Eukaryotic initiation factor 4A-I

Overview
NameEukaryotic initiation factor 4A-I
Smed IDSMED30003202
Uniprot Best hitATP-dependent RNA helicase eIF4A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF1 PE=3 SV=1 (E=0)
Length (bp)1324
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Eukaryotic initiation factor 4A-I (SMED30003202) t-SNE clustered cells

Violin plots show distribution of expression levels for Eukaryotic initiation factor 4A-I (SMED30003202) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Human
Match: EIF4A1 (eukaryotic translation initiation factor 4A1 [Source:HGNC Symbol;Acc:HGNC:3282])

HSP 1 Score: 523.857 bits (1348), Expect = 0.000e+0
Identity = 253/390 (64.87%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLE-SGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+++IV+SF+D+NL E LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ I+  + +TQA++LAPTRELA QI KV+M LGDYMGA C +CIGG NVR ++  L+    H++VGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + +  Q L++ TQ  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT++D   ++++E FYNT IEEMP+N+++ +
Sbjct:   17 MEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Human
Match: EIF4A2 (eukaryotic translation initiation factor 4A2 [Source:HGNC Symbol;Acc:HGNC:3284])

HSP 1 Score: 516.153 bits (1328), Expect = 1.416e-180
Identity = 250/390 (64.10%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            M+  G IESN+++IV++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q L+   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT++D   ++++E FYNT +EEMP+N+++ +
Sbjct:   18 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 407          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Human
Match: EIF4A2 (eukaryotic translation initiation factor 4A2 [Source:HGNC Symbol;Acc:HGNC:3284])

HSP 1 Score: 515.768 bits (1327), Expect = 1.709e-180
Identity = 250/390 (64.10%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            M+  G IESN+++IV++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q L+   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT++D   ++++E FYNT +EEMP+N+++ +
Sbjct:   19 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 408          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Human
Match: EIF4A2 (eukaryotic translation initiation factor 4A2 [Source:HGNC Symbol;Acc:HGNC:3284])

HSP 1 Score: 480.33 bits (1235), Expect = 2.785e-167
Identity = 221/342 (64.62%), Postives = 286/342 (83.63%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIH 1033
            M+  G IESN+++IV++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q L+   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIH
Sbjct:   18 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIH 359          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Human
Match: EIF4A3 (eukaryotic translation initiation factor 4A3 [Source:HGNC Symbol;Acc:HGNC:18683])

HSP 1 Score: 474.552 bits (1220), Expect = 2.935e-164
Identity = 225/376 (59.84%), Postives = 306/376 (81.38%), Query Frame = 2
Query:   50 IVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +  +F+ + L+EDLLRGI+AYGFEKPSAIQ+RAI   I+G DVIAQ+QSGTGKTATFSI+VLQ +D  +  TQA+ILAPTRELAVQI K ++ LGDYM  +C +CIGG NV +DI  L+ G HVV GTPGRV DMI++  +++  +KM VLDEADEML++GF+  + +  +YL   TQ  ++SAT+P E+L+++N+FM +P++ILVK++ELTLEGI+QF+V V +EE+KFDTLCDLY++LTITQAVIFCN K KV +L + ++   F VSS+HGDM Q+ R+ IMKEFRSG+SR+LI+TD+  RG+DV QVS++INYDLP N+E YIHRIGR GR+GRKGVA+NFV + DI  ++++E +Y+T+I+EMP+N+++ +
Sbjct:   36 VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 411          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Celegans
Match: inf-1 (Eukaryotic initiation factor 4A [Source:UniProtKB/Swiss-Prot;Acc:P27639])

HSP 1 Score: 492.271 bits (1266), Expect = 7.923e-172
Identity = 241/385 (62.60%), Postives = 306/385 (79.48%), Query Frame = 2
Query:   23 GEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            G IE NYD++VESF+D+ LKE+LLRGI+ +GFEKPSAIQKRAI+P   G DVIAQAQSGTGKTATFS+++LQ ID      QA+++APTRELA QI KV+  LG+Y+      CIGG +VRDD   LE+G+HVVVGTPGRV DMI +  + +  +KMFVLDEADEMLSRGF++ + E  + +  + Q  +LSATMP EVL V+N FM NP++ILVKK+ELTLEGIRQFY+NV ++E+KFD LCDLY  + +TQAVIFCN + KV  L + +    F VS +HGDM+Q  RD IM+EFRSGSSR+LITTD+L RGIDVQQVS+VINYDLP N+ENYIHRIGR GRFGRKGVA+NFVT+ D  +++E+E++Y T+IEEMP ++++ +
Sbjct:   18 GLIEGNYDQVVESFDDMELKEELLRGIYGFGFEKPSAIQKRAIVPCTTGKDVIAQAQSGTGKTATFSVSILQRIDHEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSVRDDQRKLEAGIHVVVGTPGRVGDMINRNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRFMRNPIRILVKKDELTLEGIRQFYINVQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVDTLTEKMTENQFTVSCLHGDMDQAERDTIMREFRSGSSRVLITTDILARGIDVQQVSLVINYDLPSNRENYIHRIGRSGRFGRKGVAINFVTENDARQLKEIESYYTTQIEEMPESIADLI 402          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Celegans
Match: inf-1 (Eukaryotic initiation factor 4A [Source:UniProtKB/Swiss-Prot;Acc:P27639])

HSP 1 Score: 492.271 bits (1266), Expect = 7.923e-172
Identity = 241/385 (62.60%), Postives = 306/385 (79.48%), Query Frame = 2
Query:   23 GEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            G IE NYD++VESF+D+ LKE+LLRGI+ +GFEKPSAIQKRAI+P   G DVIAQAQSGTGKTATFS+++LQ ID      QA+++APTRELA QI KV+  LG+Y+      CIGG +VRDD   LE+G+HVVVGTPGRV DMI +  + +  +KMFVLDEADEMLSRGF++ + E  + +  + Q  +LSATMP EVL V+N FM NP++ILVKK+ELTLEGIRQFY+NV ++E+KFD LCDLY  + +TQAVIFCN + KV  L + +    F VS +HGDM+Q  RD IM+EFRSGSSR+LITTD+L RGIDVQQVS+VINYDLP N+ENYIHRIGR GRFGRKGVA+NFVT+ D  +++E+E++Y T+IEEMP ++++ +
Sbjct:   18 GLIEGNYDQVVESFDDMELKEELLRGIYGFGFEKPSAIQKRAIVPCTTGKDVIAQAQSGTGKTATFSVSILQRIDHEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSVRDDQRKLEAGIHVVVGTPGRVGDMINRNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRFMRNPIRILVKKDELTLEGIRQFYINVQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVDTLTEKMTENQFTVSCLHGDMDQAERDTIMREFRSGSSRVLITTDILARGIDVQQVSLVINYDLPSNRENYIHRIGRSGRFGRKGVAINFVTENDARQLKEIESYYTTQIEEMPESIADLI 402          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Celegans
Match: Y65B4A.6 (pep:known chromosome:WBcel235:I:631055:636350:-1 gene:WBGene00022029 transcript:Y65B4A.6a gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y65B4A.6)

HSP 1 Score: 471.085 bits (1211), Expect = 1.625e-163
Identity = 225/385 (58.44%), Postives = 314/385 (81.56%), Query Frame = 2
Query:   26 EIESNYD-KIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            E ES+ +  I+ +F+ + L+EDLLRGI+AYGFEKPSAIQ+RAI   ++  DVIAQAQSGTGKTATFSI+VLQ++DT +  TQA+IL+PTRELAVQI KV++ LGDYM  +C +CIGG N+ +DI  L+ G HVV GTPGRV DMI++ ++++  +K+ VLDEADEML++GF+  + +  +YL    Q  +LSAT+P E+L+++++FM +P++ILVK++ELTLEGI+QF+V V +EE+KFDTL DLY++LTITQAV+FCN + KV +L D +K   F VSS+HGDMEQ+ RD++MKEFR+G++R+LI+TD+  RG+DV QVS+VINYDLP N+E YIHRIGR GRFGRKGVA+NFV   D+  ++++E +Y+T+I+EMP+N+++ +
Sbjct:   15 EFESSEEVSIIPTFDKMGLREDLLRGIYAYGFEKPSAIQQRAIPAILKARDVIAQAQSGTGKTATFSISVLQSLDTQVRETQALILSPTRELAVQIQKVVLALGDYMNVQCHACIGGTNLGEDIRKLDYGQHVVSGTPGRVFDMIRRRNLRTRAIKLLVLDEADEMLNKGFKEQLYDIYRYLPPGAQVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVDREEWKFDTLIDLYDTLTITQAVLFCNTRRKVDWLTDKMKEANFTVSSMHGDMEQKDRDEVMKEFRAGTTRVLISTDVWARGLDVPQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKQDDVRILRDIEQYYSTQIDEMPMNIADII 399          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Celegans
Match: F33D11.10 (pep:known chromosome:WBcel235:I:5866563:5868139:-1 gene:WBGene00018007 transcript:F33D11.10 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F33D11.10)

HSP 1 Score: 470.315 bits (1209), Expect = 4.008e-163
Identity = 223/385 (57.92%), Postives = 314/385 (81.56%), Query Frame = 2
Query:   26 EIESNYD-KIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            E ES+ +  ++ +F+ + L+EDLLRGI+AYGFEKPSAIQ+RA+   ++  DVIAQAQSGTGKTATFSI+VLQ++DT +  TQA+IL+PTRELAVQI KV++ LGDYM  +C +CIGG N+ +DI  L+ G HVV GTPGRV DMI++ ++++  +K+ VLDEADEML++GF+  + +  +YL    Q  +LSAT+P E+L+++++FM +P++ILVK++ELTLEGI+QF+V V +EE+KFDTL DLY++LTITQAV+FCN + KV +L D +K   F VSS+HGDMEQ+ RD++MKEFR+G++R+LI+TD+  RG+DV QVS+VINYDLP N+E YIHRIGR GRFGRKGVA+NFV   D+  ++++E +Y+T+I+EMP+N+++ +
Sbjct:   15 EFESSEEVNVIPTFDKMGLREDLLRGIYAYGFEKPSAIQQRAVPAILKARDVIAQAQSGTGKTATFSISVLQSLDTQVRETQALILSPTRELAVQIQKVVLALGDYMNVQCHACIGGTNLGEDIRKLDYGQHVVSGTPGRVFDMIRRRNLRTRAIKLLVLDEADEMLNKGFKEQLYDIYRYLPPGAQVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVDREEWKFDTLIDLYDTLTITQAVLFCNTRRKVDWLTDKMKEANFTVSSMHGDMEQKDRDEVMKEFRAGTTRVLISTDVWARGLDVPQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKQDDVRILRDIEQYYSTQIDEMPMNIADII 399          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Celegans
Match: F57B9.3 (pep:known chromosome:WBcel235:III:6939888:6941736:1 gene:WBGene00018997 transcript:F57B9.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57B9.3)

HSP 1 Score: 339.347 bits (869), Expect = 4.347e-112
Identity = 179/382 (46.86%), Postives = 265/382 (69.37%), Query Frame = 2
Query:   32 ESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            E NYD++VESF+D+ LKE+LLRGI+ +GFEKPSAIQK A+ P   G DV  Q+Q+G+GKT    I +LQ ID      Q I+LAP R +A + H+ + +LG  +     +C+G     ++    +   HV++GTP   KD +      +  +KMFVLDEADEMLS+GF++ + E  + +  + Q  +LSATMP EVL V+N FM +P++ILVKK+ELTLEGIRQFY+NV ++E+KF+ LCDL ++   TQA+IFCN + +V  L + L S    VS  HG+ME   R+ ++K+F S ++R+L+TTDL+ RG+++++ S++INYD+  N ENY+ R GR G FG KG+ ++F T+ DI++++++EN Y+T+IEEMP +  E+L
Sbjct:   19 EGNYDEVVESFDDMELKEELLRGIYGFGFEKPSAIQKSAVAPCTTGKDVTIQSQAGSGKTVISLIDILQGIDCEDAHLQVILLAPQRGMAQRAHEQLKSLGRNLNVNA-TCLGFDTTAEN----DKISHVLMGTP---KDFLSNIPSDTSRIKMFVLDEADEMLSKGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRFMRDPIRILVKKDELTLEGIRQFYINVQKDEWKFNCLCDLLKTSRETQALIFCNTRRRVTQLTEQLMSIPIKVSCFHGNMEHNEREDMVKDFNSRNTRVLVTTDLMARGMNIRK-SLIINYDVSGNMENYMLRNGRQGNFGSKGLPISFFTENDISDLKKIENHYSTRIEEMPESFLEYL 391          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Fly
Match: eIF-4a (Eukaryotic initiation factor 4a [Source:FlyBase gene name;Acc:FBgn0001942])

HSP 1 Score: 502.671 bits (1293), Expect = 1.002e-175
Identity = 250/390 (64.10%), Postives = 315/390 (80.77%), Query Frame = 2
Query:    8 TMENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +ME  G IES + ++ ++F+D+NL+E+LLRGI+ YGFEKPSAIQ+RAI+P + G DVIAQAQSGTGKTATFSIA+LQ IDTSI   QA+ILAPTRELA QI +V+M LG+YM     +CIGG NVR+D   LESG HVVVGTPGRV DMI +  +++ ++K+FVLDEADEMLSRGF++ + +  + L  + Q  +LSATMP +VL+VS  FM +PV ILVKKEELTLEGI+QFYVNV QE +K  TLCDLY++L+ITQ+VIFCN + KV  L   +    F VS++HGDMEQ+ R+ IMK+FRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NF+TD D   ++++E FY+T IEEMP N+++ +
Sbjct:   14 SMEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Fly
Match: eIF-4a (Eukaryotic initiation factor 4a [Source:FlyBase gene name;Acc:FBgn0001942])

HSP 1 Score: 502.671 bits (1293), Expect = 1.002e-175
Identity = 250/390 (64.10%), Postives = 315/390 (80.77%), Query Frame = 2
Query:    8 TMENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +ME  G IES + ++ ++F+D+NL+E+LLRGI+ YGFEKPSAIQ+RAI+P + G DVIAQAQSGTGKTATFSIA+LQ IDTSI   QA+ILAPTRELA QI +V+M LG+YM     +CIGG NVR+D   LESG HVVVGTPGRV DMI +  +++ ++K+FVLDEADEMLSRGF++ + +  + L  + Q  +LSATMP +VL+VS  FM +PV ILVKKEELTLEGI+QFYVNV QE +K  TLCDLY++L+ITQ+VIFCN + KV  L   +    F VS++HGDMEQ+ R+ IMK+FRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NF+TD D   ++++E FY+T IEEMP N+++ +
Sbjct:   14 SMEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Fly
Match: eIF-4a (Eukaryotic initiation factor 4a [Source:FlyBase gene name;Acc:FBgn0001942])

HSP 1 Score: 502.671 bits (1293), Expect = 1.002e-175
Identity = 250/390 (64.10%), Postives = 315/390 (80.77%), Query Frame = 2
Query:    8 TMENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +ME  G IES + ++ ++F+D+NL+E+LLRGI+ YGFEKPSAIQ+RAI+P + G DVIAQAQSGTGKTATFSIA+LQ IDTSI   QA+ILAPTRELA QI +V+M LG+YM     +CIGG NVR+D   LESG HVVVGTPGRV DMI +  +++ ++K+FVLDEADEMLSRGF++ + +  + L  + Q  +LSATMP +VL+VS  FM +PV ILVKKEELTLEGI+QFYVNV QE +K  TLCDLY++L+ITQ+VIFCN + KV  L   +    F VS++HGDMEQ+ R+ IMK+FRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NF+TD D   ++++E FY+T IEEMP N+++ +
Sbjct:   14 SMEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Fly
Match: eIF-4a (Eukaryotic initiation factor 4a [Source:FlyBase gene name;Acc:FBgn0001942])

HSP 1 Score: 502.671 bits (1293), Expect = 1.002e-175
Identity = 250/390 (64.10%), Postives = 315/390 (80.77%), Query Frame = 2
Query:    8 TMENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +ME  G IES + ++ ++F+D+NL+E+LLRGI+ YGFEKPSAIQ+RAI+P + G DVIAQAQSGTGKTATFSIA+LQ IDTSI   QA+ILAPTRELA QI +V+M LG+YM     +CIGG NVR+D   LESG HVVVGTPGRV DMI +  +++ ++K+FVLDEADEMLSRGF++ + +  + L  + Q  +LSATMP +VL+VS  FM +PV ILVKKEELTLEGI+QFYVNV QE +K  TLCDLY++L+ITQ+VIFCN + KV  L   +    F VS++HGDMEQ+ R+ IMK+FRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NF+TD D   ++++E FY+T IEEMP N+++ +
Sbjct:   14 SMEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Fly
Match: eIF-4a (Eukaryotic initiation factor 4a [Source:FlyBase gene name;Acc:FBgn0001942])

HSP 1 Score: 502.671 bits (1293), Expect = 1.002e-175
Identity = 250/390 (64.10%), Postives = 315/390 (80.77%), Query Frame = 2
Query:    8 TMENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +ME  G IES + ++ ++F+D+NL+E+LLRGI+ YGFEKPSAIQ+RAI+P + G DVIAQAQSGTGKTATFSIA+LQ IDTSI   QA+ILAPTRELA QI +V+M LG+YM     +CIGG NVR+D   LESG HVVVGTPGRV DMI +  +++ ++K+FVLDEADEMLSRGF++ + +  + L  + Q  +LSATMP +VL+VS  FM +PV ILVKKEELTLEGI+QFYVNV QE +K  TLCDLY++L+ITQ+VIFCN + KV  L   +    F VS++HGDMEQ+ R+ IMK+FRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NF+TD D   ++++E FY+T IEEMP N+++ +
Sbjct:   14 SMEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Zebrafish
Match: eif4a1a (eukaryotic translation initiation factor 4A1A [Source:ZFIN;Acc:ZDB-GENE-031030-2])

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 257/390 (65.90%), Postives = 329/390 (84.36%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGM-HVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+ +IV+SF+D+NL+E LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ ID  + +TQA++LAPTRELA QI KV++ LGDYMGA C +CIGG NVR+D+  L++ + H+VVGTPGRV DM+ + ++   ++KMF LDEADEMLSRGF++ + E  Q L+ +TQ  +LSATMP EVL+V+ +FM +PV+ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDMEQ+ RD IMKEFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N +T+ D   ++++E FYNT +EEMP+N+++ +
Sbjct:   17 MEPDGVIESNWKEIVDSFDDMNLREALLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDVELKATQAMVLAPTRELAQQIQKVVLALGDYMGATCHACIGGTNVRNDVQKLQADVPHIVVGTPGRVFDMLNRRYLSPKYIKMFALDEADEMLSRGFKDQIYEIFQKLATDTQVILLSATMPQEVLEVTTKFMRDPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMEQKERDVIMKEFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMITEDDKRTLRDIETFYNTTVEEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Zebrafish
Match: eif4a1b (eukaryotic translation initiation factor 4A1B [Source:ZFIN;Acc:ZDB-GENE-040120-6])

HSP 1 Score: 528.865 bits (1361), Expect = 0.000e+0
Identity = 259/390 (66.41%), Postives = 325/390 (83.33%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+D+IV+SF+D+NL+E LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ ID  +  TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ +  + S ++KMFVLDEADEMLSRGF++ + E  Q LS   Q  +LSATMP EVL V+ +FM  PV+ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT+ D   ++++E FYNT +EEMP+N+++ +
Sbjct:   17 MEPDGVIESNWDEIVDSFDDMNLRETLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDIELKGTQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEVQKLQAEAPHIVVGTPGRVYDMLNRKFLSSKYIKMFVLDEADEMLSRGFKDQIYEIFQKLSTSIQVVLLSATMPAEVLDVTTKFMREPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKDRDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Zebrafish
Match: eif4a2 (eukaryotic translation initiation factor 4A, isoform 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2802])

HSP 1 Score: 515.768 bits (1327), Expect = 1.115e-180
Identity = 252/390 (64.62%), Postives = 326/390 (83.59%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+++I ++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q LS   Q  +LSATMP +VL+V+ +FM  PV+ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT++D   ++++E FYNT +EEMP+N+++ +
Sbjct:   22 MEPDGVIESNWNEITDNFDDMNLKETLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEQKETQALVLAPTRELAQQIQKVILALGDYMGASCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLSTNIQVVLLSATMPADVLEVTTKFMREPVRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 411          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Zebrafish
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:ZFIN;Acc:ZDB-GENE-040426-915])

HSP 1 Score: 469.929 bits (1208), Expect = 1.163e-162
Identity = 223/376 (59.31%), Postives = 305/376 (81.12%), Query Frame = 2
Query:   50 IVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +  +F+ + L+EDLLRGI+AYGFEKPSAIQ+RAI   I+G DVIAQ+QSGTGKTATF ++VLQ +D  +  TQA+ILAPTRELA QI KV++ LGDYM  +C +CIGG NV +DI  L+ G HVV GTPGRV DMI++  +++  +KM VLDEADEML++GF+  + +  +YL   TQ  ++SAT+P E+L+++N+FM +P++ILVK++ELTLEGI+QF+V V +EE+KFDTLCDLY++LTITQAVIFCN K KV +L + ++   F VSS+HGDM Q+ R+ IMKEFRSG+SR+LI+TD+  RG+DV QVS++INYDLP N+E YIHRIGR GR+GRKGVA+NFV + DI  ++++E +Y+T+I+EMP+N+++ +
Sbjct:   31 VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDIQVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVCLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Zebrafish
Match: ddx6 (DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN;Acc:ZDB-GENE-070912-83])

HSP 1 Score: 277.33 bits (708), Expect = 1.044e-86
Identity = 157/373 (42.09%), Postives = 235/373 (63.00%), Query Frame = 2
Query:   62 FEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGA-KCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            FED  LK +LL GIF  G+EKPS IQ+ +I  A+ G D++A+A++GTGK+  + I +L+ ID   +S QA+++ PTRELA+Q+ ++ + +  +MG  K  +  GG N+RDDI  L+  +HVV+ TPGR+ D+IKKG  K   V+M VLDEAD++LS+ F   + E +  LS + Q  + SAT P  V K  N  +  P +I +  EELTL+G+ Q+Y  V+ E  K   L  L+  L I Q++IFCN   +V  L   +   G+    +H  M Q+ R+++  +FR+G  R L+ TDL  RGID+Q V++VIN+D PK  E Y+HRIGR GRFG  G+A+N +T  D   ++ +E    T+I+ +P ++ + L
Sbjct:   99 FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDSIQAVVIVPTRELALQVSQICIQVSKHMGGVKVMATTGGTNLRDDIMRLDETVHVVIATPGRILDLIKKGVAKVGQVQMIVLDEADKLLSQDFVQMMEEILSSLSKQRQILLYSATFPLSVQKFMNSHLQKPYEINLM-EELTLKGVTQYYAYVT-ERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLGETYLHRIGRSGRFGHLGLAINLITYDDRFNLKGIEEQLGTEIKPIPSSIDKSL 469          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Xenopus
Match: eif4a1 (eukaryotic translation initiation factor 4A1 [Source:Xenbase;Acc:XB-GENE-491256])

HSP 1 Score: 520.776 bits (1340), Expect = 0.000e+0
Identity = 251/390 (64.36%), Postives = 327/390 (83.85%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN++++V+SF+D++L E LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ I+  + +TQA++LAPTRELA QI KV+M LGDYMGA C +CIGG NVR ++  L+S   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + +  Q LS+  Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT+ D   ++++E FYNT +EEMP+N+++ +
Sbjct:   17 MEPDGVIESNWNEVVDSFDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQQIELDMKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQSEAPHIVVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLSSNAQVVLLSATMPADVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Xenopus
Match: eif4a2 (eukaryotic translation initiation factor 4A2 [Source:Xenbase;Acc:XB-GENE-978554])

HSP 1 Score: 518.464 bits (1334), Expect = 0.000e+0
Identity = 251/390 (64.36%), Postives = 329/390 (84.36%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            M+  G IESN+++IV++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++  +  TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q LS   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT++D   ++++E FYNT +EEMP+N+++ +
Sbjct:   18 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIDLKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLSTNIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 407          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Xenopus
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:Xenbase;Acc:XB-GENE-5773453])

HSP 1 Score: 469.544 bits (1207), Expect = 8.614e-163
Identity = 223/376 (59.31%), Postives = 305/376 (81.12%), Query Frame = 2
Query:   50 IVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +  +F+ + L+EDLLRGI+AYGFEKPSAIQ+RAI   I+G DVIAQ+QSGTGKTATF ++VLQ +D  +  TQA+ILAPTRELA QI KV++ LGDYM  +C +CIGG NV +DI  L+ G HVV GTPGRV DMI++  +++  +KM VLDEADEML++GF+  + +  +YL   TQ  ++SAT+P E+L+++N+FM +P++ILVK++ELTLEGI+QF+V V +EE+KFDTLCDLY++LTITQAVIFCN K KV +L + ++   F VSS+HGDM Q+ R+ IMKEFRSG+SR+LI+TD+  RG+DV QVS++INYDLP N+E YIHRIGR GR+GRKGVA+NFV + DI  ++++E +Y+T+I+EMP+N+++ +
Sbjct:   40 VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDIQVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVCLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 415          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Xenopus
Match: eif4a2 (eukaryotic translation initiation factor 4A2 [Source:Xenbase;Acc:XB-GENE-978554])

HSP 1 Score: 338.961 bits (868), Expect = 7.924e-114
Identity = 155/244 (63.52%), Postives = 200/244 (81.97%), Query Frame = 2
Query:  305 QIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIH 1033
            +I KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q LS   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIH
Sbjct:   21 KIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLSTNIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIH 264          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Xenopus
Match: ddx6 (DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:Xenbase;Acc:XB-GENE-922227])

HSP 1 Score: 270.396 bits (690), Expect = 2.190e-84
Identity = 152/373 (40.75%), Postives = 232/373 (62.20%), Query Frame = 2
Query:   62 FEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGA-KCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            FED  LK +LL GIF  G+EKPS IQ+ +I  A+ G D++A+A++GTGK+  + I +L+ +D   +  QA+++ PTRELA+Q+ ++ + +  +MG  K  +  GG N+RDDI  L+  +HVV+ TPGR+ D+IKKG  K D ++M VLDEAD++LS+ F   + + +  L    Q  + SAT P  V K     +  P +I +  EELTL+G+ Q+Y  V+ E  K   L  L+  L I Q++IFCN   +V  L   +   G+    +H  M Q+ R+++  +FR+G  R L+ TDL  RGID+Q V++VIN+D PK  E Y+HRIGR GRFG  G+A+N +T  D   ++ +E    T+I+ +P ++ + L
Sbjct:   97 FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDCIQAMVIVPTRELALQVSQICIQVSKHMGGVKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHIQMIVLDEADKLLSQDFVQIMEDIIITLPKNRQILLYSATFPLSVQKFMTSHLQKPYEINLM-EELTLKGVTQYYAYVT-ERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSSIDKSL 467          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Mouse
Match: Eif4a1 (eukaryotic translation initiation factor 4A1 [Source:MGI Symbol;Acc:MGI:95303])

HSP 1 Score: 523.857 bits (1348), Expect = 0.000e+0
Identity = 253/390 (64.87%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLE-SGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+++IV+SF+D+NL E LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ I+  + +TQA++LAPTRELA QI KV+M LGDYMGA C +CIGG NVR ++  L+    H++VGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + +  Q L++ TQ  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT++D   ++++E FYNT IEEMP+N+++ +
Sbjct:   17 MEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Mouse
Match: Eif4a2 (eukaryotic translation initiation factor 4A2 [Source:MGI Symbol;Acc:MGI:106906])

HSP 1 Score: 516.153 bits (1328), Expect = 0.000e+0
Identity = 250/390 (64.10%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            M+  G IESN+++IV++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q L+   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT++D   ++++E FYNT +EEMP+N+++ +
Sbjct:   18 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 407          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Mouse
Match: Eif4a2 (eukaryotic translation initiation factor 4A2 [Source:MGI Symbol;Acc:MGI:106906])

HSP 1 Score: 515.768 bits (1327), Expect = 1.127e-180
Identity = 250/390 (64.10%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            M+  G IESN+++IV++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q L+   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT++D   ++++E FYNT +EEMP+N+++ +
Sbjct:   19 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 408          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Mouse
Match: Eif4a2 (eukaryotic translation initiation factor 4A2 [Source:MGI Symbol;Acc:MGI:106906])

HSP 1 Score: 480.33 bits (1235), Expect = 1.837e-167
Identity = 221/342 (64.62%), Postives = 286/342 (83.63%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIH 1033
            M+  G IESN+++IV++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q L+   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIH
Sbjct:   18 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIH 359          
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Mouse
Match: Eif4a2 (eukaryotic translation initiation factor 4A2 [Source:MGI Symbol;Acc:MGI:106906])

HSP 1 Score: 480.33 bits (1235), Expect = 1.837e-167
Identity = 221/342 (64.62%), Postives = 286/342 (83.63%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIH 1033
            M+  G IESN+++IV++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q L+   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIH
Sbjct:   18 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIH 359          
BLAST of Eukaryotic initiation factor 4A-I vs. UniProt
Match: sp|Q2HFP1|IF4A_CHAGB (ATP-dependent RNA helicase eIF4A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF1 PE=3 SV=1)

HSP 1 Score: 526.554 bits (1355), Expect = 0.000e+0
Identity = 255/385 (66.23%), Postives = 324/385 (84.16%), Query Frame = 2
Query:   23 GEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            G+IESNYD+ V+SF+D+NLK +LLRGI+AYGFE+PSAIQ+RAI+P I+GHDVIAQAQSGTGKTATFSI+VLQ ID ++ S QA+ILAPTRELA QI KV++ +GD+M  +C +CIGG +VRDD+  L+ G  V+VGTPGRV DMI++  +K+D +KMFVLDEADEMLSRGF   + +  Q L   TQ  +LSATMP +VL+V+ +FM +PV+ILVKK+ELTLEGI+QFY+ V +E++K DTL DLYE++TITQAVIFCN + KV +L D L+++ F VS++HGDM+Q  RD IMKEFRSGSSR+LI TDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT  D+  M+E+E FY+T+IEEMP+N+++ +
Sbjct:   13 GQIESNYDETVDSFDDMNLKSELLRGIYAYGFERPSAIQQRAIMPVIKGHDVIAQAQSGTGKTATFSISVLQKIDPTVKSCQALILAPTRELAQQIQKVVIAIGDFMNIECHACIGGTSVRDDMKALQDGPQVIVGTPGRVHDMIQRRILKTDQMKMFVLDEADEMLSRGFTEQIYDIFQLLPQSTQVVLLSATMPQDVLEVTTKFMRDPVRILVKKDELTLEGIKQFYIAVEKEDWKLDTLSDLYETVTITQAVIFCNTRRKVDWLTDKLQARDFTVSAMHGDMDQTQRDLIMKEFRSGSSRVLIATDLLARGIDVQQVSLVINYDLPANRENYIHRIGRGGRFGRKGVAINFVTADDVRMMREIEQFYSTQIEEMPMNVADLI 397          
BLAST of Eukaryotic initiation factor 4A-I vs. UniProt
Match: sp|A4QVP2|IF4A_MAGO7 (ATP-dependent RNA helicase eIF4A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TIF1 PE=3 SV=1)

HSP 1 Score: 525.398 bits (1352), Expect = 0.000e+0
Identity = 256/385 (66.49%), Postives = 323/385 (83.90%), Query Frame = 2
Query:   23 GEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            G+IESNYD+ V+SF+++NLK +LLRGI+AYGFE+PSAIQ+RAI+P I+GHDVIAQAQSGTGKTATFSI+VLQ IDT++   QA+ILAPTRELA QI KV++ +GD+M  +C +CIGG +VRDD+  L+ G  VVVGTPGRV DMI++  +K+D +KMFVLDEADEMLSRGF   + +  Q L   TQ  +LSATMP +VL+V+ +FM +PV+ILVKK+ELTLEGI+QFY+ V +EE+K DTL DLYE++TITQAVIFCN + KV +L D L ++ F VS++HGDM+Q  RD IMKEFRSGSSR+LI TDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT  D+  M+E+E FY+T+IEEMP+N+++ +
Sbjct:   12 GQIESNYDETVDSFDEMNLKSELLRGIYAYGFERPSAIQQRAIMPVIKGHDVIAQAQSGTGKTATFSISVLQKIDTNVKQCQALILAPTRELAQQIQKVVVAIGDFMNIECHACIGGTSVRDDMKALQDGPQVVVGTPGRVHDMIQRRFLKTDGMKMFVLDEADEMLSRGFTEQIYDIFQLLPQSTQVVLLSATMPQDVLEVTTKFMRDPVRILVKKDELTLEGIKQFYIAVEKEEWKLDTLSDLYETVTITQAVIFCNTRRKVDWLTDKLTARDFTVSAMHGDMDQAQRDLIMKEFRSGSSRVLIATDLLARGIDVQQVSLVINYDLPANRENYIHRIGRGGRFGRKGVAINFVTADDVRMMREIEQFYSTQIEEMPMNVADLI 396          
BLAST of Eukaryotic initiation factor 4A-I vs. UniProt
Match: sp|Q7RV88|IF4A_NEUCR (ATP-dependent RNA helicase eIF4A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tif-1 PE=3 SV=2)

HSP 1 Score: 525.013 bits (1351), Expect = 0.000e+0
Identity = 256/385 (66.49%), Postives = 322/385 (83.64%), Query Frame = 2
Query:   23 GEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            G+IESNYD+ V+SF+++NLK +LLRGI+AYGFE+PSAIQ+RAI+P I+GHDVIAQAQSGTGKTATFSI+VLQ ID S+ + QA+ILAPTRELA QI KV++ +GD+M  +C +CIGG +VRDD+  L+ G  VVVGTPGRV DMI++  +K+D +KMFVLDEADEMLSRGF   + +  Q L   TQ  +LSATMP +VL+V+ +FM  PV+ILVKK+ELTLEGI+QFY+ V +EE+K DTL DLYE++TITQAVIFCN + KV +L D L ++ F VS++HGDM+Q  RD IMKEFRSGSSR+LI TDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT  D+  M+E+E FY+T+IEEMP+N+++ +
Sbjct:   13 GQIESNYDETVDSFDEMNLKPELLRGIYAYGFERPSAIQQRAIMPVIKGHDVIAQAQSGTGKTATFSISVLQKIDPSLKACQALILAPTRELAQQIQKVVVAIGDFMNIECHACIGGTSVRDDMKALQDGPQVVVGTPGRVHDMIQRRFLKTDSMKMFVLDEADEMLSRGFTEQIYDIFQLLPQSTQVVLLSATMPQDVLEVTTKFMREPVRILVKKDELTLEGIKQFYIAVEKEEWKLDTLSDLYETVTITQAVIFCNTRRKVDWLTDKLTARDFTVSAMHGDMDQAQRDLIMKEFRSGSSRVLIATDLLARGIDVQQVSLVINYDLPANRENYIHRIGRGGRFGRKGVAINFVTADDVRMMREIEQFYSTQIEEMPMNVADLI 397          
BLAST of Eukaryotic initiation factor 4A-I vs. UniProt
Match: sp|P60843|IF4A1_MOUSE (Eukaryotic initiation factor 4A-I OS=Mus musculus GN=Eif4a1 PE=1 SV=1)

HSP 1 Score: 523.857 bits (1348), Expect = 0.000e+0
Identity = 253/390 (64.87%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLE-SGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+++IV+SF+D+NL E LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ I+  + +TQA++LAPTRELA QI KV+M LGDYMGA C +CIGG NVR ++  L+    H++VGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + +  Q L++ TQ  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT++D   ++++E FYNT IEEMP+N+++ +
Sbjct:   17 MEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-I vs. UniProt
Match: sp|P60842|IF4A1_HUMAN (Eukaryotic initiation factor 4A-I OS=Homo sapiens GN=EIF4A1 PE=1 SV=1)

HSP 1 Score: 523.857 bits (1348), Expect = 0.000e+0
Identity = 253/390 (64.87%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLE-SGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+++IV+SF+D+NL E LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ I+  + +TQA++LAPTRELA QI KV+M LGDYMGA C +CIGG NVR ++  L+    H++VGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + +  Q L++ TQ  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT++D   ++++E FYNT IEEMP+N+++ +
Sbjct:   17 MEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-I vs. TrEMBL
Match: tr|A4V6N0|A4V6N0_DUGJA (eIF4A isoform 1A protein OS=Dugesia japonica PE=2 SV=1)

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 282/389 (72.49%), Postives = 346/389 (88.95%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            MENPGEIE+NY+KI ESF+D+NLKEDLLRGI+AYGFEKPSAIQ+RA+LPAIEGHDVIAQAQSGTGKTATFS+A+LQ ID + N  QA++LAPTRELA QIHKVI+ LGDYMGAK  +CIGG  V++D+ NLE+G+HV+VGTPGRV DMI++G++K++ +KMFVLDEADEMLSRGF+  +   +Q++  +TQ  +LSATMP +VL+V+ +FM +PVKILVKKEELTLEGIRQFYVNVS+E+YKF+TL DLYE+LTITQAVIFCN + KV +L ++LK+K F+VSS+HGDM+Q  RDQIMKEFRSGSSRILITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT  DI  +Q+LE++Y+T IEEMP+N+++ +
Sbjct:    1 MENPGEIETNYEKITESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVTKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNSIKMFVLDEADEMLSRGFKEQIHSVIQFIEHDTQIVLLSATMPPDVLEVTRKFMRSPVKILVKKEELTLEGIRQFYVNVSEEDYKFETLTDLYETLTITQAVIFCNTRRKVDYLTESLKAKPFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 389          
BLAST of Eukaryotic initiation factor 4A-I vs. TrEMBL
Match: tr|A0A162WHS4|A0A162WHS4_PHYB8 (Uncharacterized protein OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=PHYBLDRAFT_137088 PE=3 SV=1)

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 257/385 (66.75%), Postives = 333/385 (86.49%), Query Frame = 2
Query:   26 EIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMI-KKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            EIESN+D+IV++F+++NLK DLLRG++AYGFE+PS IQ+RAI+P ++GHDVIAQAQSGTGKTATFSI++LQ+ID S+  TQA+ILAPTRELA+QI KV++ LGD+MG +C +CIGG NVRDDI  L+SG+H+VVGTPGRV DMI  +G +K++ +KMFVLDEADEMLSRGF++ + +  Q L   TQ  +LSATMP +V++V+ +FM +P++ILVK++ELTLEGI+QFYV V +EE+K DTLCDLYE++TITQAVIFCN + KV +L D L ++ F VS++HGDM+Q  RD IMKEFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFV++ D+  M+++E FYNT+IEEMP+N+++ +
Sbjct:   13 EIESNWDEIVDNFDNMNLKTDLLRGVYAYGFERPSTIQQRAIMPVVKGHDVIAQAQSGTGKTATFSISILQSIDVSLKETQALILAPTRELALQIQKVVLALGDFMGIECHACIGGTNVRDDITKLQSGVHIVVGTPGRVFDMIDNRGALKTEHIKMFVLDEADEMLSRGFKDQIYDVFQLLPETTQVVLLSATMPSDVMEVTTKFMRDPIRILVKRDELTLEGIKQFYVAVDKEEWKLDTLCDLYETVTITQAVIFCNTRRKVDWLTDKLHAREFTVSAMHGDMDQSQRDVIMKEFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVSNDDVRMMRDIEQFYNTQIEEMPMNVADLI 397          
BLAST of Eukaryotic initiation factor 4A-I vs. TrEMBL
Match: tr|A0A162T1N1|A0A162T1N1_PHYB8 (Uncharacterized protein OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=PHYBLDRAFT_184149 PE=3 SV=1)

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 256/385 (66.49%), Postives = 333/385 (86.49%), Query Frame = 2
Query:   26 EIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIK-KGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            EIESN+D+IV++F+++NLK +LLRG++AYGFE+PS IQ+RAI+P I+GHDVIAQAQSGTGKTATFSI++LQ+ID S+  TQA+ILAPTRELA+QI KV++ LGD+MG +C +CIGG NVRDDI  L+SG+H+VVGTPGRV DMI  +G +K++ +KMFVLDEADEMLSRGF++ + +  Q L   TQ  +LSATMP +V++V+ +FM +P++ILVK++ELTLEGI+QFYV V +EE+K DTLCDLYE++TITQAVIFCN + KV +L D L ++ F VS++HG+M+Q  RD IMKEFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFV++ D+  M+++E FYNT+IEEMP+N+++ +
Sbjct:   12 EIESNWDEIVDNFDNMNLKTELLRGVYAYGFERPSTIQQRAIMPVIKGHDVIAQAQSGTGKTATFSISILQSIDVSLKHTQALILAPTRELALQIQKVVLALGDFMGIECHACIGGTNVRDDITKLQSGVHIVVGTPGRVYDMINTRGALKTEHIKMFVLDEADEMLSRGFKDQIYDVFQLLPETTQVVLLSATMPSDVMEVTTKFMRDPIRILVKRDELTLEGIKQFYVAVDKEEWKLDTLCDLYETVTITQAVIFCNTRRKVDWLTDKLHAREFTVSAMHGEMDQSQRDLIMKEFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVSNDDVRMMRDIEQFYNTQIEEMPMNVADLI 396          
BLAST of Eukaryotic initiation factor 4A-I vs. TrEMBL
Match: tr|A0A0D2WJR4|A0A0D2WJR4_CAPO3 (Eukaryotic translation initiation factor 4A isoform 1B OS=Capsaspora owczarzaki (strain ATCC 30864) GN=CAOG_001074 PE=3 SV=1)

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 257/389 (66.07%), Postives = 330/389 (84.83%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            M+  GEIESN+D++V++F+ +NL+EDLLRGI+AYGFEKPSAIQ+RAILPAI+GHDVIAQAQSGTGKTATFSI+VLQ+IDTSI   QA+ILAPTRELA QI KV++ LGDYM A C +CIGG NV++D+  L++G H+VVGTPGRV+DMI +  +++D +KMFVLDEADEMLSRGF++ + +  + +    Q  +LSATMP +VL+V+  FM NP++ILVK+EELTL+GIRQFY+ V +EE+K DTLCDLYE+L +TQAVIF N + KV +L + + +K F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NF+T  D   ++E+E FYNT+IEEMP+N+++ +
Sbjct:   31 MQPDGEIESNWDQVVDNFDAMNLREDLLRGIYAYGFEKPSAIQQRAILPAIKGHDVIAQAQSGTGKTATFSISVLQSIDTSIPHCQALILAPTRELAQQIQKVVIALGDYMNANCHACIGGTNVQEDMKKLQNGAHIVVGTPGRVQDMINRRALRTDRIKMFVLDEADEMLSRGFKDQIYDVFRLMPPTIQVVLLSATMPADVLEVTTHFMRNPIRILVKREELTLDGIRQFYIAVDKEEWKLDTLCDLYETLNVTQAVIFTNTRRKVDWLTEKMHAKDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFLTADDTRTLREIEQFYNTQIEEMPMNVADLI 419          
BLAST of Eukaryotic initiation factor 4A-I vs. TrEMBL
Match: tr|A0A182ZEM6|A0A182ZEM6_BIOGL (Uncharacterized protein OS=Biomphalaria glabrata PE=3 SV=1)

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 262/388 (67.53%), Postives = 324/388 (83.51%), Query Frame = 2
Query:   14 ENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            E  G IESNYD +V++F+D+NL+EDLLRGI+AYGFEKPSAIQ+RAILP I G DVIAQAQSGTGKTATFSIA+L+ +D +  +TQA++LAPTRELA QI KV++ LGDY+GA+C +CIGG  VR+D+  LESG HVVVGTPGRV DMI +  + +  +KMFVLDEADEMLSRGF++ + +  +Y+  E Q  +LSATMP +VL+V+  FM +PV+ILVKKEELTLEGIRQFYV V +EE+K DTLCDLYE+LTITQAVIFCN + KV +L + + S+ F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT  DI  ++++E FYNT IEEMP+++++ L
Sbjct:   76 EADGVIESNYDGVVDAFDDMNLREDLLRGIYAYGFEKPSAIQQRAILPCIAGRDVIAQAQSGTGKTATFSIAILEKLDLNNPNTQALVLAPTRELAQQIQKVVLALGDYLGAQCHACIGGTLVREDMRKLESGAHVVVGTPGRVYDMISRRALNTKDIKMFVLDEADEMLSRGFKDQIYDVFRYMPTEIQVILLSATMPSDVLEVTQRFMRDPVRILVKKEELTLEGIRQFYVQVEREEWKLDTLCDLYETLTITQAVIFCNTRRKVDWLTEKMSSRDFTVSAMHGDMNQNERDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPANRENYIHRIGRGGRFGRKGVAINFVTSDDIRTLRDIEQFYNTTIEEMPMDVADLL 463          
The following BLAST results are available for this feature:
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
EIF4A10.000e+064.87eukaryotic translation initiation factor 4A1 [Sour... [more]
EIF4A21.416e-18064.10eukaryotic translation initiation factor 4A2 [Sour... [more]
EIF4A21.709e-18064.10eukaryotic translation initiation factor 4A2 [Sour... [more]
EIF4A22.785e-16764.62eukaryotic translation initiation factor 4A2 [Sour... [more]
EIF4A32.935e-16459.84eukaryotic translation initiation factor 4A3 [Sour... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
inf-17.923e-17262.60Eukaryotic initiation factor 4A [Source:UniProtKB... [more]
inf-17.923e-17262.60Eukaryotic initiation factor 4A [Source:UniProtKB... [more]
Y65B4A.61.625e-16358.44pep:known chromosome:WBcel235:I:631055:636350:-1 g... [more]
F33D11.104.008e-16357.92pep:known chromosome:WBcel235:I:5866563:5868139:-1... [more]
F57B9.34.347e-11246.86pep:known chromosome:WBcel235:III:6939888:6941736:... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
eIF-4a1.002e-17564.10Eukaryotic initiation factor 4a [Source:FlyBase ge... [more]
eIF-4a1.002e-17564.10Eukaryotic initiation factor 4a [Source:FlyBase ge... [more]
eIF-4a1.002e-17564.10Eukaryotic initiation factor 4a [Source:FlyBase ge... [more]
eIF-4a1.002e-17564.10Eukaryotic initiation factor 4a [Source:FlyBase ge... [more]
eIF-4a1.002e-17564.10Eukaryotic initiation factor 4a [Source:FlyBase ge... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
eif4a1a0.000e+065.90eukaryotic translation initiation factor 4A1A [Sou... [more]
eif4a1b0.000e+066.41eukaryotic translation initiation factor 4A1B [Sou... [more]
eif4a21.115e-18064.62eukaryotic translation initiation factor 4A, isofo... [more]
eif4a31.163e-16259.31eukaryotic translation initiation factor 4A3 [Sour... [more]
ddx61.044e-8642.09DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
eif4a10.000e+064.36eukaryotic translation initiation factor 4A1 [Sour... [more]
eif4a20.000e+064.36eukaryotic translation initiation factor 4A2 [Sour... [more]
eif4a38.614e-16359.31eukaryotic translation initiation factor 4A3 [Sour... [more]
eif4a27.924e-11463.52eukaryotic translation initiation factor 4A2 [Sour... [more]
ddx62.190e-8440.75DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:Xenb... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-I vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Eif4a10.000e+064.87eukaryotic translation initiation factor 4A1 [Sour... [more]
Eif4a20.000e+064.10eukaryotic translation initiation factor 4A2 [Sour... [more]
Eif4a21.127e-18064.10eukaryotic translation initiation factor 4A2 [Sour... [more]
Eif4a21.837e-16764.62eukaryotic translation initiation factor 4A2 [Sour... [more]
Eif4a21.837e-16764.62eukaryotic translation initiation factor 4A2 [Sour... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-I vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2HFP1|IF4A_CHAGB0.000e+066.23ATP-dependent RNA helicase eIF4A OS=Chaetomium glo... [more]
sp|A4QVP2|IF4A_MAGO70.000e+066.49ATP-dependent RNA helicase eIF4A OS=Magnaporthe or... [more]
sp|Q7RV88|IF4A_NEUCR0.000e+066.49ATP-dependent RNA helicase eIF4A OS=Neurospora cra... [more]
sp|P60843|IF4A1_MOUSE0.000e+064.87Eukaryotic initiation factor 4A-I OS=Mus musculus ... [more]
sp|P60842|IF4A1_HUMAN0.000e+064.87Eukaryotic initiation factor 4A-I OS=Homo sapiens ... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-I vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|A4V6N0|A4V6N0_DUGJA0.000e+072.49eIF4A isoform 1A protein OS=Dugesia japonica PE=2 ... [more]
tr|A0A162WHS4|A0A162WHS4_PHYB80.000e+066.75Uncharacterized protein OS=Phycomyces blakesleeanu... [more]
tr|A0A162T1N1|A0A162T1N1_PHYB80.000e+066.49Uncharacterized protein OS=Phycomyces blakesleeanu... [more]
tr|A0A0D2WJR4|A0A0D2WJR4_CAPO30.000e+066.07Eukaryotic translation initiation factor 4A isofor... [more]
tr|A0A182ZEM6|A0A182ZEM6_BIOGL0.000e+067.53Uncharacterized protein OS=Biomphalaria glabrata P... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 272..353
e-value: 3.6E-31
score: 119.6
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 245..353
e-value: 8.4E-29
score: 100.0
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 231..392
score: 24.078
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 38..235
e-value: 6.1E-53
score: 191.9
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 50..220
score: 28.258
IPR027417P-loop containing nucleoside triphosphate hydrolaseGENE3DG3DSA:3.40.50.300coord: 225..390
e-value: 1.1E-54
score: 184.1
IPR027417P-loop containing nucleoside triphosphate hydrolaseGENE3DG3DSA:3.40.50.300coord: 11..224
e-value: 1.5E-73
score: 246.3
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 87..373
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 44..208
e-value: 5.6E-44
score: 149.8
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 166..174
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 19..47
score: 10.705
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 2..21

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR000629RNA-helicase_DEAD-box_CS
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0003743translation initiation factor activity
GO:0004386helicase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0006413translational initiation
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000002Stage 2
PLANA:0000004Stage 4
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0004517blastomere
PLANA:0000029primitive ectoderm
PLANA:0000212blastomere compartment
PLANA:0000058embryonic digestive system
PLANA:0000211primitive ectoderm cell
PLANA:0000023temporary embryonic pharynx
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003202 ID=SMED30003202|Name=Eukaryotic initiation factor 4A-I|organism=Schmidtea mediterranea sexual|type=transcript|length=1324bp
ATTAATAACAATGGAAAATCCAGGAGAAATAGAAAGTAATTACGACAAAA
TAGTTGAATCATTTGAAGATTTAAACTTAAAAGAAGATTTGTTAAGAGGA
ATCTTTGCTTATGGTTTTGAAAAACCTTCTGCTATTCAGAAGCGTGCTAT
TTTGCCAGCTATTGAAGGTCACGATGTCATTGCCCAAGCACAATCTGGAA
CCGGAAAAACTGCCACTTTCAGTATTGCTGTTTTGCAGAATATTGACACT
TCTATCAATTCTACACAAGCTATTATTCTAGCACCTACCAGAGAACTTGC
AGTTCAAATCCACAAAGTTATAATGACCCTTGGTGACTATATGGGAGCTA
AATGTTGCTCATGCATTGGTGGAAGAAATGTCCGTGACGACATTAACAAT
TTGGAAAGTGGAATGCATGTTGTTGTCGGTACTCCAGGACGAGTTAAAGA
TATGATAAAGAAGGGCCATATTAAATCAGATTTCGTGAAAATGTTTGTCC
TTGATGAAGCCGATGAAATGTTGAGTCGAGGTTTTCAAAATGACGTTTGT
GAATGCGTTCAATATTTATCTGCCGAAACCCAAAATTTCATTCTTTCTGC
AACAATGCCAGATGAAGTTTTAAAAGTCAGTAACGAATTCATGAATAATC
CAGTGAAAATTCTCGTTAAAAAAGAGGAATTGACTCTGGAAGGTATTCGT
CAATTCTACGTTAACGTTAGCCAAGAAGAATACAAATTTGATACCTTATG
TGATTTATATGAATCTCTGACCATCACCCAAGCTGTCATTTTCTGTAACT
TCAAAAACAAAGTTATATTTTTAAATGATAACTTGAAAAGTAAAGGATTT
GTTGTTTCATCAGTCCACGGTGACATGGAGCAACAAGCTAGAGACCAGAT
TATGAAAGAGTTCCGAAGTGGATCAAGTAGAATTCTCATCACCACAGATT
TGCTATGCCGAGGTATTGACGTCCAACAAGTCTCAATGGTCATTAATTAT
GATTTGCCTAAAAACAAAGAAAATTATATTCATCGAATTGGCAGAGGAGG
CCGATTCGGAAGGAAAGGAGTTGCACTAAATTTTGTCACAGACAAAGATA
TTGCTGAAATGCAGGAGCTGGAAAATTTTTATAACACCAAGATTGAAGAG
ATGCCCATTAATTTATCTGAATTCTTATAAATGATTTACCGCTATTTTTG
TAAATAAATTTTAATTTACAATTAAATTAGGTTATTCATAACTTCCTTTG
TTACGTAATTTTTGCTATCTTATCTATTTTTGTTAGTAATGTATTTATGC
TGCGTCACATTTTTGTTGCAAATT
back to top

protein sequence of SMED30003202-orf-1

>SMED30003202-orf-1 ID=SMED30003202-orf-1|Name=SMED30003202-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=393bp
LITMENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAI
LPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELA
VQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKD
MIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSA
TMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLC
DLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQI
MKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHRIGRGG
RFGRKGVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL*
back to top
Aliases
The feature 'Eukaryotic initiation factor 4A-I' has the following synonyms
Synonym
eIF4a-like