWLMNVRDPGSRLARWNLQLQEYDYEIIHKPGSGHTNADALSRA--------------RDPPSTVGAVLSFVPVFEDGTIKDEQERDPELRKISDR--LAGNDSDDQGYFRDRMGLLRKGGPGQREGRARERTVIPKSLVEKVLYAYHNAPYSGHFGFKKTLRKITAKYVWRGMHRDVKSYCASCESCQLR-KSGQRRRAPLELFGEVKEPFERTALDIVGPLPITTEGNKYVLVFVDHFTKFAEALPLRDQKAETVARAFVERIVLRHGVPQQLLTDQGTNFVSGLMKETCRLLGVKKLTTTAYHPESNGAVERLNKTIKGLLSHLVARDQRDWDLWMPYVLFSYNTAVHESTEETPFYLCHGRDPGLPHEILDAPSVPKYACLEDYRAELTLRMRAAHEVTGEALRKSQACRKTQYDRKTK 1020          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A0V0X0B7 (Transposon Ty3-G Gag-Pol polyprotein OS=Trichinella sp. T6 OX=92179 GN=TY3B-G PE=4 SV=1)

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 315/808 (38.99%), Postives = 475/808 (58.79%), Query Frame = 2
Query:  113 ITSKELSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIP--HALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFAL-IKAANNVPEFQREQEMDEELKQIIRHT-------VIIQKDSELKQIIDERHKYVIHEGIL----KYIHYNELRI--VVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSP 2488
            +   E S +  +    L+ +Y    +  E DLG  S+++H I      P+KL P R+P A ++  DR I+ M    +I  +  P+SS +V+V+KKDG  RFCVDYR+LN VTR D  PIP   +  D +  ++ F+ +DL  GY Q +V EED+ KTAFS   GL++F V+ F L  APATFQR M   LR +     LVY+DDII+F     EH++ +E V  +L+   LKIKP KC+  +  V Y+GH+++++G+  +P+    ++ +PTP+ V  VRQFLGLASYYR+F+++FA +A PL  L KK  K+ W   ++  F   K+ L+  PIL +PDF +TF++  DAS  A+GAVL QQ   +   VI YASRSL   E+ Y    +E LALV+    FR YL GR+FI  TDHN L+WL   R+   ++ RW   L E+DFE+ +R G+ +  ADALSR    +        ++   + A+ + AAN + ++   QE D+EL+QI   +          +    L+ +  +R + V+ EG +    +     E R+  V+P +    +L   H+G  GGHL   KTL++++ +Y+W    +DV+ WC +C+ C  R+   KK + P++       P +   MD+VGPL ET NGN+YI+V CDY +KWPEA+A+PN +A  VA   ++ +  RYGAP+ L +DQG NF+S L K + +LF + K  T+ YHPQ+DGLVER N TL+++++        DW   +   L  +R++V+ +TG TP  +++ +   +P+DL +  P
Sbjct:  510 VDRAECSAQNRRTLRSLIRRYGKAISCGEGDLGRTSLVQHRIETGGAQPVKLPPRRLPQAQRETVDRLIREMLHAGVIEPASGPWSSPVVLVQKKDGSPRFCVDYRRLNAVTRVDAQPIPRIDDTLDALAGAKWFSTLDLASGYWQVEVAEEDREKTAFSTPLGLFQFRVMPFGLCNAPATFQRLMEKALRGLTWKTCLVYLDDIIVFGKTEEEHLERLEGVLSRLQSVGLKIKPEKCQLMRQSVHYLGHVVTQQGIGTDPEKTAAVQKWPTPRCVREVRQFLGLASYYRRFVRNFAGVANPLHALTKKGEKWHWGPKEEEAFTLLKKALVSPPILGHPDFDRTFLLDVDASEDAVGAVLSQQGGQDPPSVIAYASRSLSRAERGYCATRREMLALVWATQHFRPYLYGRRFIARTDHNSLRWLRNFREPEGQVARWLERLAEFDFEVVHRAGRKHQNADALSRRVCKQCGLEGSTAEV--PVGAVRLDAANPIKQW---QESDKELQQIREWSTQRTWPRAAPEGSRLLRSLWAQRDRIVVREGTICRKWETPDTGETRLLQVIPRQRIPEILAAVHNGQSGGHLGVAKTLAKVRQRYYWPQQREDVEDWCRACETCAARAVPTKKPQAPMQ-LQPVGYPFQRVGMDLVGPLEETRNGNRYILVVCDYFSKWPEAFALPNAEARTVAAALVDGLFCRYGAPETLHSDQGRNFESALVKEVCQLFGVAKTRTTAYHPQSDGLVERMNRTLLDLLAKASIDHPDDWDAHLNRVLLAYRSSVHHTTGATPSRIIFGREMRLPVDLVYGLP 1311          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A4Y2GV68 (Transposon Ty3-I Gag-Pol polyprotein OS=Araneus ventricosus OX=182803 GN=TY3B-I_1030 PE=4 SV=1)

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 329/849 (38.75%), Postives = 496/849 (58.42%), Query Frame = 2
Query:  128 LSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPH--ALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDEELKQIIRHTVIIQKDSELKQIIDERHKYVIHEGILKYIHYNE----------------LRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSPTSQYLDIPNYKVIMQERLQSAWIKAGLKIKYRQEQYKETYDKKA 2620
            L+EEQ     +LL ++Q++F+  + D+G  ++ +H I   +  PIK  P R+P A ++E++R +K M +  II +S  P++S IV+VKKKDG  RFCVDYRKLN++T KD+YP+P   +  D +  SQ F+ +DL  GY Q +++ EDK KTAF+ G+GL++F V+ F L  APATF+R M  VLR +     LVY+DDIII    F EH+ ++  VF++L++ANLK+ P KC + + EV+Y+GHIIS  G++ +P+  K + ++P P+ V ++R FLGL +YYR+F+++F+ IA+PL  L +  T F W +  +  F++ KQ LI +P+L YP   K F++ TDASN  +GAVL Q++ G ++ VI Y S+SL   E+NY    KE LA+V  I  F  YL GRKF++ TDH  L+WL+  R+   ++ RW   LQEYDFEI++R G S+  ADALSR                   F   + A +  E Q+ Q  D  +K I+   +  +     ++I  E      +  +   +H  +                 ++++P      +L + HD   GGH    KTLS+ + +++W  +  DV+KWC  C  C  R     + K  L+      AP E  A+DI+GPLP TT GN+Y++V  DY TKWPEA  +P+Q+A  VA+  +   I RYG P  L +DQGTNF S LF  + +L  I K  T+  HP++DG+VERFN T++N +S +V++ Q DW   +   L  +R+A +E+TG TP  +++ +   +P D+ F  P+        Y   ++ RL+S    A  +IK   E+ K  YD  A
Sbjct:  660 LNEEQRTAVKELLQEFQNLFSTSDSDVGRCNMTQHRINTGNHPPIKQYPRRLPRAKKEEAERLVKEMVDNGIIEESSGPWASPIVLVKKKDGSTRFCVDYRKLNEITIKDSYPLPRIDDTLDALNGSQWFSTLDLKSGYWQVEIQPEDKEKTAFTTGQGLWQFKVMPFGLCNAPATFERLMETVLRGLTSEACLVYLDDIIIVGRTFQEHINNIRKVFQRLQKANLKLSPKKCRFFRKEVSYLGHIISADGVKTDPEKTKAVVDWPRPETVHDLRSFLGLCTYYRRFVRNFSAIARPLHKLTEARTNFNWTEECEKSFNSLKQALITSPVLTYPRTDKEFILDTDASNEGIGAVLSQKI-GNEECVIAYFSKSLGKPERNYCVTRKELLAIVKSIEHFHHYLYGRKFLLRTDHASLRWLLNFREPEGQIARWIQRLQEYDFEIQHRKGTSHGNADALSRRP-----------------FLTTEDAWSSSEVQKAQLEDPAIKPILERKLNSEDRPSWQEIAPESPATKRYWALWDSLHLKDGVLYRKWESDDGSSCRWQLILPKSRIQEVLRETHDSASGGHFGVMKTLSKTRERFYWDRLRADVEKWCRECHACGARKGPKTRTKGRLQ-RYNVGAPFERMALDILGPLPVTTKGNRYVLVLMDYFTKWPEAIPIPDQEASTVAEELVRAWISRYGVPMILHSDQGTNFNSALFTELCKLLGILKTRTTALHPESDGMVERFNRTILNHLSLFVSKNQTDWDTHLPLFLLAYRSADHEATGCTPADMLFGRTLRLPCDILFGRPSDTPSSPNEYLNNLEARLESVHAFARERIKLASERMKTRYDSGA 1489          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A1Y1KUJ8 (Uncharacterized protein (Fragment) OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 327/821 (39.83%), Postives = 490/821 (59.68%), Query Frame = 2
Query:  125 ELSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIP--HALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEF-----QREQEMDEELKQII---RHTV------IIQKDSELKQIIDERHKYVIHEGILKYIHYNE------LRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEF-QSPTSQYLDIPNY 2518
            +L   Q Q    +L++++D+FA ++ D G  SI+ H+I   +  PI+ +P R+P A +DE++  I+ M++  +I  S SP+SS IV+VKKKDG  RFCVDYR LN VT+KD+YP+P   +  D +  +Q F+ +DL  GY Q  ++  D+ KTAFS G GL++F V+ F L  APATF+R M  VLR +     LVY+DD+I+    F EH+K++  VF +LREANLK+ P KC   + EV Y+GHI+SR G+  +P+ +  I+ +P P+N   +R FLGL +YYR+F+K FA+IA+PL  L ++  ++ W +  Q  F+  +Q L   PIL YP     F++ TDASN A+GAVL Q  +G+ + VI Y S+ L   E+NY    +E L +V     F +YL GRKF++ TDH  L+WL++ R+   ++ RW   LQEYD++I++R GK +  ADALSR      +N     K+ D I  L +      E+     +  QE D  +K ++   RH        I     E+K    + +   + + +L     +E      L++VVP      +L + HDG  GGH    KTL R++ +++W   ++DV++WC  C++C T +    K K P++      +PME  A+DI GP PET  GNKYI+V  DY TKW EAYA+PNQ+A  VA++ ++    R+G P ++ +DQG NF+S LF+ +  L   +K  T+P HPQ+DG+VER N T+   +S  V   Q++W  ++   L  +R+AVNE+TG+TP  LM  +   +P DLEF + P  +Y+   NY
Sbjct:  623 DLDNRQRQKVKNMLVEFRDVFAVNDQDKGKTSIVTHKINTGNSQPIRQQPRRLPLAKRDEAEEIIRDMRKQGVIEPSNSPWSSPIVLVKKKDGSTRFCVDYRLLNSVTKKDSYPLPRIDDTLDTLSGAQWFSTLDLKSGYWQVGMESTDREKTAFSIGSGLWQFTVMPFGLCNAPATFERLMEAVLRGLTWQTCLVYLDDVIVVGKTFEEHLKNLREVFGRLREANLKLSPKKCFMFQKEVKYLGHIVSRDGVTADPEKIIAIQEWPIPENKHEIRSFLGLCTYYRRFVKGFANIAKPLIKLTEEGNEYEWSEDCQRAFEHLRQALTSAPILGYPRNEGKFVLDTDASNTAIGAVLSQLQDGQ-ERVIAYFSKVLSKPERNYCVTRRELLGVVKACEHFHKYLYGRKFLIRTDHAALKWLLQFRNPEGQVARWLERLQEYDYDIEHRAGKVHNNADALSR--RPCKDNCTHCSKIEDKIGHLRRTTVESEEWKPSEIKTAQENDPSIKTVLNWMRHGQRPDWQDISATSPEVKSYWGQWNSLTLKDNLLYRTLESEDGTESTLQLVVPRSKVSEVLRKLHDGASGGHFGITKTLQRVRERFYWVNRKEDVRRWCQKCELCATGNGPVSKKKAPMR-QYNVGSPMERVAIDIAGPFPETDGGNKYILVAMDYFTKWTEAYAIPNQEAATVAEVLVKEFFTRFGVPIEIHSDQGRNFESALFQDVCRLVGANKTRTTPLHPQSDGMVERMNRTMGKYLSKVVAEHQKNWDQYLHLFLMAYRSAVNETTGQTPACLMLGRELRLPCDLEFGRKPHEEYVAGENY 1439          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000042253.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000503.1:15658:18693:-1 gene:ENSAMXG00000039114.1 transcript:ENSAMXT00000042253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 503.442 bits (1295), Expect = 9.206e-161
Identity = 285/867 (32.87%), Postives = 450/867 (51.90%), Query Frame = 2
Query:  128 LSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDE--TPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPHA--LVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALS-------------RXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDEELKQIIRHTV----------IIQKDSELKQIIDERHKYVIHEGILKYIHYNE------LRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSPTSQYLDIPNYKVIMQERLQSAWIKAGLKIKYRQ---EQYKETYDKKA 2620
            LSE Q      L+ +++  FA  E +    S+  H I   D   +  +    R+ +A +  +++ ++ M    +I  S SP+S+ +V+ KKKDG  RFCVDYR+LN VT+ D+YP+P   +  D++  S  F+ +DL  GY Q  + E D+ KTAFS G  L+ F VL F L  +PATF+R M  VL  IP +  +VY+DD++   + F+  +  +E+V   ++ ANLK+ P+KC   +  V ++GH++S  G++ +P   + + ++P P+N   VR F+GLASYYR+FI+ F  +    + L +    F W    +  F   K +L   P+L Y +  +  + +  AS+  LGAVL  QV+   + VI Y SR L   E+NY    +E LA+V G+  FR Y+ G  F++ TDH  LQWLM+ R+   +L RW   +QE+ FE+ +R G+S+  ADALS             R                D    ++ A  +V + +  Q  D +L   + H +          ++      K +      + + +G+L ++  +        R+V+P   RD++L   H     GH    KTL RL+ +++W     DV+ +   C +C  +    +  + PL        PME  A+D++GP P T +GN+Y++V  DY TKWPEAYA+P+Q A   A + +     R+G P++L +DQG NF+SE+   +  +  IHK  T+P HPQ+DGLVERFN TL   ++   ++ QRDW   +   L   R+AV E+TG TP  LM+ +    P+ L F +P     D  +    + + L S     GL    +    ++ K  YD + 
Sbjct:   95 LSEPQQLRLRDLIERFRASFAVSERECTRTSLAFHSINTGDAQTSGWQTAAARLAFAKRVAAEQLVRDMASAGVIEPSSSPWSAPVVLAKKKDGNWRFCVDYRRLNAVTKLDSYPLPRIDDTLDQLSGSAWFSSLDLRSGYWQVPLAEGDREKTAFSLGSALWHFTVLPFGLCNSPATFERLMERVLSGIPRSCCVVYLDDVMAHGTDFDSALSHLEVVLGAIQAANLKLNPAKCNLLRQRVNFLGHVVSGAGVETDPKKTEAVRDWPVPRNAKMVRSFVGLASYYRRFIRGFRDVGGNASHLTRPGVTFRWSDEAERAFGELKSRLCNAPVLAYRNVREASLWIRIASDRGLGAVL-SQVQDGSERVIAYYSRRLDKAERNYCVTCRELLAVVEGLKHFRPYVYGVPFLLRTDHASLQWLMRFREPEGQLARWISRIQEFSFEVVHRPGRSHGNADALSRRPCVAVDCKHCARAEEKSAETAHCAAVSADVTGGVVVAQVSVEQIRDAQRADRDLMWAV-HALEANVTPSWEEVVPLGPVAKALRSNWASFSLSDGVLCHVWEDPANGQRVFRVVIPRALRDSVLRGVHGSPGAGHFGVTKTLKRLRQRFYWPGCRTDVELFVHCCDVCAAKKGPARAPRAPLH-PYQCGGPMERVAVDVLGPFPVTDSGNRYVLVAMDYFTKWPEAYAVPDQGAVTTADVLVREFFCRFGVPEELHSDQGRNFESEVMAEVCRILGIHKTRTTPLHPQSDGLVERFNCTLAAQLAMVSSKGQRDWDKHLPVVLLACRSAVQETTGFTPALLMFGRELRTPVALAFGAPPDGGEDAKDTPAFVSDLLSSLDFAHGLARSNQSAAGQKQKRAYDTRC 958          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000034038.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:3120146:3124090:1 gene:ENSAMXG00000040885.1 transcript:ENSAMXT00000034038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 499.204 bits (1284), Expect = 4.092e-156
Identity = 305/905 (33.70%), Postives = 479/905 (52.93%), Query Frame = 2
Query:  131 SEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYR-IPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDI--PHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTK---------------FVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGIT-TFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAE------------ADALSRXXXXXXXXXXXXXKLR-DTIFALIKAANNVPEFQREQEMDEEL-----------KQIIR-----------------------HTVIIQKDSELKQIIDERHKYVIHEGILKYIHYNE------LRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQ-SPTSQYLDIPNYKVIMQERLQSAWIKAGLKIKYRQEQYKETYDKKARM 2626
            +E Q    T  ++K  D+F+ H  D G  ++++HEIPL+D  P +L PYR IP +      + I  M+E  +IR S SP++S IVVV KKDG LR C+DYRKLN  + +D +P+P  +E  + +GE++ F+ +DL  GY Q +V E DK KTAFS   GL+E N + F L  +P+TFQR M     D+     L+Y+DDI+IFS  F+EH++ ++MVF +LR+  LK+KP KC   + EV Y+GH++S  G++ +PD + K+  +  P+N   + QFLG A YYR+FI+ +A IA PL  L     +               F+W +  +N F T K KL   P+L Y D+++ F++ TDAS   LGAVL Q  +G ++ VI YASR L P E  Y   + E LAL + +T  F  +L G KF V TD+NPL+++M      +   RW   L  +DF+I+YR G  NA             A+AL         +++++ + + D+    +   ++     +E   D+ L           KQ IR                        +   Q + + K +  E  K V+ + IL + H  +       ++V+P K R  +    HD    GH    +T + ++ +++W  M  DVK WC  C+ C  R      ++ PL      A    I    +   + ++  G + I+V  D+ ++W +AY   +QKAE VA++  +N   ++G P KL  DQG NF+S + K +  L    K +TSPYHPQ +G  ERFN TL+N++ +   + +  W+ +I +    +    ++STG TP+YLM+ +   +PIDL F  +P + Y +  +Y   + + L+ A  +A L  ++ ++  K+ YD KA++
Sbjct:  196 TENQYLQMTDKILKNSDVFSKHHLDYGHTTVVKHEIPLVDPRPFRL-PYRKIPPSQYQAVRKAITEMEEAGVIRPSKSPYASPIVVVTKKDGSLRICMDYRKLNSCSTRDAFPLPRVEEALEALGEAKYFSTLDLTSGYWQVEVAEADKHKTAFSTPMGLFEANRMPFGLQNSPSTFQRLMTCCFGDLNFESLLIYLDDIVIFSRTFDEHLERLQMVFDRLRKYGLKLKPQKCHLLRREVLYLGHVVSSDGIKTDPDKISKVAGWKVPENRHELLQFLGFAGYYRRFIEGYASIAAPLYRLTSGDPRKKKRGRKGPPAVGLPFIWTEECENAFQTLKTKLTTAPVLGYADYSQPFVLQTDASLAGLGAVLAQVQDG-RERVIAYASRGLNPAETRYPAHKLEFLALKWAVTDKFYDHLYGHKFSVLTDNNPLKYVMTTAKLDATGQRWVAQLSMFDFDIRYRQGGCNANADGLSRMPASEVAEALHTCPQLVPTSSQKQSQEKGDSAERAVDGTSSESGSNKEPSADQFLSAGSDALPSMSKQEIRAAQRTDPVIGPVLYYKCQYAKPKRSARTQSNEQEKLLRKEWKKLVVKDDIL-FRHVRDRQRGSFYQLVLPEKFRGYVKSSLHDE--SGHFGVERTFALVRERFYWPRMFNDVKTWCEQCERCCLRKTPTAGLRAPLVSIHTNAPLELICIDFLT--VEKSKGGFENILVVTDHFSRWAQAYPTKDQKAETVAKVLWKNFFCKFGFPAKLHADQGRNFESTVVKELCRLTGTQKSHTSPYHPQGNGTTERFNRTLMNLMGTLPPQSKARWHEYIDALTHAYNCTRHDSTGYTPYYLMFGRHPRLPIDLVFGLAPATDYCEHSDYAKTLHDSLKYACEQANLTSRHSKDTQKKHYDVKAKV 1093          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000041682.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002320.1:24977:29035:1 gene:ENSAMXG00000038531.1 transcript:ENSAMXT00000041682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 498.819 bits (1283), Expect = 1.030e-155
Identity = 293/825 (35.52%), Postives = 468/825 (56.73%), Query Frame = 2
Query:  128 LSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRD--IPHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLK-----------KTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEK---NYSTIEKETLALVYGITT-FRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIF-------ALIKAANNVP-----EFQREQEMDEELKQIIRH---------TVIIQKDSELKQIIDERHKYVIHEGILKYIHYNE------LRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPID 2470
            L+ EQ Q+   LL +Y  +F+  E +LG   +IEHEIPL+D+TP+K R  R+P +  D     I+ + +  +IR S SP+SS +VVV+K+DG +R CVDYR+LN  TRKD YP+P  +E  D +G ++ F+ +DL  GYNQ  + E DK KTAF    GL+EFN + F L  AP+TFQR M  +  D      L+Y+DDI+IFSS F+ H++ +E+V K+L++ NLK+K SKC + +S+V Y+GH+IS  G+  +P+ +K +  +  P+ V  +R FLG ASYYR+F++ FA  A PL  L+            K  +  W  A +  F+T K KL+  P+L Y DF+K F++  DAS+  LGAVL Q  EG +   I YASR L+  E+   NYS+++ E L L + +T  FR+YL+G +F VYTD+NPL +L   +  A +  RW   L  ++F IKYR G SN  ADALSR+ +     + +E     +I        A I   + VP     + QR Q  D  +   +++             Q+  E+ +++ + +K    +G+L  +          L++V+P   +  +L   HD    GH  A +T S ++ + FW  M + +++WC  C  C+       KI+  +           IA    +  +   ++G + ++V  D  +K+ +A+   +Q+A  VA I +E   + YG P+++ +DQG NF+S+L KS+ +++ + K  T+PYHPQ +G  ERFN T+ +++ +  + ++R W  ++   LF +   V+++T  +P+ LM+ ++  +P+D
Sbjct:  281 LTPEQSQLGKDLLQRYSSVFSQDEGELGCTHLIEHEIPLIDDTPVKQRYRRLPPSQYDLVKGHIQELLDRKVIRASCSPYSSPVVVVQKRDGTIRLCVDYRQLNSKTRKDAYPLPRIEESLDALGGARFFSTLDLASGYNQVPMAEHDKSKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERIFGDERFQSLLLYLDDIVIFSSTFDLHLQRLEVVLKRLQQNNLKLKLSKCHFFQSQVKYLGHVISSAGVATDPEKIKAVSEWERPQTVTQLRSFLGFASYYRRFVEGFAKHASPLHRLVAVLQGGKRRVKTKPVEGHWSDACEEAFETLKLKLVSAPVLGYADFSKPFILEIDASHGGLGAVLSQDQEGGR-RPIAYASRGLRDSERNMSNYSSMKLELLGLKWAVTEKFREYLLGAQFTVYTDNNPLSYLQTAKLGAVEQ-RWVSQLALFNFNIKYRPGLSNRNADALSRLPACPTPQSFQETVSGISIPLQVGATKATISTIDAVPLRPKADLQRLQSADPVIGPFLQYWHRQKFPTAGERAQESKEVLELVRQWNKLRECDGVLYRLTRTPDGVEEFLQLVLPECLQKEVLTALHDN--HGHQGAERTASLVRQRCFWPHMWKKIERWCKECSRCVVAKMGQPKIRTFMGNLSASKPLEIIAIDFTL--MDRASDGRENVLVITDVFSKFTQAFPTQDQRASTVAHILVEKWFYVYGVPQRIHSDQGRNFESDLLKSLCKIYDVKKSRTTPYHPQGNGQCERFNRTMHDLLRTLPSEQKRRWPKYLPQLLFAYNTTVHQTTAHSPYELMFGRQPRLPVD 1099          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000048059.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001896.1:45492:48938:1 gene:ENSAMXG00000034382.1 transcript:ENSAMXT00000048059.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 488.419 bits (1256), Expect = 1.115e-153
Identity = 312/900 (34.67%), Postives = 479/900 (53.22%), Query Frame = 2
Query:  125 ELSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPHA--LVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLL-----KKT------TKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEK---NYSTIEKETLALVYGIT-TFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIF---------------ALIKAANNVPE---------------FQREQEMDEELKQIIRHTVIIQKDSELK------------QIIDERHKYVIHEGIL------KYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSPTSQYLDIPNYKVIMQERLQSAWIKAGLKIKYRQEQYKETYDKKARMS 2629
            +LS EQ +    LL K+Q +F+ HE D G    I HEIP  D  PI+ R  +IP     E    IK M + +II+ S SP+SS IV+V+KKDG +RFCVDYR+LNQVTRKD+YP+P  +E    + +++ ++ +DL  GY Q K+ ++D  KTAF+   GL+EF  + F L  APA+FQR M   L D  +   L+Y+DD+I+F++ FN H+  ++ VF +L +  LK+KP KC+  +S V Y+GH++S  G+ P+PD V  ++ +  PK++  +R FLGLA YYR+F+K F+ IA PL  LL     KK+        + W    +  F++ KQ L+  P+L + DFT  F++ TDAS+  LGAVL Q+ +G+ + VI YASR L+  E+   NYS+ + E LAL + IT  F +YL+G  F VYTD+NPL  L   R  A +  RW   L  Y F++K+R+GKSN  AD LSR         E++  +    F                L  +   VP+                +R  E+ ++   I R   + Q    L+            +++ E  +  + EG+L         +    ++++P   +       HD +  GH +  KTL  L++ Y+W  M  DV+KWC  C+ C  R   G    V L      + P+E+  MD +  L     G + I+V  D+ TK+  A A  +Q A    ++  + +I  +G P    +DQG NF++ + K + EL+   K +T+PYHP+ +GL ERFN TL+ M+ + V+ K++ W  ++   L  + N V+ STG TP YLM+ +    P+D+    P  +   +  +     ERL  A+ + G       +  K+ +DK+  + 
Sbjct:   96 QLSVEQKEKLATLLTKHQSVFSQHEEDYGCTETILHEIPTGDAAPIRQRYRQIPPNLYGEVKTLIKQMLDADIIKPSSSPWSSPIVLVRKKDGSIRFCVDYRQLNQVTRKDSYPLPRVEEALASLKKARWYSTLDLASGYWQVKMHQKDMDKTAFTTPMGLFEFQRMPFGLCNAPASFQRLMESCLGDQNYQSLLIYLDDVIVFAADFNSHLDRLDFVFSRLSQQGLKLKPDKCKLLRSSVQYLGHVVSDAGIAPDPDKVMAVQQWRVPKSITELRAFLGLAGYYRRFVKGFSQIAAPLHRLLGGHPTKKSKAKALCPPWKWSNECETAFESLKQGLVQAPVLAFADFTLPFLLYTDASHRGLGAVLSQKQDGQ-EKVIAYASRGLQGAERNDANYSSFKLELLALKWAITEKFHEYLLGSDFTVYTDNNPLAHLATARLGAVEQ-RWVARLASYRFQVKHRSGKSNVNADVLSRYPVGAAVVPEDDDGMEVPGFQEVTVEVVQACLSGSCLAASIGPVPDQPQPSGGSRIGQDWTMERWAEVQQQDPVISRVLYVFQTKRPLRWDERQWEAPNVLRLLKEMPRLQLQEGVLYRCIQDPNTNMPRYQLLLPQSLQKEAFTCCHDKM--GHFATEKTLKTLQINYYWPHMAIDVQKWCSECQQCTLRKRPGTS-AVGL-TPVAASYPLELVTMDFLS-LEAAVGGFQNIMVLTDHFTKFAWAAATRDQTAATTVRVMWQQVIQYFGCPSLFHSDQGPNFEAAVVKQLCELYGCKKSHTTPYHPEGNGLTERFNRTLLGMLGTLVDEKKQRWADYLPEMLHAYNNTVHSSTGYTPSYLMFGRHARTPLDVMLGHPVEEQSTVEEWVRRHHERLCYAYKRVGELTGRAGQHQKKQHDKRGLLG 988          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000045469.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000976.1:426503:430633:1 gene:ENSAMXG00000030479.1 transcript:ENSAMXT00000045469.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 489.189 bits (1258), Expect = 7.982e-152
Identity = 289/852 (33.92%), Postives = 465/852 (54.58%), Query Frame = 2
Query:  110 QITSKELSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRD--IPHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLL-----------KKTTKFV---W*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEK---NYSTIEKETLALVYGITT-FRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQ-REQEMDEELKQIIRHTV------------IIQKDSEL--------------------------KQIIDERHKYVIHEGI------LKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPID 2470
            Q++   LS +  +    LL ++Q++F+ H  DLG  ++++H IPL+D  P++ R  R+P +  D     I+ + E  ++R S SP++S IVVV+KKDG +R CVDYR+LN  TRKD +P+P  +E  D +  S+ F+ +DL  GYNQ  V E+DK KTAF    GL+EFN + F L  AP+TFQR M  +  D      L+Y+DDI+IFSS   +H++ ++MV  +L++ NLK+K  KC + ++ V+Y+GH+IS  G++ +P+ ++ + ++  P  V  VR FLG ASYYR+F++ FA +A PL  L+            K    V   W +  +  F   K +L+  P+L + DFT+ F+V  DAS+  LGAVL Q+ EG K   I +ASR L+P E+   NYS+++ E LAL + +T  FR+YL+G +F VYTD+NPL +L   + AA +  RW+  L  +++E+KYR G SN  ADALSR+ ++            D     ++  +  PE    ++E     + +I  TV            I+Q    L                          K+++ +  + V  +G+      L    +   ++V+P   +  +LL  HD    GH    +T   ++ + +W  M QD+KKWC  C+ C        K++  +           +A    V  L   +NG + ++V  D  +K+ +AYA+ +QKA  V ++ +E   + YG PK++ +DQG +F+ EL K + E + I K  T+PYHP+ +G  ERFN TL +++ +    K+R W   +   LF +   +++ST  +P+ L++ ++  +PID
Sbjct:  307 QLSWPALSAQDQEQARALLRRHQNLFSEHAGDLGCTTLVQHSIPLLDSVPVRQRYRRLPPSQYDLVKAHIQELVEHQVVRPSSSPYASPIVVVQKKDGSIRLCVDYRQLNAKTRKDAFPLPRIEESLDALSGSKWFSTLDLASGYNQVPVLEKDKEKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERIFGDQSFHTLLLYLDDIVIFSSDLQQHLQRLDMVLSRLQQHNLKLKLEKCHFFQTRVSYLGHVISESGVETDPEKIRAVVDWKRPTTVKEVRSFLGFASYYRRFVEGFAALAAPLHKLVGALQGSKKQPRSKMHSIVIPHWDEVCETSFRALKDRLVRAPVLGFADFTRPFIVEIDASHTGLGAVLSQEQEG-KRRPIAFASRGLRPSERNMSNYSSMKLELLALKWAVTEKFREYLLGTQFTVYTDNNPLSYLQSAKLAAVEQ-RWASQLALFNYELKYRPGTSNGNADALSRLPADT-----------DQSSVGVRGISVPPEVPLADKETASRSQVVISSTVDAIPSRSSVDLQILQAADPLIAAFSVYWRRGQAPTARELRNEREGVKELVRQWQRIVERQGVLYRSVQLPPAKHTVFQLVLPKALQTEVLLALHDQ--HGHQGMERTTDLVRQRCYWPKMWQDIKKWCTECERCSIAKAMHPKVRTFMGSLLATRPLEILAMDFTV--LERASNGQENVLVLTDVFSKFTQAYAVADQKASTVVRVLVEKWFYVYGVPKRIHSDQGRSFEGELLKHLCETYGIEKSRTTPYHPEGNGQCERFNRTLHDLLRTLPPEKKRKWPQLLPHLLFAYNTTIHQSTQYSPYELLFGQKPQLPID 1141          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004121.1 (pep scaffold:Pmarinus_7.0:GL477387:93825:107330:1 gene:ENSPMAG00000003764.1 transcript:ENSPMAT00000004121.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.842 bits (268), Expect = 1.023e-25
Identity = 72/268 (26.87%), Postives = 129/268 (48.13%), Query Frame = 2
Query: 1694 HKYVIHEGILKYIHYNELR---IVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIF-RYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLV-------ERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMP 2464
            +K+V+   +L Y+     R   +V+    +  +L+  H     GH   +KT+ +L+  Y+W  M  DVK    SC +C  R+   +++ +P       + P E+  +D++GPLP T+  N+Y+++  DY +KW EA  +  +  E VA      ++F RYG P+K+ +  G  F +++ KS T      +   SP   Q    V       +  N  L   ++   ++   DW   ++  LF +R   + +T  +PFYLM+ +   +P
Sbjct:   49 NKFVLKGKVLYYVGRKRERRRMVVMDEDEKRNILMSVHGA---GHFGQKKTILKLEADYYWLGMISDVKNLIASCGVC--RNKGSRRVAMPSMKLLKASGPWEVLGLDVLGPLPVTSRANRYLLLLIDYFSKWAEAVPLIEKSQEHVASAL--TVVFCRYGFPRKVFSSLGKEFVTQVNKSSTLSRAYQR--CSPSQTQVHAHVSVRVALNKATNQALKGCVNLVASQHPSDWESRVEQSLFEYRVGKHSTTQYSPFYLMFGREARLP 307          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004123.1 (pep scaffold:Pmarinus_7.0:GL477387:93825:107321:1 gene:ENSPMAG00000003764.1 transcript:ENSPMAT00000004123.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.605 bits (257), Expect = 2.540e-24
Identity = 69/254 (27.17%), Postives = 124/254 (48.82%), Query Frame = 2
Query: 1697 KYVIHEGILKYIHYNELR---IVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIF-RYGAPKKLLTDQGTNFQSELFKSITELF*I-HKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMY 2443
            K+V+   +L Y+     R   +V+    +  +L+  H     GH   +KT+ +L+  Y+W  M  DVK    SC +C  R+   +++ +P       + P E+  +D++GPLP T+  N+Y+++  DY +KW EA  +  +  E VA      ++F RYG P+K+ +  G  F +++ K   + + I H L          G  +  N  L   ++   ++   DW   ++  LF +R   + +T  +PFYLM+
Sbjct:   50 KFVLKGKVLYYVGRKRERRRMVVMDEDEKRNILMSVHGA---GHFGQKKTILKLEADYYWLGMISDVKNLIASCGVC--RNKGSRRVAMPSMKLLKASGPWEVLGLDVLGPLPVTSRANRYLLLLIDYFSKWAEAVPLIEKSQEHVASAL--TVVFCRYGFPRKVFSSLGKEFVTQVNKIQHKKWCISHTLQNLCETRGPAGWHKATNQALKGCVNLVASQHPSDWESRVEQSLFEYRVGKHSTTQYSPFYLMF 296          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009777.1 (pep scaffold:Pmarinus_7.0:GL476990:135790:139231:-1 gene:ENSPMAG00000008837.1 transcript:ENSPMAT00000009777.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 1.755e-19
Identity = 62/239 (25.94%), Postives = 113/239 (47.28%), Query Frame = 2
Query: 1748 RIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMP 2464
            R+VV N+     +LQ   G    H    +T   L+  Y+W+ M  D++ +  +C+IC  +S   K+  +        + P E+  MD++GP P T+  ++++++  DY TKW E   M +Q A  V    +     R+G PKKL  +    + +++ + +   F +     +  H   +G     +  L + +S    R  RDW L ++  LF +  + + +T  +PFYLM  +   +P
Sbjct:   61 RLVVMNEEDKRSILQRVHGA--DHCGQTRTRKLLEEHYYWKGMVNDIRDYINACEICKQKSY--KRSSISHVKLLKASYPWEVLGMDLLGPFPATSRAHRFVLLIVDYFTKWAELTPMTDQSAAHVVAA-LTTAFHRFGFPKKLFCNVSEEYVAQINEEMFRHFPMCS-GLAISHLWANGAHRGTSQALRDCVSKATGR-HRDWELQLEQRLFEYHTSKHSATRYSPFYLMLGREARLP 292          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Nematostella
Match: EDO33875 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR01])

HSP 1 Score: 62.3882 bits (150), Expect = 5.099e-12
Identity = 26/86 (30.23%), Postives = 52/86 (60.47%), Query Frame = 2
Query:  713 DDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASY 970
            DD+I F S F EH++ +E + + +R +  K    K ++    V ++GH+I + G++P P+ +  I  + TP N + +R+F+G+ ++
Sbjct:    1 DDVICFHSSFEEHLRGIERMLQAVRASGFK-SIKKSQFATRSVKFLGHVIDQNGVRPQPEKL-DIRQWETPTNEEELRKFIGVCTF 84          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000036827.1 (pep primary_assembly:ASM223467v1:16:28613823:28617539:1 gene:ENSORLG00000023550.1 transcript:ENSORLT00000036827.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 525.783 bits (1353), Expect = 7.966e-167
Identity = 302/859 (35.16%), Postives = 471/859 (54.83%), Query Frame = 2
Query:  158 KLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*-LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIP--HALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXK-LRDTIFA----------------LIKAANNVPEFQREQEMDEELKQIIRHTVIIQK---------DSELKQIIDERHKYVIHEGILK------YIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSPTSQYLDIPN--YKVIMQERLQSAWIKAGLKIKYRQEQYKETYDKKAR 2623
            K+L++Y+DIFA  E ++G+  ++ HEI   D  PIK RP R+P AHQ  +D  I+ M    II  S SP++S +V+VKKK G  +RFCVDYR LN VT+KD+YP+P   E  D +  S  F+ +DL  GY Q  +    + KTAF  G+GL++F VLSF L  APATF+R M  VL  IP    LVY+DDI++    F   ++ +  V +++  A LK+ P KC + + E+ ++GH I  +G+    + V+ + ++PTP  + +++ FLGLASYYR+F++ F+ IA PL  L +K   FVW Q  +  F + K+ L  +PIL  PD    F++ TDAS+  +GAVL  Q+    + V+ Y S++L   E+ Y    +E LA+V  I  FR YL G  F V TDH+ LQWLM  ++   ++ RW   L  + F +++R G  +A ADA+SR           E +  R+ + +                L++  ++  E++  QE D +L+ +++     +K             K + ++     + +G+L+             ++VVP   R+++L   H     GH    KTL R++  ++W  + +DV+ +C  C IC        + +  L+      APME  A+DI+GP P T  GN++++V  DY TKWPEAYA+P+Q+A  VA   +E +  R+GA + + +DQG NF+S +F ++ E   + K  T+P HPQ+DGLVERFN TL+  ++   +  Q DW   +   L  +R+AV +ST  TP  LM  +    P ++ F  P       P   Y   +Q+R+ +A   A  +++    + K  YD +A+
Sbjct:  239 KVLLEYRDIFALSEDEVGLTHLVHHEIDTGDARPIKTRPRRLPLAHQVAADSAIEEMLRGGIIEPSDSPWASGVVMVKKKKGPKMRFCVDYRPLNGVTKKDSYPLPRIDESLDLVSGSSWFSSLDLRSGYWQVPLSPAARPKTAFCTGRGLWQFRVLSFGLCNAPATFERLMEKVLASIPRQECLVYLDDILVHGGSFKAALESLRKVLQRIAAAGLKLHPDKCCFMRRELEFLGHKIGGEGISTLEEKVQAVRDWPTPTTLRDLKSFLGLASYYRRFVRGFSCIAAPLFHLQRKDCDFVWTQECEQAFSSLKKALTNSPILTPPDPKLPFILDTDASDVGMGAVL-SQMGSAGERVVAYFSKTLSKAERRYCVTRRELLAVVKAIGHFRYYLCGLPFTVRTDHSALQWLMTFKEPEGQIARWLEELASFSFTVEHRPGSRHANADAMSRRPCALAGCQYCEKREAREAVISREEQSHTGESSWPVCRLVQGVDST-EWRAHQEQDVDLQPVLQWVEAGRKPEWGEVAGCSPGSKGLFEKFDALRLKDGVLQRAWKEPATGEERWQVVVPRTLRNSVLQGCHGAAGSGHFGVSKTLRRIRQGFYWGQLRRDVEDFCRRCDICTAHKGPPDRSRAELQ-QLAAGAPMERVAVDIMGPFPRTNRGNRFVLVAMDYFTKWPEAYAIPDQEAVTVADALVEGMFSRFGAAEVIHSDQGRNFESAVFSAMCERLGMRKTRTTPLHPQSDGLVERFNRTLVKQLAILTSAHQSDWDEHLPLVLMAYRSAVQDSTLCTPALLMLGRELRTPAEMSFGKPPDALGAPPGPEYARKLQDRMDTAHAFARNQLEKAGIRQKRNYDLRAK 1094          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000045600.1 (pep primary_assembly:ASM223467v1:4:26167161:26171153:-1 gene:ENSORLG00000023514.1 transcript:ENSORLT00000045600.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 483.797 bits (1244), Expect = 3.047e-150
Identity = 300/881 (34.05%), Postives = 474/881 (53.80%), Query Frame = 2
Query:  107 PQITSKELSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPY-RIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDI--PHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLL-------------KKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEK---NYSTIEKETLALVYGITT-FRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQRE-----QEMDEELKQII-------------RHTVIIQKDSELKQIIDERHKYVIHEGIL-KYI-----HYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSPTSQYLDIPNYKVIMQERLQSAWIKAGLKIKYRQEQYKETYDKK 2617
            PQ+  + L E   +    LL KY  +FA  + D+G  +++ HEIPL+DETP++ +PY RIP +  + +   I+ + +  +IR+S SP++S IV+V+KKDG LR CVDYR+LN  TRKD +P+P   E  D +  +Q FT +DL  GY+Q +V E+DK KTAF    GL+EFN + F L  AP+TFQR M  +  D      L+Y+DD+IIFSS   +H++ +E VF +L    LK+K SKC + + +V Y+GH++S +G+  +P+    + ++  P N+ ++R FLG ASYYR+FI  FA IA PL  L+             KK     W    +  F   K  LI  P+L Y +F K F++  DAS+  LGAVL Q+ EG +   + +ASRSLKP E+   NYS+++ E +AL + +T  FR+YL+G    V+TD+NPL  L   +  A++  RW+  L  +D  IKYR G  NA ADALSR       +    ++  + +  +    + +P          Q+ D  L   I             RH +       ++++I +  +   HE +L +YI     H    ++V+P   ++++L   HD    GH    +TL  ++ +Y+W  M  DV+KWC +C+ C+       K+K  +           +A    V  L   T+G + ++V  D  +K+ +     +Q+A  VA+  +++    +G P ++ +DQG NF+S L   + + + I K  T+PYHPQ +G  ERFN TL +++ +    ++R W   +    F +   V++STG TP++LM+ +   +P+D    S T    D+P  + +  E  QS+   A   ++ R E  +   D K
Sbjct:  292 PQL--EHLDERDKERVKALLSKYNRVFAKDDLDVGCTNLMTHEIPLLDETPVR-QPYRRIPPSQYELAHSHIQQLLQSQVIRESSSPYASPIVLVQKKDGGLRMCVDYRQLNARTRKDAFPLPRIDESLDALAGAQWFTTLDLASGYSQVEVAEKDKAKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERLFGDCRFQSVLLYLDDVIIFSSSVEQHLQRLEQVFSRLEAQGLKVKLSKCHFFQKQVKYLGHVVSAEGVSTDPEKAAVVRDWRRPANLADLRSFLGFASYYRRFIAGFAKIASPLNSLVARLLPPGRKGKTPKKPVDEFWDAECEKSFQELKTALITAPVLAYANFQKPFVLEVDASHGGLGAVLSQEHEGRR-RPVAFASRSLKPTERNMNNYSSMKLELVALKWAVTEKFREYLLGNACTVFTDNNPLSHLATAKLGATEQ-RWASELAAFDLTIKYRPGSQNANADALSRQHPVLELSGARPLET-ERVLGVQAEMSTLPGLSPSDLYTLQQQDPVLGPFIKYWERGKMPDARERHGL----SKPVRELIRQWKRLREHESVLYRYIYGSDGHGETNQLVLPQSLQESILHSLHDD--HGHQGTERTLQLIRSRYYWPNMYSDVEKWCRTCERCVLSKALQPKVKTYMGSVKASRPHEILAIDFTV--LDPATDGRENVLVMTDVFSKYTQTVPTKDQRASTVAEALVKHWFQLFGPPARIHSDQGWNFESNLVHQLCKFYQIDKSRTTPYHPQGNGQCERFNLTLHDLLRTLPPEQKRRWPRHLSQVTFAYNTTVHQSTGMTPYFLMFGREPRLPVDFLLGSDTEH--DVPLDEWL--EEHQSSLAVAYEAVQRRMENVRAQRDLK 1154          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000039099.1 (pep primary_assembly:ASM223467v1:16:31928608:31932747:-1 gene:ENSORLG00000023909.1 transcript:ENSORLT00000039099.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 484.952 bits (1247), Expect = 3.102e-150
Identity = 293/842 (34.80%), Postives = 466/842 (55.34%), Query Frame = 2
Query:  110 QITSKELSE----EQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMN--FVLRDIPHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLL---------KKTTKFV---W*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEK---NYSTIEKETLALVYGITT-FRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRX----------------XXXXXXXXXXXXKLRDTIFALIKAANNVP-EFQREQEMDEELKQII----RHTVII-----QKDSELKQIIDERHKYVIHEGILKYIHYNE------LRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDL 2473
            Q+ S +LS     EQ ++ T LL KY  +F+ HE DLG  S+I HEIPL+D+ P++ R  RIP +    +   I  + +  +IR+S SPF+S IV+++KKDG LR CVDYR+LN  TRKD +P+P  +E  D +  ++ F+ +DL  GY+Q  V E D+ KTAF    GL+E+N + F L  AP+TFQR M   F  +     L+Y+DDII+FSS   +H++ +E+V ++L+   LK+K +KC + + +V Y+GH+IS +G+  +P  V+ + N+  P  V  +R F+G ASYYR+F++ FA +A PL  L+         KK+ + +   W +  Q  F+  K KL   P+L Y DF++ F++  DASN  LGAVL Q+ EG K   I YASR L+P E+   NYS++  E LAL + +   FR+YL+G+K IVYTD+NPL +L   +  A +  RW+  L  +D EI+YR+G+SN  ADALSR                     +   ++   +  T   ++   ++ P +    Q  D  LK+ +    R T        Q  S    ++ + ++ V   G+L    + +      L+I++P   R+ +L   H     GH    +TL  L+ + +W  M  +V +WC  C+ C     T    + P+           +A    V  L  TT+G + ++V  D  +K+  A A  +Q+A  VAQ+ +     ++G P ++ +DQG +F+S L + + +L+ + K  T+PYHP+ +G  ERFN TL +++ +    ++RDW + +   L+ +    + STGE+PF+LM+ +   +P+D 
Sbjct:  295 QLESVDLSALSAGEQEKVRT-LLGKYLTVFSLHEGDLGCTSLITHEIPLVDDAPVRQRYRRIPPSDYVAAKEHINNLLQSQVIRESSSPFASPIVLIRKKDGGLRLCVDYRQLNSRTRKDAFPLPRIEESLDALSGARWFSTLDLASGYHQVAVAEADRPKTAFCTPFGLFEWNRMPFGLCNAPSTFQRLMQRMFGEQQGQSLLLYLDDIIVFSSTIEQHLERLELVLERLQLEGLKVKLAKCAFFQHQVHYLGHVISDQGVSTDPGKVEAVANWEPPTTVFQLRSFIGFASYYRRFVEGFAKLAAPLHRLVAELEGNKVRKKSARGLTNHWTEECQRSFEALKAKLTTTPVLAYADFSRPFILEVDASNGGLGAVLSQEQEG-KVRPIAYASRGLRPTERNPVNYSSMRLEFLALKWAVAEKFREYLLGQKCIVYTDNNPLSYLSTAKLGAMEQ-RWAAQLAAFDLEIRYRSGRSNRNADALSRQHFPDMQAWRDVLPGSCLPMSLQQVQQTETVGTTQATMVALPHHSPSDMASLQGADPVLKEFLPFWERQTRPSPEERRQLSSPTLALLRQWNRLVEQGGVLYRRVFRDDGGEAVLQILLPGSIREEVLTAVHQ--QHGHQGVDRTLDLLRQRCYWPGMSAEVAEWCSQCERCQVAKVTRPAARAPMGHLLASKPNEILAMDFSV--LEPTTSGIENVLVITDIFSKYTMAVATRDQRAATVAQVLVTEWFSKFGVPARIHSDQGRSFESALIQQLCDLYAVEKSRTTPYHPEGNGQCERFNRTLHDLLRTLPVSRKRDWNVCLPQLLYSYNTTPHHSTGESPFFLMFGQEPRLPVDF 1129          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000029819.1 (pep primary_assembly:ASM223467v1:24:6358775:6362914:-1 gene:ENSORLG00000022361.1 transcript:ENSORLT00000029819.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 483.797 bits (1244), Expect = 8.257e-150
Identity = 288/832 (34.62%), Postives = 459/832 (55.17%), Query Frame = 2
Query:  128 LSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMN--FVLRDIPHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLL---------KKTTKFV---W*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEK---NYSTIEKETLALVYGITT-FRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRX----------------XXXXXXXXXXXXKLRDTIFALIKAANNVP-EFQREQEMDEELKQII----RHTVII-----QKDSELKQIIDERHKYVIHEGILKYIHYNE------LRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDL 2473
            LS  + +    LL KY  +F+ HE DLG  S+I HEIPL+D+ P++ R  RIP +    +   I  + +  +IR+S SPF+S IV+++KKDG LR CVDYR+LN  TRKD +P+P  +E  D +  ++ F+ +DL  GY+Q  V E D+ KTAF    GL+E+N + F L  AP+TFQR M   F  +     L+Y+DDII+FSS   +H++ +E+V ++L+   LK+K +KC + + +V Y+GH+IS +G+  +P  V+ + N+  P  V  +R F+G ASYYR+F++ FA +A PL  L+         KK+ + +   W +  Q  F+  K KL   P+L Y DF++ F++  DASN  LGAVL Q+ EG K   I YASR L+P E+   NYS++  E LAL + +   FR+YL+G+K IVYTD+NPL +L   +  A +  RW+  L  +D EI+YR+G+SN  ADALSR                     +   ++   +  T   ++   ++ P +    Q  D  LK+ +    R T        Q  S    ++ + ++ V   G+L    + +      L+I++P   R+ +L   H     GH    +TL  L+ + +W  M  +V +WC  C+ C     T    + P+           +A    V  L  TT+G + ++V  D  +K+  A A  +Q+A  VAQ+ +     ++G P ++ +DQG +F+S L + + +L+ + K  T+PYHP+ +G  ERFN TL +++ +    ++RDW + +   L+ +    + STGE+PF+LM+ +   +P+D 
Sbjct:  304 LSAGEQEKVRALLGKYLTVFSLHEGDLGCTSLITHEIPLVDDAPVRQRYRRIPPSDYVAAKEHINNLLQSQVIRESSSPFASPIVLIRKKDGGLRLCVDYRQLNSRTRKDAFPLPRIEESLDALSGARWFSTLDLASGYHQVAVAEADRPKTAFCTPFGLFEWNRMPFGLCNAPSTFQRLMQRMFGEQQGQSLLLYLDDIIVFSSTIEQHLERLELVLERLQLEGLKVKLAKCAFFQHQVHYLGHVISDQGVSTDPGKVEAVANWEPPTTVFQLRSFIGFASYYRRFVEGFAKLAAPLHRLVAELEGNKVRKKSARGLTNHWTEECQRSFEALKAKLTTTPVLAYADFSRPFILEVDASNGGLGAVLSQEQEG-KVRPIAYASRGLRPTERNPVNYSSMRLEFLALKWAVAEKFREYLLGQKCIVYTDNNPLSYLSTAKLGAMEQ-RWAAQLAAFDLEIRYRSGRSNRNADALSRQHFPDMQAWRDVLPGSCLPMSLQQVQQTETVGTTQATMVALPHHSPSDMASLQGADPVLKEFLPFWERQTRPSPEERRQLSSPTLALLRQWNRLVEQGGVLYRRVFRDDGGEAVLQILLPGSIREEVLTAVHQ--QHGHQGVDRTLDLLRQRCYWPGMSAEVAEWCSQCERCQVAKVTRPAARAPMGHLLASKPNEILAMDFSV--LEPTTSGIENVLVITDIFSKYTMAVATRDQRAATVAQVLVTEWFSKFGVPARIHSDQGRSFESALIQQLCDLYAVEKSRTTPYHPEGNGQCERFNRTLHDLLRTLPVSRKRDWNVCLPQLLYSYNTTPHHSTGESPFFLMFGQEPRLPVDF 1129          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000040501.1 (pep primary_assembly:ASM223467v1:1:1251188:1255180:-1 gene:ENSORLG00000023024.1 transcript:ENSORLT00000040501.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 481.1 bits (1237), Expect = 3.489e-149
Identity = 300/881 (34.05%), Postives = 469/881 (53.23%), Query Frame = 2
Query:  107 PQITSKELSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPY-RIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDI--PHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLL-------------KKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEK---NYSTIEKETLALVYGITT-FRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQRE-----QEMDEELKQII-------------RHTVIIQKDSELKQIIDERHKYVIHEGILKYI------HYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSPTSQYLDIPNYKVIMQERLQSAWIKAGLKIKYRQEQYKETYDKK 2617
            PQ+  + L E   +    LL KY  +FA  + D+G  +++ HEIPL+DETP++ +PY RIP +  + +   I+ + +  +IR+S SP++S IV+V+KKDG LR CVDYR+LN  TRKD +P P   E  D +  +Q FT +DL  GY+Q +V E+DK KTAF    GL+EFN + F L  AP+TFQR M  +  D      L+Y+DD+IIFSS   +H++ +E VF +L    LK+K SKC + + +V Y+GH++S +G+  +P+    + ++  P N+ ++R FLG ASYYR+FI  FA IA PL  L+             KK     W    +  F   K  LI  P+L Y DF K F++  DAS+  LGAVL Q+ EG K   + +ASRSLKP E+   NYS+++ E +AL + +T  FR+YL+G    V+TD+NPL  L   +  A++  RW+  L  +D  IKYR G  NA ADALSR       +    ++  + +  +    + +P          Q  D  L   I             RH +       ++++I +  +   HE +L         H    ++V+P   ++++L   HD    GH    +TL  ++ +Y+W  M  DV+KWC +C+ C+       K+K  +           +A    V  L   T+G + ++V  D  +K+ +     +Q+A  VA+  +++    +G P ++ +DQG NF+S L   + + + I K  T+PYHPQ +G  ERFN TL +++ +    ++R W   +    F +   V++STG TP++LM+ +   +P+D    S T    D+P  + +  E  QS+   A   ++ R E  +   D K
Sbjct:  292 PQL--EHLDERDKERVKALLSKYNRVFAKDDLDVGCTNLMTHEIPLLDETPVR-QPYRRIPPSQYELARSHIQQLLQSQVIRESSSPYASPIVLVQKKDGGLRMCVDYRQLNARTRKDAFPSPRIDESLDALAGAQWFTTLDLASGYSQVEVAEKDKAKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERLFGDCRFQSVLLYLDDVIIFSSSVEQHLQRLEQVFSRLDAQGLKVKLSKCHFFQKQVKYLGHVVSAEGVSTDPEKAAVVRDWRRPANLADLRSFLGFASYYRRFIAGFAKIASPLNSLVARLLPPGRKGKTPKKPVDEFWDAECEESFQELKTALITAPVLAYADFQKPFVLEVDASHGGLGAVLSQEHEG-KRRPVAFASRSLKPTERNMNNYSSMKLELVALKWAVTEKFREYLLGNACTVFTDNNPLSHLATAKLGATEQ-RWASELAAFDLTIKYRPGSQNANADALSRQHPVLELSGARPLET-ERVLGVQAEMSTLPGLSPSDLYTLQRQDPVLGPFIKYWERGKMPDARERHGL----SKPVRELIRQWKRLREHESVLYRCIYGSDGHGETNQLVLPQSLQESILHSLHDD--HGHQGTERTLQLIRSRYYWPNMYSDVEKWCRTCERCVLSKALQPKVKTYMGSVKASRPHEILAIDFTV--LDPATDGRENVLVMTDVFSKYTQTVPTKDQRASTVAEALVKHWFQLFGPPARIHSDQGRNFESNLVHRLCKFYQIDKSRTTPYHPQGNGQCERFNRTLHDLLRTLPPEQKRRWPRHLSQVTFAYNTTVHQSTGMTPYFLMFGREPRLPVDFLLGSDTEH--DVPLDEWL--EEHQSSLAVAYEAVQRRMENVRAQRDLK 1154          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000080881.1 (SMESG000080881.1)

HSP 1 Score: 993.416 bits (2567), Expect = 0.000e+0
Identity = 525/754 (69.63%), Postives = 592/754 (78.51%), Query Frame = 2
Query:   74 KLPKNIKIYK*PQITSKELSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDEELKQIIRHTVIIQKDSELKQIIDERHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSY 2335
            KLP+NIKIYK PQ+ S +L+E Q   FT+LL KY+ +FA HEYDLG+  +IEHEIPL+DETPIKL+PYRIPY HQ+ESDRQIKAMKEF IIRDS SPFSSSI VVKKKDG LRFCVDYRKLNQVTRKDTYPIPVPQEMFD+MGE Q FTVIDLNKGYNQFKVKEED+ KTAFSDGKGLYEFNVL F LTGAPATFQRGMNFVLRDIPHALVYIDDIIIFS+ F EH+KDVE VF++L +ANLKIKPSKCEWGKSEV YVGHIISR GLQPNP+NVKKI+ YP P+NVD VRQFLGLASYYRKFIK F+H+AQPL +LLKK T+F W ++QQ  F   K+ LI  PILR P+F   F++MTDASN ALGAVLGQQVEGEKDHVI YASR+LKPHEKNYSTIEKETLAL YGI T  ++  G     Y   NP+    K+                   E+ Y                              +TIF  IK ANN+ E Q++QE D+EL Q+ +H V I+K+S+ K ++DE+HKY+IH+G+LK I    L IVV  KHR  L+L YHDG LGGHLSARKTLSRLK KY+W T+E DV++WC +C++CLTR NTGKKIKVPLKP P+P APMEI AMDIVGPLPET N NKYIIVFCDYLTKWPEAYAM NQKAE VA+IF+ENIIFRYGAPKKLLTDQGTNFQSELF SITELF I KL+TSP HPQTDGLVERF  TLINMI  +
Sbjct: 3322 KLPRNIKIYKQPQVISNDLTESQKWEFTELLKKYKMVFAKHEYDLGLTQVIEHEIPLLDETPIKLKPYRIPYIHQEESDRQIKAMKEFKIIRDSSSPFSSSIAVVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEVQFFTVIDLNKGYNQFKVKEEDRRKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNFVLRDIPHALVYIDDIIIFSNTFKEHLKDVETVFRRLLKANLKIKPSKCEWGKSEVVYVGHIISRNGLQPNPENVKKIKEYPIPENVDQVRQFLGLASYYRKFIKSFSHVAQPLNVLLKKQTQFKWGKSQQEAFKLLKKSLIKKPILRCPNFRIPFILMTDASNFALGAVLGQQVEGEKDHVIAYASRTLKPHEKNYSTIEKETLALAYGIATQIKWKCG-----YAIENPVNNESKNN------------------EMNY-----------------------------NNTIFMAIKTANNLQELQKDQENDDELNQLRKHAVTIKKESDWKHVVDEKHKYIIHDGLLKCIKNENLLIVVLTKHRTTLMLIYHDGALGGHLSARKTLSRLKQKYYWDTIESDVRQWCHTCEVCLTRRNTGKKIKVPLKPMPVPGAPMEITAMDIVGPLPETINVNKYIIVFCDYLTKWPEAYAMQNQKAETVAKIFVENIIFRYGAPKKLLTDQGTNFQSELFISITELFGILKLSTSPCHPQTDGLVERFIRTLINMIKKF 4023          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000057446.1 (SMESG000057446.1)

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 396/602 (65.78%), Postives = 457/602 (75.91%), Query Frame = 2
Query:   74 KLPKNIKIYK*PQITSKELSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDEELKQIIRHTVIIQKDSELKQIIDERHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTME 1879
            KLP+NIKIYK PQ+ S +L+E Q   FT+LL KY+ +FA HEYDLG+  +IEHEIPL+DETPIKL+PYRIPY HQ+E                                              +TRKDTYPIPVPQEMFD+MGE Q FTVIDLNKGYNQFKVKEED+ KTAFSDGKGLYEFNVL F LTGAPATFQR MNFVLRDIPHALVYIDD+IIFS+ F EH+KDVE VF++L +A LKIKPSKCEWGKSEV YVGHIISR GLQPNP+NV+KI+ YP P+NVD VRQFLGLASYYRKFIK F+H+AQ L +LLKK  +  W +AQQ  F+  K+ LI  PILR P+F   F++MTDASN A GAVLGQQVEGEKDHVI YASR+LKPHEKNYSTIEKETLALVYGI TFRQYLVGRKF+V T HNPLQWLMKH D+ASKLIRWS+ALQEYDFEIKYRTGKSN  AD LSR           E+   +TIF  IK ANN+ E Q++QE D+EL Q+ +H V I+K+S+ K + DE+HKY+IH+G+LK +    L IVVP  H+  L+L YHDG LGG+LSARKTLSRLK KY+W T+E
Sbjct: 1859 KLPRNIKIYKEPQVISNDLTESQKWEFTELLKKYKMVFAKHEYDLGLTQVIEHEIPLLDETPIKLKPYRIPYIHQEE----------------------------------------------ITRKDTYPIPVPQEMFDQMGEVQFFTVIDLNKGYNQFKVKEEDRRKTAFSDGKGLYEFNVLPFGLTGAPATFQRSMNFVLRDIPHALVYIDDVIIFSNTFKEHLKDVETVFRRLLKAKLKIKPSKCEWGKSEVVYVGHIISRNGLQPNPENVRKIKEYPIPENVDQVRQFLGLASYYRKFIKSFSHVAQLLNVLLKKQIQSKWGKAQQEAFELLKESLIKKPILRCPNFRIPFILMTDASNFAFGAVLGQQVEGEKDHVIAYASRTLKPHEKNYSTIEKETLALVYGIATFRQYLVGRKFVVLTYHNPLQWLMKHWDSASKLIRWSIALQEYDFEIKYRTGKSNGNADTLSR-IPVNNERKNNEMNYNNTIFMAIKTANNLQELQKDQENDDELNQLRKHAVTIKKESDWKHVADEKHKYIIHDGLLKCVKNENLLIVVPTNHQTTLMLIYHDGALGGYLSARKTLSRLKQKYYWDTIE 2413          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000045224.1 (SMESG000045224.1)

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 393/841 (46.73%), Postives = 554/841 (65.87%), Query Frame = 2
Query:  113 ITSKELSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDEELKQIIR-----HTVIIQKDSELKQIIDE-RHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSPTSQYLDIPNYKVIMQERLQSAWIKAGLKIKYRQEQYKETYDKK 2617
            I S+ L+E + +   KLL++++DIFA  + DLG + + +H IPL D+TPI LRPYR+  A +  ++++++ M +  +I  S SP+   +V+VKKKDG  RFC+DYR+LN VT++DTYP+P   EM   +  +  FT +DL  GY Q KVKEED+ KTAF+ GK LY+F  + F LT APA+FQR MNFV   I   +VYIDD++I+SS F +H+KD+                              HI+S KG +P+P N++KI+N P PK V  V++FLGL  YYRKFIK +A IA+P+  L KK T F W + QQ  F+T + KLI  PIL +PDF K F++ TDAS  A GAV+GQ  + +++ VI Y SR+ K HEKNYS  E+E LA++  I  F+  L G +  + TDH PL WL +H++A+S+L+RW++ LQEY   IK+++GK+NA AD +SR    E+ +++        I  +I    +  + + EQ+ DEELK II         I   +S+LK+ +++ RH+Y I +G L  +   +  + +P   R  +L+QYHDG LGGH+SA+KT +RL+ KY+W  + +DVK W  +C IC TR +TG K+K PLKP PIP  PM + AMD+VGPLPET +GN YI+V  DYL+K+PEA+A+P+QKA  +A+I +E I  RYG PK++LTDQGTNF SE+ + +T  F I KL TSPYHPQT+G  ERFNG LI M+S+YV+R Q+DW  +I  CL  +R +++ +T  +PF LMY +  NMPIDLE+Q P SQY++I +Y    +ER+Q  W  AG+ I++ QE YKE +DKK
Sbjct: 1278 IDSQLLNETEKEQLQKLLMEFKDIFAASDLDLGTSDVTQHTIPLTDDTPITLRPYRLAEAQKSVAEKEVQKMLDAGVIEPSCSPWQFPVVMVKKKDGTQRFCIDYRRLNAVTKRDTYPLPDINEMLQTLHGAAYFTSLDLKSGYWQIKVKEEDREKTAFTIGKDLYQFKKMPFGLTNAPASFQRCMNFVTHGIKQCMVYIDDLLIYSSTFEQHLKDIR-----------------------------HIVSAKGKEPDPRNIEKIKNCPVPKTVTQVQEFLGLCGYYRKFIKSYATIAKPIQELTKKDTPFTWEKEQQTAFETLRDKLISAPILVHPDFKKPFLLATDASGYASGAVVGQWDDEKRERVIGYYSRTFKKHEKNYSVTEREALAIIQAIKHFKYLLWGHEIYITTDHQPLVWLGQHKEASSRLMRWAMQLQEYSPYIKFKSGKANANADCMSRFVFEELMDHDVRR-----ICMIIAEDIDFTKLRNEQKEDEELKTIIEFMETNDMKIFDNNSKLKEHMEKHRHRYTIEKGWLLLMDGEKRLMCLPESRRKEVLMQYHDGKLGGHMSAKKTEARLRQKYYWPNIGEDVKGWIKNCLICATRKSTGSKLKAPLKPMPIPPEPMTMIAMDVVGPLPETKDGNSYILVVTDYLSKFPEAFAIPDQKARTIARILVEEICCRYGTPKQILTDQGTNFMSEIIEEVTNYFRIAKLRTSPYHPQTNGQTERFNGILIEMMSNYVSRHQKDWDRYINLCLMAYRMSIHSATKMSPFKLMYGRECNMPIDLEYQPPISQYMEIDDYVTGFKERMQEIWKTAGMNIRFNQESYKELHDKK 2084          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000045224.1 (SMESG000045224.1)

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 393/841 (46.73%), Postives = 554/841 (65.87%), Query Frame = 2
Query:  113 ITSKELSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDEELKQIIR-----HTVIIQKDSELKQIIDE-RHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSPTSQYLDIPNYKVIMQERLQSAWIKAGLKIKYRQEQYKETYDKK 2617
            I S+ L+E + +   KLL++++DIFA  + DLG + + +H IPL D+TPI LRPYR+  A +  ++++++ M +  +I  S SP+   +V+VKKKDG  RFC+DYR+LN VT++DTYP+P   EM   +  +  FT +DL  GY Q KVKEED+ KTAF+ GK LY+F  + F LT APA+FQR MNFV   I   +VYIDD++I+SS F +H+KD+                              HI+S KG +P+P N++KI+N P PK V  V++FLGL  YYRKFIK +A IA+P+  L KK T F W + QQ  F+T + KLI  PIL +PDF K F++ TDAS  A GAV+GQ  + +++ VI Y SR+ K HEKNYS  E+E LA++  I  F+  L G +  + TDH PL WL +H++A+S+L+RW++ LQEY   IK+++GK+NA AD +SR    E+ +++        I  +I    +  + + EQ+ DEELK II         I   +S+LK+ +++ RH+Y I +G L  +   +  + +P   R  +L+QYHDG LGGH+SA+KT +RL+ KY+W  + +DVK W  +C IC TR +TG K+K PLKP PIP  PM + AMD+VGPLPET +GN YI+V  DYL+K+PEA+A+P+QKA  +A+I +E I  RYG PK++LTDQGTNF SE+ + +T  F I KL TSPYHPQT+G  ERFNG LI M+S+YV+R Q+DW  +I  CL  +R +++ +T  +PF LMY +  NMPIDLE+Q P SQY++I +Y    +ER+Q  W  AG+ I++ QE YKE +DKK
Sbjct: 1250 IDSQLLNETEKEQLQKLLMEFKDIFAASDLDLGTSDVTQHTIPLTDDTPITLRPYRLAEAQKSVAEKEVQKMLDAGVIEPSCSPWQFPVVMVKKKDGTQRFCIDYRRLNAVTKRDTYPLPDINEMLQTLHGAAYFTSLDLKSGYWQIKVKEEDREKTAFTIGKDLYQFKKMPFGLTNAPASFQRCMNFVTHGIKQCMVYIDDLLIYSSTFEQHLKDIR-----------------------------HIVSAKGKEPDPRNIEKIKNCPVPKTVTQVQEFLGLCGYYRKFIKSYATIAKPIQELTKKDTPFTWEKEQQTAFETLRDKLISAPILVHPDFKKPFLLATDASGYASGAVVGQWDDEKRERVIGYYSRTFKKHEKNYSVTEREALAIIQAIKHFKYLLWGHEIYITTDHQPLVWLGQHKEASSRLMRWAMQLQEYSPYIKFKSGKANANADCMSRFVFEELMDHDVRR-----ICMIIAEDIDFTKLRNEQKEDEELKTIIEFMETNDMKIFDNNSKLKEHMEKHRHRYTIEKGWLLLMDGEKRLMCLPESRRKEVLMQYHDGKLGGHMSAKKTEARLRQKYYWPNIGEDVKGWIKNCLICATRKSTGSKLKAPLKPMPIPPEPMTMIAMDVVGPLPETKDGNSYILVVTDYLSKFPEAFAIPDQKARTIARILVEEICCRYGTPKQILTDQGTNFMSEIIEEVTNYFRIAKLRTSPYHPQTNGQTERFNGILIEMMSNYVSRHQKDWDRYINLCLMAYRMSIHSATKMSPFKLMYGRECNMPIDLEYQPPISQYMEIDDYVTGFKERMQEIWKTAGMNIRFNQESYKELHDKK 2056          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000045224.1 (SMESG000045224.1)

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 393/841 (46.73%), Postives = 554/841 (65.87%), Query Frame = 2
Query:  113 ITSKELSEEQIQIFTKLLIKYQDIFA*HEYDLGVNSIIEHEIPLMDETPIKLRPYRIPYAHQDESDRQIKAMKEFNIIRDSFSPFXXXXXXXXXXDG*LRFCVDYRKLNQVTRKDTYPIPVPQEMFDRMGESQ*FTVIDLNKGYNQFKVKEEDKGKTAFSDGKGLYEFNVLSFALTGAPATFQRGMNFVLRDIPHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSKCEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLASYYRKFIKHFAHIAQPLTMLLKKTTKFVW*QAQQNVFDTFKQKLIMNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKPHEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAASKLIRWSLALQEYDFEIKYRTGKSNAEADALSRXXXXXXXXXXXXXKLRDTIFALIKAANNVPEFQREQEMDEELKQIIR-----HTVIIQKDSELKQIIDE-RHKYVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRLKLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKXXXXXXXXXXXXXXDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENIIFRYGAPKKLLTDQGTNFQSELFKSITELF*IHKLNTSPYHPQTDGLVERFNGTLINMISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPIDLEFQSPTSQYLDIPNYKVIMQERLQSAWIKAGLKIKYRQEQYKETYDKK 2617
            I S+ L+E + +   KLL++++DIFA  + DLG + + +H IPL D+TPI LRPYR+  A +  ++++++ M +  +I  S SP+   +V+VKKKDG  RFC+DYR+LN VT++DTYP+P   EM   +  +  FT +DL  GY Q KVKEED+ KTAF+ GK LY+F  + F LT APA+FQR MNFV   I   +VYIDD++I+SS F +H+KD+                              HI+S KG +P+P N++KI+N P PK V  V++FLGL  YYRKFIK +A IA+P+  L KK T F W + QQ  F+T + KLI  PIL +PDF K F++ TDAS  A GAV+GQ  + +++ VI Y SR+ K HEKNYS  E+E LA++  I  F+  L G +  + TDH PL WL +H++A+S+L+RW++ LQEY   IK+++GK+NA AD +SR    E+ +++        I  +I    +  + + EQ+ DEELK II         I   +S+LK+ +++ RH+Y I +G L  +   +  + +P   R  +L+QYHDG LGGH+SA+KT +RL+ KY+W  + +DVK W  +C IC TR +TG K+K PLKP PIP  PM + AMD+VGPLPET +GN YI+V  DYL+K+PEA+A+P+QKA  +A+I +E I  RYG PK++LTDQGTNF SE+ + +T  F I KL TSPYHPQT+G  ERFNG LI M+S+YV+R Q+DW  +I  CL  +R +++ +T  +PF LMY +  NMPIDLE+Q P SQY++I +Y    +ER+Q  W  AG+ I++ QE YKE +DKK
Sbjct: 1248 IDSQLLNETEKEQLQKLLMEFKDIFAASDLDLGTSDVTQHTIPLTDDTPITLRPYRLAEAQKSVAEKEVQKMLDAGVIEPSCSPWQFPVVMVKKKDGTQRFCIDYRRLNAVTKRDTYPLPDINEMLQTLHGAAYFTSLDLKSGYWQIKVKEEDREKTAFTIGKDLYQFKKMPFGLTNAPASFQRCMNFVTHGIKQCMVYIDDLLIYSSTFEQHLKDIR-----------------------------HIVSAKGKEPDPRNIEKIKNCPVPKTVTQVQEFLGLCGYYRKFIKSYATIAKPIQELTKKDTPFTWEKEQQTAFETLRDKLISAPILVHPDFKKPFLLATDASGYASGAVVGQWDDEKRERVIGYYSRTFKKHEKNYSVTEREALAIIQAIKHFKYLLWGHEIYITTDHQPLVWLGQHKEASSRLMRWAMQLQEYSPYIKFKSGKANANADCMSRFVFEELMDHDVRR-----ICMIIAEDIDFTKLRNEQKEDEELKTIIEFMETNDMKIFDNNSKLKEHMEKHRHRYTIEKGWLLLMDGEKRLMCLPESRRKEVLMQYHDGKLGGHMSAKKTEARLRQKYYWPNIGEDVKGWIKNCLICATRKSTGSKLKAPLKPMPIPPEPMTMIAMDVVGPLPETKDGNSYILVVTDYLSKFPEAFAIPDQKARTIARILVEEICCRYGTPKQILTDQGTNFMSEIIEEVTNYFRIAKLRTSPYHPQTNGQTERFNGILIEMMSNYVSRHQKDWDRYINLCLMAYRMSIHSATKMSPFKLMYGRECNMPIDLEYQPPISQYMEIDDYVTGFKERMQEIWKTAGMNIRFNQESYKELHDKK 2054          
The following BLAST results are available for this feature:
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RTL11.045e-2327.05retrotransposon Gag like 1 [Source:HGNC Symbol;Acc... [more]
RTL11.045e-2327.05retrotransposon Gag like 1 [Source:HGNC Symbol;Acc... [more]
NYNRIN2.033e-1729.94NYN domain and retroviral integrase containing [So... [more]
GIN12.194e-1725.27gypsy retrotransposon integrase 1 [Source:HGNC Sym... [more]
GIN16.580e-1527.75gypsy retrotransposon integrase 1 [Source:HGNC Sym... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX511082.17.576e-10530.35pep chromosome:GRCz11:9:14291932:14297132:1 gene:E... [more]
BX546500.16.262e-10328.82pep chromosome:GRCz11:23:12926092:12931693:-1 gene... [more]
CR855320.11.267e-10228.94pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENS... [more]
BX511224.12.145e-10129.07pep chromosome:GRCz11:2:18017000:18022765:1 gene:E... [more]
CR925755.23.224e-9928.77pep chromosome:GRCz11:17:42486740:42492668:-1 gene... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000006041.11.321e-12529.50pep primary_assembly:Xenopus_tropicalis_v9.1:6:373... [more]
anxa62.212e-10841.25annexin A6 [Source:Xenbase;Acc:XB-GENE-989741][more]
ENSXETT00000035398.12.881e-10231.55pep primary_assembly:Xenopus_tropicalis_v9.1:3:986... [more]
castor13.262e-9831.38cytosolic arginine sensor for mTORC1 subunit 1 [So... [more]
ENSXETT00000042189.16.272e-9831.64pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nynrin6.357e-1626.50NYN domain and retroviral integrase containing [So... [more]
Nynrin6.357e-1626.50NYN domain and retroviral integrase containing [So... [more]
Rtl17.430e-1624.17retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:M... [more]
Rtl17.430e-1624.17retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:M... [more]
Gin11.668e-1424.91gypsy retrotransposon integrase 1 [Source:MGI Symb... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20825|POL2_DROME1.041e-10943.01Retrovirus-related Pol polyprotein from transposon... [more]
sp|P04323|POL3_DROME1.747e-10943.99Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q7LHG5|YI31B_YEAST3.212e-9430.03Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomy... [more]
sp|Q99315|YG31B_YEAST3.425e-9430.25Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomy... [more]
sp|P0CT39|TF26_SCHPO9.963e-8929.97Transposon Tf2-6 polyprotein OS=Schizosaccharomyce... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A355ABF21.175e-651.50Uncharacterized protein OS=Flavobacteriaceae bacte... [more]
A0A147BAZ10.000e+040.34Putative retrovirus-related pol polyprotein from t... [more]
A0A0V0X0B70.000e+038.99Transposon Ty3-G Gag-Pol polyprotein OS=Trichinell... [more]
A0A4Y2GV680.000e+038.75Transposon Ty3-I Gag-Pol polyprotein OS=Araneus ve... [more]
A0A1Y1KUJ80.000e+039.83Uncharacterized protein (Fragment) OS=Photinus pyr... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000042253.19.206e-16132.87pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000034038.14.092e-15633.70pep primary_assembly:Astyanax_mexicanus-2.0:14:312... [more]
ENSAMXT00000041682.11.030e-15535.52pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000048059.11.115e-15334.67pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000045469.17.982e-15233.92pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000004121.11.023e-2526.87pep scaffold:Pmarinus_7.0:GL477387:93825:107330:1 ... [more]
ENSPMAT00000004123.12.540e-2427.17pep scaffold:Pmarinus_7.0:GL477387:93825:107321:1 ... [more]
ENSPMAT00000009777.11.755e-1925.94pep scaffold:Pmarinus_7.0:GL476990:135790:139231:-... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO338755.099e-1230.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000036827.17.966e-16735.16pep primary_assembly:ASM223467v1:16:28613823:28617... [more]
ENSORLT00000045600.13.047e-15034.05pep primary_assembly:ASM223467v1:4:26167161:261711... [more]
ENSORLT00000039099.13.102e-15034.80pep primary_assembly:ASM223467v1:16:31928608:31932... [more]
ENSORLT00000029819.18.257e-15034.62pep primary_assembly:ASM223467v1:24:6358775:636291... [more]
ENSORLT00000040501.13.489e-14934.05pep primary_assembly:ASM223467v1:1:1251188:1255180... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080881.10.000e+069.63SMESG000080881.1[more]
SMESG000057446.10.000e+065.78SMESG000057446.1[more]
SMESG000045224.10.000e+046.73SMESG000045224.1[more]
SMESG000045224.10.000e+046.73SMESG000045224.1[more]
SMESG000045224.10.000e+046.73SMESG000045224.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003204 ID=SMED30003204|Name=Transposon Ty3-I Gag-Pol polyprotein|organism=Schmidtea mediterranea sexual|type=transcript|length=3277bp
TGATAAAACAGTATCACTAAAACCAAAAACAAAATTGGGAAAACTAACGA
AGATGTTAAAAATTGGAAATAAAAAGTTACCAAAAAATATTAAGATATAT
AAATAACCCCAAATCACTAGTAAAGAATTGTCGGAAGAGCAAATACAAAT
ATTCACCAAATTACTGATCAAGTATCAAGATATTTTCGCATAACACGAAT
ATGATTTGGGCGTGAATTCAATAATAGAACACGAAATCCCATTAATGGAT
GAAACTCCAATCAAGTTACGACCATATAGAATTCCATATGCACATCAAGA
TGAGAGTGATAGACAAATAAAAGCCATGAAGGAATTTAATATCATAAGAG
ACAGTTTTTCACCATTCTCATCATCCATAGTAGTTGTAAAGAAAAAAGAT
GGCTAATTAAGATTTTGTGTTGATTATCGAAAATTGAACCAAGTTACGAG
AAAAGATACATATCCAATTCCAGTTCCTCAAGAAATGTTTGATCGAATGG
GAGAATCACAGTAATTCACTGTTATTGATTTAAACAAAGGTTATAATCAG
TTCAAAGTCAAGGAAGAAGATAAAGGAAAAACCGCGTTTTCAGATGGAAA
AGGTTTGTATGAATTTAATGTTTTATCTTTTGCTTTAACAGGTGCTCCAG
CCACCTTTCAAAGGGGCATGAATTTCGTATTGCGAGATATTCCACATGCA
TTAGTTTATATCGATGATATTATAATATTTTCAAGCTATTTTAATGAACA
TATGAAAGATGTCGAAATGGTGTTCAAACAACTTAGAGAAGCGAATCTGA
AAATCAAACCCTCAAAGTGCGAATGGGGAAAATCGGAAGTAACGTATGTT
GGACATATTATATCACGAAAAGGTCTTCAACCAAATCCAGATAATGTAAA
GAAAATTGAAAACTATCCAACTCCTAAAAATGTCGATAATGTCAGACAAT
TCCTTGGATTAGCAAGCTATTATCGAAAATTTATTAAACACTTTGCACAT
ATTGCCCAGCCACTGACAATGTTATTAAAGAAAACTACAAAATTTGTGTG
GTGACAAGCCCAACAAAATGTATTTGATACCTTCAAACAAAAGTTGATAA
TGAACCCAATATTAAGATATCCAGATTTTACGAAAACATTTATGGTAATG
ACAGACGCAAGCAATTGCGCACTAGGAGCAGTGTTGGGACAACAAGTTGA
AGGTGAGAAGGATCACGTAATCACATATGCAAGTCGATCATTAAAACCCC
ATGAAAAGAACTATTCAACCATTGAAAAAGAAACTCTAGCTTTAGTATAT
GGAATAACAACATTTCGTCAATATTTGGTTGGTAGAAAATTCATTGTTTA
TACGGACCATAACCCATTACAATGGCTAATGAAACACCGAGATGCAGCAA
GTAAGTTAATCAGATGGTCGTTAGCTTTACAAGAATACGATTTTGAGATC
AAATATCGTACAGGAAAATCCAATGCTGAAGCGGATGCTTTATCAAGAAT
CTCTAGTAATGAAATTAATAATAATGAAGAGGAAATAAAATTGAGAGATA
CAATATTCGCTTTAATAAAAGCAGCAAATAATGTACCTGAGTTTCAACGA
GAACAAGAAATGGATGAAGAATTAAAACAGATAATAAGGCATACAGTAAT
AATCCAAAAGGATAGTGAATTAAAACAAATAATTGATGAAAGGCATAAAT
ACGTAATTCATGAAGGGATTTTGAAATATATTCATTACAATGAATTGCGA
ATAGTAGTTCCAAACAAGCATAGAGATGCATTGTTATTACAGTATCATGA
TGGTGTTCTGGGAGGACATTTATCTGCAAGAAAAACGCTATCGCGATTAA
AGTTAAAGTATTTTTGGAGAACAATGGAGCAAGATGTCAAAAAATGGTGC
GGCTCTTGTAAGATATGCCTGACTCGAAGTAACACTGGGAAAAAAATAAA
AGTCCCGCTCAAGCCAACGCCTATACCGGCAGCTCCAATGGAAATAGCAG
CGATGGATATCGTCGGGCCTTTACCCGAGACAACAAATGGAAATAAATAC
ATTATTGTATTCTGTGACTATTTAACAAAATGGCCAGAAGCATATGCTAT
GCCTAATCAAAAAGCTGAAATGGTTGCTCAGATATTCATTGAAAATATTA
TATTCAGATACGGAGCTCCAAAGAAATTATTGACAGATCAAGGGACAAAT
TTTCAAAGTGAATTATTCAAATCCATAACAGAGTTATTTTGAATTCATAA
ATTAAATACGTCTCCATATCACCCTCAAACAGATGGGTTGGTTGAAAGAT
TCAATGGTACCTTGATAAATATGATTTCATCATACGTAAATCGCAAACAA
AGAGATTGGTATTTATTTATTCAGTCATGTTTGTTTGTACATAGAAATGC
AGTAAATGAAAGTACTGGAGAAACGCCTTTCTACTTAATGTATTTAAAAC
GGAACAATATGCCAATTGATTTAGAATTTCAATCCCCAACTTCTCAATAC
TTGGATATTCCAAACTATAAAGTTATAATGCAAGAAAGACTCCAATCAGC
TTGGATAAAAGCTGGATTAAAAATAAAATATCGCCAAGAGCAATACAAAG
AAACCTATGATAAAAAAGCGCGCATGAGCACGGCATTACAATTGGAGATC
TAGTATATCTAAATCGACCTGAGCCAGTTAAAGGATTGTCAACAAAATTG
CAGAGGCCATTCAAAGGTCCGTATATAGTTTGTGATTCAACAGCAACAAA
TCTAAAATTGCGTCCAATTAATAATAAAAGAGCAGAGACAATTGTTGTTC
ACTCTAATCGATGTAAAAAAATACCTAAATCAGAATATCCACTGCGGTCA
AAACAAAGGAAAACAAAAGATGAAATTAATGTTCAACAAAAATTTCAAAA
AAATCCAACTCCGTTGAGTTATTTGAATAAAGTCTTATTTATCACTGCGG
TAATGATAAATATCGTAACCAATGTTAAAGGAACCAAAATCAACCTACTC
TGTGTAGTTAAAAAAGTACCATTATTGGGTAAAATCGATATCTTTTCAAC
AGTCCCTGGTGTAATATGGATTTGTCTTTGCGGAATAACGGATGGAATCG
AAGTTGGTTATTTATCAGATCTATCCAAGTCATTTATGAATCATGAGAAA
CATGTATATGTGGCTCGACAATTAACGACGAATTACAAATATCCTTGGGT
AATCAGACAATATAATTTTCAAACAAATAGAAATAAAAACATCTAAAACT
TCATACGGATTTATATTTGGATAAAAA
back to top

protein sequence of SMED30003204-orf-1

>SMED30003204-orf-1 ID=SMED30003204-orf-1|Name=SMED30003204-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp
MISSYVNRKQRDWYLFIQSCLFVHRNAVNESTGETPFYLMYLKRNNMPID
LEFQSPTSQYLDIPNYKVIMQERLQSAWIKAGLKIKYRQEQYKETYDKKA
RMSTALQLEI*
back to top

protein sequence of SMED30003204-orf-2

>SMED30003204-orf-2 ID=SMED30003204-orf-2|Name=SMED30003204-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=129bp
MNFVLRDIPHALVYIDDIIIFSSYFNEHMKDVEMVFKQLREANLKIKPSK
CEWGKSEVTYVGHIISRKGLQPNPDNVKKIENYPTPKNVDNVRQFLGLAS
YYRKFIKHFAHIAQPLTMLLKKTTKFVW*
back to top

protein sequence of SMED30003204-orf-3

>SMED30003204-orf-3 ID=SMED30003204-orf-3|Name=SMED30003204-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=381bp
MNPILRYPDFTKTFMVMTDASNCALGAVLGQQVEGEKDHVITYASRSLKP
HEKNYSTIEKETLALVYGITTFRQYLVGRKFIVYTDHNPLQWLMKHRDAA
SKLIRWSLALQEYDFEIKYRTGKSNAEADALSRISSNEINNNEEEIKLRD
TIFALIKAANNVPEFQREQEMDEELKQIIRHTVIIQKDSELKQIIDERHK
YVIHEGILKYIHYNELRIVVPNKHRDALLLQYHDGVLGGHLSARKTLSRL
KLKYFWRTMEQDVKKWCGSCKICLTRSNTGKKIKVPLKPTPIPAAPMEIA
AMDIVGPLPETTNGNKYIIVFCDYLTKWPEAYAMPNQKAEMVAQIFIENI
IFRYGAPKKLLTDQGTNFQSELFKSITELF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001584Integrase_cat-core
IPR012337RNaseH-like_sf
IPR000477RT_dom
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0004190aspartic-type endopeptidase activity