Eukaryotic initiation factor 4A-like Protein

Overview
NameEukaryotic initiation factor 4A-like Protein
Smed IDSMED30003202
Uniprot Best hitATP-dependent RNA helicase eIF4A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=TIF1 PE=3 SV=1 (E=0)
Length (bp)1324
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Eukaryotic initiation factor 4A-like Protein (SMED30003202) t-SNE clustered cells

Violin plots show distribution of expression levels for Eukaryotic initiation factor 4A-like Protein (SMED30003202) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Don't be a BOT, type this for download: B07F86hE

 

back to top

Expression Details

Eukaryotic initiation factor 4A-like Protein ( eIF4a-like ) is expressed during Stage 2, Stage 3 and Stage 4 in the embryonic digestive system, embryonic pharynx, primitive ectoderm, primitive ectoderm cell and blastomere

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30003202

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
embryonic pharynxSMED30003202 SMED30003202smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
primitive gutSMED30003202 SMED30003202smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
primitive ectodermSMED30003202 SMED30003202smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
embryonic pharynxSMED30003202 SMED30003202smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
primitive gutSMED30003202 SMED30003202smed_20140614PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
embryonic pharynxSMED30003202 SMED30003202smed_20140614PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
blastomereSMED30003202 SMED30003202smed_20140614PMID:28072387whole organismStage 4fluorescence in situ hybridization evidence
blastomereSMED30003202 SMED30003202smed_20140614PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
blastomereSMED30003202 SMED30003202smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
primitive ectodermSMED30003202 SMED30003202smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
primitive ectodermSMED30003202 SMED30003202smed_20140614PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
blastomereSMED30003202 SMED30003202smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
blastomereSMED30003202 SMED30003202smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
Homology
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Human
Match: EIF4A1 (eukaryotic translation initiation factor 4A1 [Source:HGNC Symbol;Acc:HGNC:3282])

HSP 1 Score: 523.857 bits (1348), Expect = 0.000e+0
Identity = 253/390 (64.87%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLE-SGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+++IV+SF+D+NL E LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ I+  + +TQA++LAPTRELA QI KV+M LGDYMGA C +CIGG NVR ++  L+    H++VGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + +  Q L++ TQ  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT++D   ++++E FYNT IEEMP+N+++ +
Sbjct:   17 MEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Human
Match: EIF4A2 (eukaryotic translation initiation factor 4A2 [Source:HGNC Symbol;Acc:HGNC:3284])

HSP 1 Score: 516.153 bits (1328), Expect = 0.000e+0
Identity = 250/390 (64.10%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            M+  G IESN+++IV++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q L+   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT++D   ++++E FYNT +EEMP+N+++ +
Sbjct:   18 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 407          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Human
Match: EIF4A2 (eukaryotic translation initiation factor 4A2 [Source:HGNC Symbol;Acc:HGNC:3284])

HSP 1 Score: 515.768 bits (1327), Expect = 0.000e+0
Identity = 250/390 (64.10%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            M+  G IESN+++IV++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q L+   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT++D   ++++E FYNT +EEMP+N+++ +
Sbjct:   19 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 408          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Human
Match: EIF4A2 (eukaryotic translation initiation factor 4A2 [Source:HGNC Symbol;Acc:HGNC:3284])

HSP 1 Score: 480.33 bits (1235), Expect = 4.320e-169
Identity = 221/342 (64.62%), Postives = 286/342 (83.63%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIH 1033
            M+  G IESN+++IV++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q L+   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIH
Sbjct:   18 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIH 359          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Human
Match: EIF4A3 (eukaryotic translation initiation factor 4A3 [Source:HGNC Symbol;Acc:HGNC:18683])

HSP 1 Score: 474.552 bits (1220), Expect = 4.751e-166
Identity = 225/376 (59.84%), Postives = 306/376 (81.38%), Query Frame = 2
Query:   50 IVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +  +F+ + L+EDLLRGI+AYGFEKPSAIQ+RAI   I+G DVIAQ+QSGTGKTATFSI+VLQ +D  +  TQA+ILAPTRELAVQI K ++ LGDYM  +C +CIGG NV +DI  L+ G HVV GTPGRV DMI++  +++  +KM VLDEADEML++GF+  + +  +YL   TQ  ++SAT+P E+L+++N+FM +P++ILVK++ELTLEGI+QF+V V +EE+KFDTLCDLY++LTITQAVIFCN K KV +L + ++   F VSS+HGDM Q+ R+ IMKEFRSG+SR+LI+TD+  RG+DV QVS++INYDLP N+E YIHRIGR GR+GRKGVA+NFV + DI  ++++E +Y+T+I+EMP+N+++ +
Sbjct:   36 VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 411          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Celegans
Match: inf-1 (Eukaryotic initiation factor 4A [Source:UniProtKB/Swiss-Prot;Acc:P27639])

HSP 1 Score: 492.271 bits (1266), Expect = 1.213e-173
Identity = 241/385 (62.60%), Postives = 306/385 (79.48%), Query Frame = 2
Query:   23 GEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            G IE NYD++VESF+D+ LKE+LLRGI+ +GFEKPSAIQKRAI+P   G DVIAQAQSGTGKTATFS+++LQ ID      QA+++APTRELA QI KV+  LG+Y+      CIGG +VRDD   LE+G+HVVVGTPGRV DMI +  + +  +KMFVLDEADEMLSRGF++ + E  + +  + Q  +LSATMP EVL V+N FM NP++ILVKK+ELTLEGIRQFY+NV ++E+KFD LCDLY  + +TQAVIFCN + KV  L + +    F VS +HGDM+Q  RD IM+EFRSGSSR+LITTD+L RGIDVQQVS+VINYDLP N+ENYIHRIGR GRFGRKGVA+NFVT+ D  +++E+E++Y T+IEEMP ++++ +
Sbjct:   18 GLIEGNYDQVVESFDDMELKEELLRGIYGFGFEKPSAIQKRAIVPCTTGKDVIAQAQSGTGKTATFSVSILQRIDHEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSVRDDQRKLEAGIHVVVGTPGRVGDMINRNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRFMRNPIRILVKKDELTLEGIRQFYINVQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVDTLTEKMTENQFTVSCLHGDMDQAERDTIMREFRSGSSRVLITTDILARGIDVQQVSLVINYDLPSNRENYIHRIGRSGRFGRKGVAINFVTENDARQLKEIESYYTTQIEEMPESIADLI 402          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Celegans
Match: inf-1 (Eukaryotic initiation factor 4A [Source:UniProtKB/Swiss-Prot;Acc:P27639])

HSP 1 Score: 492.271 bits (1266), Expect = 1.213e-173
Identity = 241/385 (62.60%), Postives = 306/385 (79.48%), Query Frame = 2
Query:   23 GEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            G IE NYD++VESF+D+ LKE+LLRGI+ +GFEKPSAIQKRAI+P   G DVIAQAQSGTGKTATFS+++LQ ID      QA+++APTRELA QI KV+  LG+Y+      CIGG +VRDD   LE+G+HVVVGTPGRV DMI +  + +  +KMFVLDEADEMLSRGF++ + E  + +  + Q  +LSATMP EVL V+N FM NP++ILVKK+ELTLEGIRQFY+NV ++E+KFD LCDLY  + +TQAVIFCN + KV  L + +    F VS +HGDM+Q  RD IM+EFRSGSSR+LITTD+L RGIDVQQVS+VINYDLP N+ENYIHRIGR GRFGRKGVA+NFVT+ D  +++E+E++Y T+IEEMP ++++ +
Sbjct:   18 GLIEGNYDQVVESFDDMELKEELLRGIYGFGFEKPSAIQKRAIVPCTTGKDVIAQAQSGTGKTATFSVSILQRIDHEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSVRDDQRKLEAGIHVVVGTPGRVGDMINRNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRFMRNPIRILVKKDELTLEGIRQFYINVQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVDTLTEKMTENQFTVSCLHGDMDQAERDTIMREFRSGSSRVLITTDILARGIDVQQVSLVINYDLPSNRENYIHRIGRSGRFGRKGVAINFVTENDARQLKEIESYYTTQIEEMPESIADLI 402          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Celegans
Match: inf-1 (Eukaryotic initiation factor 4A [Source:UniProtKB/Swiss-Prot;Acc:P27639])

HSP 1 Score: 492.271 bits (1266), Expect = 1.213e-173
Identity = 241/385 (62.60%), Postives = 306/385 (79.48%), Query Frame = 2
Query:   23 GEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            G IE NYD++VESF+D+ LKE+LLRGI+ +GFEKPSAIQKRAI+P   G DVIAQAQSGTGKTATFS+++LQ ID      QA+++APTRELA QI KV+  LG+Y+      CIGG +VRDD   LE+G+HVVVGTPGRV DMI +  + +  +KMFVLDEADEMLSRGF++ + E  + +  + Q  +LSATMP EVL V+N FM NP++ILVKK+ELTLEGIRQFY+NV ++E+KFD LCDLY  + +TQAVIFCN + KV  L + +    F VS +HGDM+Q  RD IM+EFRSGSSR+LITTD+L RGIDVQQVS+VINYDLP N+ENYIHRIGR GRFGRKGVA+NFVT+ D  +++E+E++Y T+IEEMP ++++ +
Sbjct:   18 GLIEGNYDQVVESFDDMELKEELLRGIYGFGFEKPSAIQKRAIVPCTTGKDVIAQAQSGTGKTATFSVSILQRIDHEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSVRDDQRKLEAGIHVVVGTPGRVGDMINRNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRFMRNPIRILVKKDELTLEGIRQFYINVQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVDTLTEKMTENQFTVSCLHGDMDQAERDTIMREFRSGSSRVLITTDILARGIDVQQVSLVINYDLPSNRENYIHRIGRSGRFGRKGVAINFVTENDARQLKEIESYYTTQIEEMPESIADLI 402          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Celegans
Match: Y65B4A.6 (pep chromosome:WBcel235:I:629492:636350:-1 gene:WBGene00022029.1 transcript:Y65B4A.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y65B4A.6)

HSP 1 Score: 471.085 bits (1211), Expect = 2.647e-165
Identity = 225/385 (58.44%), Postives = 314/385 (81.56%), Query Frame = 2
Query:   26 EIESNYD-KIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            E ES+ +  I+ +F+ + L+EDLLRGI+AYGFEKPSAIQ+RAI   ++  DVIAQAQSGTGKTATFSI+VLQ++DT +  TQA+IL+PTRELAVQI KV++ LGDYM  +C +CIGG N+ +DI  L+ G HVV GTPGRV DMI++ ++++  +K+ VLDEADEML++GF+  + +  +YL    Q  +LSAT+P E+L+++++FM +P++ILVK++ELTLEGI+QF+V V +EE+KFDTL DLY++LTITQAV+FCN + KV +L D +K   F VSS+HGDMEQ+ RD++MKEFR+G++R+LI+TD+  RG+DV QVS+VINYDLP N+E YIHRIGR GRFGRKGVA+NFV   D+  ++++E +Y+T+I+EMP+N+++ +
Sbjct:   15 EFESSEEVSIIPTFDKMGLREDLLRGIYAYGFEKPSAIQQRAIPAILKARDVIAQAQSGTGKTATFSISVLQSLDTQVRETQALILSPTRELAVQIQKVVLALGDYMNVQCHACIGGTNLGEDIRKLDYGQHVVSGTPGRVFDMIRRRNLRTRAIKLLVLDEADEMLNKGFKEQLYDIYRYLPPGAQVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVDREEWKFDTLIDLYDTLTITQAVLFCNTRRKVDWLTDKMKEANFTVSSMHGDMEQKDRDEVMKEFRAGTTRVLISTDVWARGLDVPQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKQDDVRILRDIEQYYSTQIDEMPMNIADII 399          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Celegans
Match: F33D11.10 (pep chromosome:WBcel235:I:5866514:5868139:-1 gene:WBGene00018007.1 transcript:F33D11.10.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F33D11.10)

HSP 1 Score: 470.315 bits (1209), Expect = 6.550e-165
Identity = 223/385 (57.92%), Postives = 314/385 (81.56%), Query Frame = 2
Query:   26 EIESNYD-KIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            E ES+ +  ++ +F+ + L+EDLLRGI+AYGFEKPSAIQ+RA+   ++  DVIAQAQSGTGKTATFSI+VLQ++DT +  TQA+IL+PTRELAVQI KV++ LGDYM  +C +CIGG N+ +DI  L+ G HVV GTPGRV DMI++ ++++  +K+ VLDEADEML++GF+  + +  +YL    Q  +LSAT+P E+L+++++FM +P++ILVK++ELTLEGI+QF+V V +EE+KFDTL DLY++LTITQAV+FCN + KV +L D +K   F VSS+HGDMEQ+ RD++MKEFR+G++R+LI+TD+  RG+DV QVS+VINYDLP N+E YIHRIGR GRFGRKGVA+NFV   D+  ++++E +Y+T+I+EMP+N+++ +
Sbjct:   15 EFESSEEVNVIPTFDKMGLREDLLRGIYAYGFEKPSAIQQRAVPAILKARDVIAQAQSGTGKTATFSISVLQSLDTQVRETQALILSPTRELAVQIQKVVLALGDYMNVQCHACIGGTNLGEDIRKLDYGQHVVSGTPGRVFDMIRRRNLRTRAIKLLVLDEADEMLNKGFKEQLYDIYRYLPPGAQVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVDREEWKFDTLIDLYDTLTITQAVLFCNTRRKVDWLTDKMKEANFTVSSMHGDMEQKDRDEVMKEFRAGTTRVLISTDVWARGLDVPQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKQDDVRILRDIEQYYSTQIDEMPMNIADII 399          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Fly
Match: eIF4A (gene:FBgn0001942 transcript:FBtr0079178)

HSP 1 Score: 502.671 bits (1293), Expect = 1.370e-177
Identity = 250/390 (64.10%), Postives = 315/390 (80.77%), Query Frame = 2
Query:    8 TMENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +ME  G IES + ++ ++F+D+NL+E+LLRGI+ YGFEKPSAIQ+RAI+P + G DVIAQAQSGTGKTATFSIA+LQ IDTSI   QA+ILAPTRELA QI +V+M LG+YM     +CIGG NVR+D   LESG HVVVGTPGRV DMI +  +++ ++K+FVLDEADEMLSRGF++ + +  + L  + Q  +LSATMP +VL+VS  FM +PV ILVKKEELTLEGI+QFYVNV QE +K  TLCDLY++L+ITQ+VIFCN + KV  L   +    F VS++HGDMEQ+ R+ IMK+FRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NF+TD D   ++++E FY+T IEEMP N+++ +
Sbjct:   14 SMEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Fly
Match: eIF4A (gene:FBgn0001942 transcript:FBtr0079175)

HSP 1 Score: 502.671 bits (1293), Expect = 1.370e-177
Identity = 250/390 (64.10%), Postives = 315/390 (80.77%), Query Frame = 2
Query:    8 TMENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +ME  G IES + ++ ++F+D+NL+E+LLRGI+ YGFEKPSAIQ+RAI+P + G DVIAQAQSGTGKTATFSIA+LQ IDTSI   QA+ILAPTRELA QI +V+M LG+YM     +CIGG NVR+D   LESG HVVVGTPGRV DMI +  +++ ++K+FVLDEADEMLSRGF++ + +  + L  + Q  +LSATMP +VL+VS  FM +PV ILVKKEELTLEGI+QFYVNV QE +K  TLCDLY++L+ITQ+VIFCN + KV  L   +    F VS++HGDMEQ+ R+ IMK+FRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NF+TD D   ++++E FY+T IEEMP N+++ +
Sbjct:   14 SMEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Fly
Match: eIF4A (gene:FBgn0001942 transcript:FBtr0079177)

HSP 1 Score: 502.671 bits (1293), Expect = 1.370e-177
Identity = 250/390 (64.10%), Postives = 315/390 (80.77%), Query Frame = 2
Query:    8 TMENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +ME  G IES + ++ ++F+D+NL+E+LLRGI+ YGFEKPSAIQ+RAI+P + G DVIAQAQSGTGKTATFSIA+LQ IDTSI   QA+ILAPTRELA QI +V+M LG+YM     +CIGG NVR+D   LESG HVVVGTPGRV DMI +  +++ ++K+FVLDEADEMLSRGF++ + +  + L  + Q  +LSATMP +VL+VS  FM +PV ILVKKEELTLEGI+QFYVNV QE +K  TLCDLY++L+ITQ+VIFCN + KV  L   +    F VS++HGDMEQ+ R+ IMK+FRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NF+TD D   ++++E FY+T IEEMP N+++ +
Sbjct:   14 SMEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Fly
Match: eIF4A (gene:FBgn0001942 transcript:FBtr0307068)

HSP 1 Score: 502.671 bits (1293), Expect = 1.370e-177
Identity = 250/390 (64.10%), Postives = 315/390 (80.77%), Query Frame = 2
Query:    8 TMENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +ME  G IES + ++ ++F+D+NL+E+LLRGI+ YGFEKPSAIQ+RAI+P + G DVIAQAQSGTGKTATFSIA+LQ IDTSI   QA+ILAPTRELA QI +V+M LG+YM     +CIGG NVR+D   LESG HVVVGTPGRV DMI +  +++ ++K+FVLDEADEMLSRGF++ + +  + L  + Q  +LSATMP +VL+VS  FM +PV ILVKKEELTLEGI+QFYVNV QE +K  TLCDLY++L+ITQ+VIFCN + KV  L   +    F VS++HGDMEQ+ R+ IMK+FRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NF+TD D   ++++E FY+T IEEMP N+++ +
Sbjct:   14 SMEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Fly
Match: eIF4A (gene:FBgn0001942 transcript:FBtr0079176)

HSP 1 Score: 502.671 bits (1293), Expect = 1.370e-177
Identity = 250/390 (64.10%), Postives = 315/390 (80.77%), Query Frame = 2
Query:    8 TMENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +ME  G IES + ++ ++F+D+NL+E+LLRGI+ YGFEKPSAIQ+RAI+P + G DVIAQAQSGTGKTATFSIA+LQ IDTSI   QA+ILAPTRELA QI +V+M LG+YM     +CIGG NVR+D   LESG HVVVGTPGRV DMI +  +++ ++K+FVLDEADEMLSRGF++ + +  + L  + Q  +LSATMP +VL+VS  FM +PV ILVKKEELTLEGI+QFYVNV QE +K  TLCDLY++L+ITQ+VIFCN + KV  L   +    F VS++HGDMEQ+ R+ IMK+FRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NF+TD D   ++++E FY+T IEEMP N+++ +
Sbjct:   14 SMEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Zebrafish
Match: eif4a1a (eukaryotic translation initiation factor 4A1A [Source:ZFIN;Acc:ZDB-GENE-031030-2])

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 257/390 (65.90%), Postives = 329/390 (84.36%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGM-HVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+ +IV+SF+D+NL+E LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ ID  + +TQA++LAPTRELA QI KV++ LGDYMGA C +CIGG NVR+D+  L++ + H+VVGTPGRV DM+ + ++   ++KMF LDEADEMLSRGF++ + E  Q L+ +TQ  +LSATMP EVL+V+ +FM +PV+ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDMEQ+ RD IMKEFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N +T+ D   ++++E FYNT +EEMP+N+++ +
Sbjct:   17 MEPDGVIESNWKEIVDSFDDMNLREALLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDVELKATQAMVLAPTRELAQQIQKVVLALGDYMGATCHACIGGTNVRNDVQKLQADVPHIVVGTPGRVFDMLNRRYLSPKYIKMFALDEADEMLSRGFKDQIYEIFQKLATDTQVILLSATMPQEVLEVTTKFMRDPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMEQKERDVIMKEFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMITEDDKRTLRDIETFYNTTVEEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Zebrafish
Match: eif4a1b (eukaryotic translation initiation factor 4A1B [Source:ZFIN;Acc:ZDB-GENE-040120-6])

HSP 1 Score: 528.865 bits (1361), Expect = 0.000e+0
Identity = 259/390 (66.41%), Postives = 325/390 (83.33%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+D+IV+SF+D+NL+E LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ ID  +  TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ +  + S ++KMFVLDEADEMLSRGF++ + E  Q LS   Q  +LSATMP EVL V+ +FM  PV+ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT+ D   ++++E FYNT +EEMP+N+++ +
Sbjct:   17 MEPDGVIESNWDEIVDSFDDMNLRETLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDIELKGTQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEVQKLQAEAPHIVVGTPGRVYDMLNRKFLSSKYIKMFVLDEADEMLSRGFKDQIYEIFQKLSTSIQVVLLSATMPAEVLDVTTKFMREPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKDRDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Zebrafish
Match: eif4a1b (eukaryotic translation initiation factor 4A1B [Source:ZFIN;Acc:ZDB-GENE-040120-6])

HSP 1 Score: 528.865 bits (1361), Expect = 0.000e+0
Identity = 259/390 (66.41%), Postives = 325/390 (83.33%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+D+IV+SF+D+NL+E LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ ID  +  TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ +  + S ++KMFVLDEADEMLSRGF++ + E  Q LS   Q  +LSATMP EVL V+ +FM  PV+ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT+ D   ++++E FYNT +EEMP+N+++ +
Sbjct:   17 MEPDGVIESNWDEIVDSFDDMNLRETLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDIELKGTQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEVQKLQAEAPHIVVGTPGRVYDMLNRKFLSSKYIKMFVLDEADEMLSRGFKDQIYEIFQKLSTSIQVVLLSATMPAEVLDVTTKFMREPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKDRDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Zebrafish
Match: eif4a1b (eukaryotic translation initiation factor 4A1B [Source:ZFIN;Acc:ZDB-GENE-040120-6])

HSP 1 Score: 528.48 bits (1360), Expect = 0.000e+0
Identity = 259/390 (66.41%), Postives = 325/390 (83.33%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+D+IV+SF+D+NL+E LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ ID  +  TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ +  + S ++KMFVLDEADEMLSRGF++ + E  Q LS   Q  +LSATMP EVL V+ +FM  PV+ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT+ D   ++++E FYNT +EEMP+N+++ +
Sbjct:   18 MEPDGVIESNWDEIVDSFDDMNLRETLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDIELKGTQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEVQKLQAEAPHIVVGTPGRVYDMLNRKFLSSKYIKMFVLDEADEMLSRGFKDQIYEIFQKLSTSIQVVLLSATMPAEVLDVTTKFMREPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKDRDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNVADLI 407          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Zebrafish
Match: eif4a1b (eukaryotic translation initiation factor 4A1B [Source:ZFIN;Acc:ZDB-GENE-040120-6])

HSP 1 Score: 525.013 bits (1351), Expect = 0.000e+0
Identity = 255/383 (66.58%), Postives = 321/383 (83.81%), Query Frame = 2
Query:   32 ESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ESN+D+IV+SF+D+NL+E LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ ID  +  TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ +  + S ++KMFVLDEADEMLSRGF++ + E  Q LS   Q  +LSATMP EVL V+ +FM  PV+ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT+ D   ++++E FYNT +EEMP+N+++ +
Sbjct:   30 ESNWDEIVDSFDDMNLRETLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDIELKGTQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEVQKLQAEAPHIVVGTPGRVYDMLNRKFLSSKYIKMFVLDEADEMLSRGFKDQIYEIFQKLSTSIQVVLLSATMPAEVLDVTTKFMREPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKDRDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNVADLI 412          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Xenopus
Match: eif4a1 (eukaryotic translation initiation factor 4A1 [Source:NCBI gene;Acc:496556])

HSP 1 Score: 520.39 bits (1339), Expect = 0.000e+0
Identity = 251/390 (64.36%), Postives = 327/390 (83.85%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN++++V+SF+D++L E LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ I+  + +TQA++LAPTRELA QI KV+M LGDYMGA C +CIGG NVR ++  L+S   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + +  Q LS+  Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT+ D   ++++E FYNT +EEMP+N+++ +
Sbjct:   13 MEPDGVIESNWNEVVDSFDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQQIELDMKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQSEAPHIVVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLSSNAQVVLLSATMPADVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 402          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Xenopus
Match: eif4a1 (eukaryotic translation initiation factor 4A1 [Source:NCBI gene;Acc:496556])

HSP 1 Score: 520.005 bits (1338), Expect = 0.000e+0
Identity = 251/390 (64.36%), Postives = 327/390 (83.85%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN++++V+SF+D++L E LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ I+  + +TQA++LAPTRELA QI KV+M LGDYMGA C +CIGG NVR ++  L+S   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + +  Q LS+  Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT+ D   ++++E FYNT +EEMP+N+++ +
Sbjct:   19 MEPDGVIESNWNEVVDSFDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQQIELDMKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQSEAPHIVVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLSSNAQVVLLSATMPADVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 408          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Xenopus
Match: eif4a1 (eukaryotic translation initiation factor 4A1 [Source:NCBI gene;Acc:496556])

HSP 1 Score: 520.005 bits (1338), Expect = 0.000e+0
Identity = 251/390 (64.36%), Postives = 327/390 (83.85%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN++++V+SF+D++L E LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ I+  + +TQA++LAPTRELA QI KV+M LGDYMGA C +CIGG NVR ++  L+S   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + +  Q LS+  Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT+ D   ++++E FYNT +EEMP+N+++ +
Sbjct:   20 MEPDGVIESNWNEVVDSFDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQQIELDMKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQSEAPHIVVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLSSNAQVVLLSATMPADVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 409          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Xenopus
Match: eif4a1 (eukaryotic translation initiation factor 4A1 [Source:NCBI gene;Acc:496556])

HSP 1 Score: 519.62 bits (1337), Expect = 0.000e+0
Identity = 251/390 (64.36%), Postives = 327/390 (83.85%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN++++V+SF+D++L E LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ I+  + +TQA++LAPTRELA QI KV+M LGDYMGA C +CIGG NVR ++  L+S   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + +  Q LS+  Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT+ D   ++++E FYNT +EEMP+N+++ +
Sbjct:   15 MEPDGVIESNWNEVVDSFDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQQIELDMKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQSEAPHIVVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLSSNAQVVLLSATMPADVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 404          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Xenopus
Match: eif4a1 (eukaryotic translation initiation factor 4A1 [Source:NCBI gene;Acc:496556])

HSP 1 Score: 519.235 bits (1336), Expect = 0.000e+0
Identity = 251/390 (64.36%), Postives = 327/390 (83.85%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN++++V+SF+D++L E LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ I+  + +TQA++LAPTRELA QI KV+M LGDYMGA C +CIGG NVR ++  L+S   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + +  Q LS+  Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT+ D   ++++E FYNT +EEMP+N+++ +
Sbjct:   14 MEPDGVIESNWNEVVDSFDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQQIELDMKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQSEAPHIVVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLSSNAQVVLLSATMPADVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 403          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Mouse
Match: Eif4a1 (eukaryotic translation initiation factor 4A1 [Source:MGI Symbol;Acc:MGI:95303])

HSP 1 Score: 523.857 bits (1348), Expect = 0.000e+0
Identity = 253/390 (64.87%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLE-SGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+++IV+SF+D+NL E LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ I+  + +TQA++LAPTRELA QI KV+M LGDYMGA C +CIGG NVR ++  L+    H++VGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + +  Q L++ TQ  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT++D   ++++E FYNT IEEMP+N+++ +
Sbjct:   17 MEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Mouse
Match: Eif4a2 (eukaryotic translation initiation factor 4A2 [Source:MGI Symbol;Acc:MGI:106906])

HSP 1 Score: 516.153 bits (1328), Expect = 0.000e+0
Identity = 250/390 (64.10%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            M+  G IESN+++IV++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q L+   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT++D   ++++E FYNT +EEMP+N+++ +
Sbjct:   18 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 407          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Mouse
Match: Eif4a2 (eukaryotic translation initiation factor 4A2 [Source:MGI Symbol;Acc:MGI:106906])

HSP 1 Score: 515.768 bits (1327), Expect = 0.000e+0
Identity = 250/390 (64.10%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            M+  G IESN+++IV++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q L+   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT++D   ++++E FYNT +EEMP+N+++ +
Sbjct:   19 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 408          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Mouse
Match: Eif4a2 (eukaryotic translation initiation factor 4A2 [Source:MGI Symbol;Acc:MGI:106906])

HSP 1 Score: 480.33 bits (1235), Expect = 2.966e-169
Identity = 221/342 (64.62%), Postives = 286/342 (83.63%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIH 1033
            M+  G IESN+++IV++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q L+   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIH
Sbjct:   18 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIH 359          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Mouse
Match: Eif4a2 (eukaryotic translation initiation factor 4A2 [Source:MGI Symbol;Acc:MGI:106906])

HSP 1 Score: 480.33 bits (1235), Expect = 2.966e-169
Identity = 221/342 (64.62%), Postives = 286/342 (83.63%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIH 1033
            M+  G IESN+++IV++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + E  Q L+   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIH
Sbjct:   18 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIH 359          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. UniProt
Match: sp|Q2HFP1|IF4A_CHAGB (ATP-dependent RNA helicase eIF4A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=TIF1 PE=3 SV=1)

HSP 1 Score: 526.554 bits (1355), Expect = 0.000e+0
Identity = 255/385 (66.23%), Postives = 324/385 (84.16%), Query Frame = 2
Query:   23 GEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            G+IESNYD+ V+SF+D+NLK +LLRGI+AYGFE+PSAIQ+RAI+P I+GHDVIAQAQSGTGKTATFSI+VLQ ID ++ S QA+ILAPTRELA QI KV++ +GD+M  +C +CIGG +VRDD+  L+ G  V+VGTPGRV DMI++  +K+D +KMFVLDEADEMLSRGF   + +  Q L   TQ  +LSATMP +VL+V+ +FM +PV+ILVKK+ELTLEGI+QFY+ V +E++K DTL DLYE++TITQAVIFCN + KV +L D L+++ F VS++HGDM+Q  RD IMKEFRSGSSR+LI TDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT  D+  M+E+E FY+T+IEEMP+N+++ +
Sbjct:   13 GQIESNYDETVDSFDDMNLKSELLRGIYAYGFERPSAIQQRAIMPVIKGHDVIAQAQSGTGKTATFSISVLQKIDPTVKSCQALILAPTRELAQQIQKVVIAIGDFMNIECHACIGGTSVRDDMKALQDGPQVIVGTPGRVHDMIQRRILKTDQMKMFVLDEADEMLSRGFTEQIYDIFQLLPQSTQVVLLSATMPQDVLEVTTKFMRDPVRILVKKDELTLEGIKQFYIAVEKEDWKLDTLSDLYETVTITQAVIFCNTRRKVDWLTDKLQARDFTVSAMHGDMDQTQRDLIMKEFRSGSSRVLIATDLLARGIDVQQVSLVINYDLPANRENYIHRIGRGGRFGRKGVAINFVTADDVRMMREIEQFYSTQIEEMPMNVADLI 397          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. UniProt
Match: sp|A4QVP2|IF4A_MAGO7 (ATP-dependent RNA helicase eIF4A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=TIF1 PE=3 SV=1)

HSP 1 Score: 525.398 bits (1352), Expect = 0.000e+0
Identity = 256/385 (66.49%), Postives = 323/385 (83.90%), Query Frame = 2
Query:   23 GEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            G+IESNYD+ V+SF+++NLK +LLRGI+AYGFE+PSAIQ+RAI+P I+GHDVIAQAQSGTGKTATFSI+VLQ IDT++   QA+ILAPTRELA QI KV++ +GD+M  +C +CIGG +VRDD+  L+ G  VVVGTPGRV DMI++  +K+D +KMFVLDEADEMLSRGF   + +  Q L   TQ  +LSATMP +VL+V+ +FM +PV+ILVKK+ELTLEGI+QFY+ V +EE+K DTL DLYE++TITQAVIFCN + KV +L D L ++ F VS++HGDM+Q  RD IMKEFRSGSSR+LI TDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT  D+  M+E+E FY+T+IEEMP+N+++ +
Sbjct:   12 GQIESNYDETVDSFDEMNLKSELLRGIYAYGFERPSAIQQRAIMPVIKGHDVIAQAQSGTGKTATFSISVLQKIDTNVKQCQALILAPTRELAQQIQKVVVAIGDFMNIECHACIGGTSVRDDMKALQDGPQVVVGTPGRVHDMIQRRFLKTDGMKMFVLDEADEMLSRGFTEQIYDIFQLLPQSTQVVLLSATMPQDVLEVTTKFMRDPVRILVKKDELTLEGIKQFYIAVEKEEWKLDTLSDLYETVTITQAVIFCNTRRKVDWLTDKLTARDFTVSAMHGDMDQAQRDLIMKEFRSGSSRVLIATDLLARGIDVQQVSLVINYDLPANRENYIHRIGRGGRFGRKGVAINFVTADDVRMMREIEQFYSTQIEEMPMNVADLI 396          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. UniProt
Match: sp|Q7RV88|IF4A_NEUCR (ATP-dependent RNA helicase eIF4A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=tif-1 PE=3 SV=2)

HSP 1 Score: 525.013 bits (1351), Expect = 0.000e+0
Identity = 256/385 (66.49%), Postives = 322/385 (83.64%), Query Frame = 2
Query:   23 GEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            G+IESNYD+ V+SF+++NLK +LLRGI+AYGFE+PSAIQ+RAI+P I+GHDVIAQAQSGTGKTATFSI+VLQ ID S+ + QA+ILAPTRELA QI KV++ +GD+M  +C +CIGG +VRDD+  L+ G  VVVGTPGRV DMI++  +K+D +KMFVLDEADEMLSRGF   + +  Q L   TQ  +LSATMP +VL+V+ +FM  PV+ILVKK+ELTLEGI+QFY+ V +EE+K DTL DLYE++TITQAVIFCN + KV +L D L ++ F VS++HGDM+Q  RD IMKEFRSGSSR+LI TDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT  D+  M+E+E FY+T+IEEMP+N+++ +
Sbjct:   13 GQIESNYDETVDSFDEMNLKPELLRGIYAYGFERPSAIQQRAIMPVIKGHDVIAQAQSGTGKTATFSISVLQKIDPSLKACQALILAPTRELAQQIQKVVVAIGDFMNIECHACIGGTSVRDDMKALQDGPQVVVGTPGRVHDMIQRRFLKTDSMKMFVLDEADEMLSRGFTEQIYDIFQLLPQSTQVVLLSATMPQDVLEVTTKFMREPVRILVKKDELTLEGIKQFYIAVEKEEWKLDTLSDLYETVTITQAVIFCNTRRKVDWLTDKLTARDFTVSAMHGDMDQAQRDLIMKEFRSGSSRVLIATDLLARGIDVQQVSLVINYDLPANRENYIHRIGRGGRFGRKGVAINFVTADDVRMMREIEQFYSTQIEEMPMNVADLI 397          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. UniProt
Match: sp|P60843|IF4A1_MOUSE (Eukaryotic initiation factor 4A-I OS=Mus musculus OX=10090 GN=Eif4a1 PE=1 SV=1)

HSP 1 Score: 523.857 bits (1348), Expect = 0.000e+0
Identity = 253/390 (64.87%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLE-SGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+++IV+SF+D+NL E LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ I+  + +TQA++LAPTRELA QI KV+M LGDYMGA C +CIGG NVR ++  L+    H++VGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + +  Q L++ TQ  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT++D   ++++E FYNT IEEMP+N+++ +
Sbjct:   17 MEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. UniProt
Match: sp|P60842|IF4A1_HUMAN (Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1)

HSP 1 Score: 523.857 bits (1348), Expect = 0.000e+0
Identity = 253/390 (64.87%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLE-SGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+++IV+SF+D+NL E LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ I+  + +TQA++LAPTRELA QI KV+M LGDYMGA C +CIGG NVR ++  L+    H++VGTPGRV DM+ + ++   ++KMFVLDEADEMLSRGF++ + +  Q L++ TQ  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT++D   ++++E FYNT IEEMP+N+++ +
Sbjct:   17 MEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. TrEMBL
Match: gnl|BL_ORD_ID|19628044 (tr|A4V6N0|A4V6N0_DUGJA eIF4A isoform 1A protein OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 282/389 (72.49%), Postives = 346/389 (88.95%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            MENPGEIE+NY+KI ESF+D+NLKEDLLRGI+AYGFEKPSAIQ+RA+LPAIEGHDVIAQAQSGTGKTATFS+A+LQ ID + N  QA++LAPTRELA QIHKVI+ LGDYMGAK  +CIGG  V++D+ NLE+G+HV+VGTPGRV DMI++G++K++ +KMFVLDEADEMLSRGF+  +   +Q++  +TQ  +LSATMP +VL+V+ +FM +PVKILVKKEELTLEGIRQFYVNVS+E+YKF+TL DLYE+LTITQAVIFCN + KV +L ++LK+K F+VSS+HGDM+Q  RDQIMKEFRSGSSRILITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT  DI  +Q+LE++Y+T IEEMP+N+++ +
Sbjct:    1 MENPGEIETNYEKITESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVTKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNSIKMFVLDEADEMLSRGFKEQIHSVIQFIEHDTQIVLLSATMPPDVLEVTRKFMRSPVKILVKKEELTLEGIRQFYVNVSEEDYKFETLTDLYETLTITQAVIFCNTRRKVDYLTESLKAKPFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 389          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. TrEMBL
Match: gnl|BL_ORD_ID|21047044 (tr|A0A1V9XU99|A0A1V9XU99_9ACAR Eukaryotic initiation factor 4A-II-like OS=Tropilaelaps mercedesae OX=418985 GN=BIW11_07404 PE=3 SV=1)

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 264/389 (67.87%), Postives = 328/389 (84.32%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            M+  G IESNYDK+V+SF+D+ L+E+LLRGI+AYGFE+PSAIQ+RAILP IEG+DVIAQAQSGTGKTATFSI++LQ I+      QA+ILAPTRELA QI KV++ LGDYM AKC +CIGG NV+DDI NLE GMHVVVGTPGRV DMI++  +++D ++MFVLDEADEMLSRGF+  + +  + LS  TQ  +LSATMP +VL V+  FM +P++ILVKKEELTLEGI+QFYVNV +EE+KFDTLCDLYE+LTITQAVIFCN + KV +L D +  K F VS++HGDM Q  R+ IM+ FRSGSSR+LITTDLL RGIDVQQVS+VIN+DLP N+ENYIHRIGRGGRFGRKGVA+NFVTD+D   ++++E+FYNT +EEMP+N+++ +
Sbjct:   32 MDPEGIIESNYDKVVDSFDDMKLREELLRGIYAYGFERPSAIQQRAILPCIEGNDVIAQAQSGTGKTATFSISILQQIEIENPQCQALILAPTRELAQQIQKVVIALGDYMSAKCHACIGGTNVKDDIRNLEKGMHVVVGTPGRVYDMIQRRALRTDSIRMFVLDEADEMLSRGFKEQIHDVFKTLSETTQVILLSATMPADVLDVTKCFMRDPIRILVKKEELTLEGIKQFYVNVDKEEWKFDTLCDLYETLTITQAVIFCNTRRKVDWLTDQMTKKDFTVSALHGDMSQHEREMIMRAFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTNRENYIHRIGRGGRFGRKGVAINFVTDEDKRTLKDIESFYNTAVEEMPVNVADLI 420          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. TrEMBL
Match: gnl|BL_ORD_ID|10628761 (tr|A0A162WHS4|A0A162WHS4_PHYB8 Uncharacterized protein OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=PHYBLDRAFT_137088 PE=3 SV=1)

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 257/385 (66.75%), Postives = 333/385 (86.49%), Query Frame = 2
Query:   26 EIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMI-KKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            EIESN+D+IV++F+++NLK DLLRG++AYGFE+PS IQ+RAI+P ++GHDVIAQAQSGTGKTATFSI++LQ+ID S+  TQA+ILAPTRELA+QI KV++ LGD+MG +C +CIGG NVRDDI  L+SG+H+VVGTPGRV DMI  +G +K++ +KMFVLDEADEMLSRGF++ + +  Q L   TQ  +LSATMP +V++V+ +FM +P++ILVK++ELTLEGI+QFYV V +EE+K DTLCDLYE++TITQAVIFCN + KV +L D L ++ F VS++HGDM+Q  RD IMKEFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFV++ D+  M+++E FYNT+IEEMP+N+++ +
Sbjct:   13 EIESNWDEIVDNFDNMNLKTDLLRGVYAYGFERPSTIQQRAIMPVVKGHDVIAQAQSGTGKTATFSISILQSIDVSLKETQALILAPTRELALQIQKVVLALGDFMGIECHACIGGTNVRDDITKLQSGVHIVVGTPGRVFDMIDNRGALKTEHIKMFVLDEADEMLSRGFKDQIYDVFQLLPETTQVVLLSATMPSDVMEVTTKFMRDPIRILVKRDELTLEGIKQFYVAVDKEEWKLDTLCDLYETVTITQAVIFCNTRRKVDWLTDKLHAREFTVSAMHGDMDQSQRDVIMKEFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVSNDDVRMMRDIEQFYNTQIEEMPMNVADLI 397          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. TrEMBL
Match: gnl|BL_ORD_ID|12065479 (tr|A0A1Y2AK30|A0A1Y2AK30_9FUNG DEAD-domain-containing protein OS=Neocallimastix californiae OX=1754190 GN=LY90DRAFT_515263 PE=3 SV=1)

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 256/385 (66.49%), Postives = 332/385 (86.23%), Query Frame = 2
Query:   23 GEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            GEIESN+D++ ++F+D+NLKE+LLRG+FAYGFEKPSAIQ+RAILP I+GHDVIAQAQSGTGKTATFSI++LQ+ID SI   QA++L+PTRELA QI KV++ LGDYM  KC +CIGG NVRDD+  LE+G+HVVVGTPGRV DMI +  + ++ +KMFVLDEADEMLSRGF++ + E  Q L  +TQ  +LSATMP +VL+V+  FM +P++ILVK++ELTLEGI+QFYV+V +EE+K DTLCDLYE++TITQA+IFCN + KV +L + ++S+ F VS++HG+M Q  R+ IM+EFRSGSSR+LITTDLL RGIDVQQ+S+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT++D+  ++++E FYNT+IEEMP+N++E +
Sbjct:   16 GEIESNWDEVTDNFDDMNLKEELLRGVFAYGFEKPSAIQQRAILPVIKGHDVIAQAQSGTGKTATFSISILQSIDISIRKCQALVLSPTRELAQQIQKVVLALGDYMDCKCHACIGGTNVRDDMKILEAGVHVVVGTPGRVWDMINRRALNTENIKMFVLDEADEMLSRGFKDQIYEVFQLLPPQTQVVLLSATMPPDVLEVTKNFMRDPIRILVKRDELTLEGIKQFYVSVEKEEWKLDTLCDLYETVTITQAIIFCNTRRKVDWLTEKMQSREFTVSAMHGEMTQAEREVIMREFRSGSSRVLITTDLLARGIDVQQISLVINYDLPANRENYIHRIGRGGRFGRKGVAINFVTNEDVRMLRDIEQFYNTQIEEMPMNIAELI 400          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. TrEMBL
Match: gnl|BL_ORD_ID|10604985 (tr|A0A162T1N1|A0A162T1N1_PHYB8 Uncharacterized protein OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=PHYBLDRAFT_184149 PE=3 SV=1)

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 256/385 (66.49%), Postives = 333/385 (86.49%), Query Frame = 2
Query:   26 EIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIK-KGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            EIESN+D+IV++F+++NLK +LLRG++AYGFE+PS IQ+RAI+P I+GHDVIAQAQSGTGKTATFSI++LQ+ID S+  TQA+ILAPTRELA+QI KV++ LGD+MG +C +CIGG NVRDDI  L+SG+H+VVGTPGRV DMI  +G +K++ +KMFVLDEADEMLSRGF++ + +  Q L   TQ  +LSATMP +V++V+ +FM +P++ILVK++ELTLEGI+QFYV V +EE+K DTLCDLYE++TITQAVIFCN + KV +L D L ++ F VS++HG+M+Q  RD IMKEFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFV++ D+  M+++E FYNT+IEEMP+N+++ +
Sbjct:   12 EIESNWDEIVDNFDNMNLKTELLRGVYAYGFERPSTIQQRAIMPVIKGHDVIAQAQSGTGKTATFSISILQSIDVSLKHTQALILAPTRELALQIQKVVLALGDFMGIECHACIGGTNVRDDITKLQSGVHIVVGTPGRVYDMINTRGALKTEHIKMFVLDEADEMLSRGFKDQIYDVFQLLPETTQVVLLSATMPSDVMEVTTKFMRDPIRILVKRDELTLEGIKQFYVAVDKEEWKLDTLCDLYETVTITQAVIFCNTRRKVDWLTDKLHAREFTVSAMHGEMDQSQRDLIMKEFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVSNDDVRMMRDIEQFYNTQIEEMPMNVADLI 396          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Cavefish
Match: eif4a1a (eukaryotic initiation factor 4A-I [Source:NCBI gene;Acc:103045638])

HSP 1 Score: 520.39 bits (1339), Expect = 0.000e+0
Identity = 253/390 (64.87%), Postives = 327/390 (83.85%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGM-HVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IE N+ ++V+SF+D+NL+E+LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ ID  + +TQA++LAPTRELA QI KV++ LGDYMGA C +CIGG NVR+++  L++ + H+VVGTPGRV DM+ + ++    +K F LDEADEMLSRGF++ + E  Q LS++ Q  +LSATMP EVL V+++FM +PV+ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IMKEFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT+ D   ++++E FYNT +EEMP+N+++ +
Sbjct:   17 MEPDGVIEGNWKEVVDSFDDMNLRENLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDIEMKATQAMVLAPTRELAQQIQKVVLALGDYMGATCHACIGGTNVRNEVQKLQADVPHIVVGTPGRVFDMLNRRYLSPRHIKQFALDEADEMLSRGFKDQIYEIFQKLSSDIQVILLSATMPQEVLDVTSKFMRDPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDLIMKEFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Cavefish
Match: eif4a2 (eukaryotic translation initiation factor 4A2 [Source:NCBI gene;Acc:103033197])

HSP 1 Score: 514.612 bits (1324), Expect = 0.000e+0
Identity = 253/390 (64.87%), Postives = 324/390 (83.08%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+++I ++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ++     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG NVR+++  L++   H+VVGTPGRV DM+ +  +   ++KMFVLDEADEMLSRGF++ + E  Q LS   Q  +LSATMP EVL V+ +FM  PV+ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT++D   ++++E FYNT +EEMP+N+++ +
Sbjct:   22 MEPDGIIESNWNEITDNFDDMNLKETLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEQKETQALVLAPTRELAQQIQKVILALGDYMGASCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRFLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLSTNIQVVLLSATMPAEVLDVTTKFMREPVRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 411          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Cavefish
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:NCBI gene;Acc:103037591])

HSP 1 Score: 470.7 bits (1210), Expect = 7.977e-165
Identity = 223/376 (59.31%), Postives = 305/376 (81.12%), Query Frame = 2
Query:   50 IVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +  +F+ + L+EDLLRGI+AYGFEKPSAIQ+RAI   I+G DVIAQ+QSGTGKTATF ++VLQ +D  +  TQA+ILAPTRELA QI KV++ LGDYM  +C +CIGG NV +DI  L+ G HVV GTPGRV DMI++  +++  +KM VLDEADEML++GF+  + +  +YL   TQ  ++SAT+P E+L+++N+FM +P++ILVK++ELTLEGI+QF+V V +EE+KFDTLCDLY++LTITQAVIFCN K KV +L + ++   F VSS+HGDM Q+ R+ IMKEFRSG+SR+LI+TD+  RG+DV QVS++INYDLP N+E YIHRIGR GR+GRKGVA+NFV + DI  ++++E +Y+T+I+EMP+N+++ +
Sbjct:   31 VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDIQVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Cavefish
Match: eif4a1b (eukaryotic translation initiation factor 4A1B [Source:ZFIN;Acc:ZDB-GENE-040120-6])

HSP 1 Score: 464.922 bits (1195), Expect = 6.783e-163
Identity = 236/390 (60.51%), Postives = 304/390 (77.95%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+ +IV++F+D+NL+E LLRGI+AYGFEKPSAIQ+RAILP I+G+DVIAQAQSGTGKTATF+I++LQ +D  + +TQA++LAPTRELA Q+                           +  L++   H+VVGTPGRV DM+ +  + S  +KMFVLDEADEMLSRGF++ + E  Q L + TQ  +LSATMP EVL+V+ +FM  PV+ILVKK+ELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT+ D   ++++E FYNT +EEMP+N+++ +
Sbjct:   19 MEPDGIIESNWHEIVDTFDDMNLRETLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQLDPELRATQALVLAPTRELAQQVS--------------------------VAKLQAEAPHIVVGTPGRVFDMLSRKFLSSKSIKMFVLDEADEMLSRGFKDQIYEIFQKLPSSTQVVLLSATMPVEVLEVTTKFMREPVRILVKKDELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKDRDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNVADLI 382          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Cavefish
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:NCBI gene;Acc:103037591])

HSP 1 Score: 463.381 bits (1191), Expect = 3.609e-162
Identity = 221/366 (60.38%), Postives = 299/366 (81.69%), Query Frame = 2
Query:   80 KEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +EDLLRGI+AYGFEKPSAIQ+RAI   I+G DVIAQ+QSGTGKTATF ++VLQ +D  +  TQA+ILAPTRELA QI KV++ LGDYM  +C +CIGG NV +DI  L+ G HVV GTPGRV DMI++  +++  +KM VLDEADEML++GF+  + +  +YL   TQ  ++SAT+P E+L+++N+FM +P++ILVK++ELTLEGI+QF+V V +EE+KFDTLCDLY++LTITQAVIFCN K KV +L + ++   F VSS+HGDM Q+ R+ IMKEFRSG+SR+LI+TD+  RG+DV QVS++INYDLP N+E YIHRIGR GR+GRKGVA+NFV + DI  ++++E +Y+T+I+EMP+N+++ +
Sbjct:   27 EEDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDIQVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 392          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Sea Lamprey
Match: ddx6 (DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN;Acc:ZDB-GENE-070912-83])

HSP 1 Score: 272.322 bits (695), Expect = 8.299e-87
Identity = 153/373 (41.02%), Postives = 231/373 (61.93%), Query Frame = 2
Query:   62 FEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGA-KCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            FED  LK +LL GIF  G+EKPS IQ+ +I  A+ G D++A+A++GTGK+  + I +L+ +D      QA+ + PTRELA+Q  ++ + L  +MG  K  +  GG N+RDDI  L+  +HV++ TPGR+ D+I KG  K D V+M VLDEAD++LS+ F   + + ++ +    Q  + SAT P  V K  N  +  P +I +  EELTL+GI QFY  V+ E  K   L  L+  L I Q++IFCN   +V  L   +   G+    +H  M+Q+ R+++  +FR G  R L+ +DL  RGID+Q V++VIN+D PKN E Y+HRIGR GR+G  G+A+N +T +D   ++ +E    T+I+ +P  + + L
Sbjct:  101 FEDYCLKRELLMGIFEKGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDMKKPYIQALTIVPTRELALQTSQICIELSKHMGGVKVMATTGGTNLRDDILRLDETVHVIIATPGRILDLINKGLAKVDAVQMIVLDEADKLLSQDFVQMLDDIIRAMPRNRQILLYSATFPLSVQKFMNRHLQKPYEINLM-EELTLKGITQFYAYVN-ERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKMKQEHRNRVFHDFRRGECRNLVCSDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRYGHLGLAINLITYEDRFNLKGIEEQLGTEIKPIPGTIDKSL 471          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000216.1 (pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-1 gene:ENSPMAG00000000186.1 transcript:ENSPMAT00000000216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.667 bits (496), Expect = 3.592e-58
Identity = 119/363 (32.78%), Postives = 204/363 (56.20%), Query Frame = 2
Query:  113 GFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIK--KG-HIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL*MIYR 1192
            G+++P+ IQ  AI  A++G D+I  A++G+GKT  F++ +LQ +  +     A++L PTRELA QI +    LG  +G K    +GG ++      L    HV++ TPGR+ D ++  KG +I++  +K  V+DEAD +L+  F+ +V + ++ +  E + ++ SATM  +V K+    +  PVK  V  +  T+E ++Q+YV +   ++K   L  +   L     +IFC+  N    +   L++ GF    +HG M Q  R   + +F+  +  IL+ TD+  RG+D+  V +VIN+D+P + ++YIHR+GR  R GR G ++ FV+  D+   Q +E+    K+   P N  E + +  R
Sbjct:   14 GWKQPTKIQVEAIPVALQGKDIIGLAETGSGKTGAFALPILQALLDAPQRLFALVLTPTRELAFQISEQFEALGSSIGIKSAVVVGGIDMMSQSLALAKKPHVIIATPGRLVDHLENTKGFNIRA--LKYLVMDEADRILNMDFETEVDKILKVIPKERKTYLFSATMTKKVQKLQRAALKEPVKCSVSTKYQTVEKLQQYYVFIP-AKFKDSYLVYILNELAGNSFIIFCSTCNNTQRIALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKGKARSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKSITFVSQYDVELFQRIEHLIGKKLPAFPTNEEEVMMLTER 373          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Sea Lamprey
Match: ddx39aa (DEAD (Asp-Glu-Ala-Asp) box polypeptide 39Aa [Source:ZFIN;Acc:ZDB-GENE-030131-4275])

HSP 1 Score: 194.512 bits (493), Expect = 1.147e-57
Identity = 139/393 (35.37%), Postives = 216/393 (54.96%), Query Frame = 2
Query:   26 EIESNYDKIVES-FEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGA-KCCSCIGGRNVRDDINNLESGM-HVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPD--EVLKVSNEFMNNPVKILVKKE-ELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAE-MQELENFYNTKIEEMP--INLSEFL 1177
            E++ +Y  I  S F D  LK +LLR I   GFE PS +Q   I  AI G DV+ QA+SG GKTA F +A LQ ++ +      +++  TRELA QI K       YM   K     GG +++ D   L+    H+VVGTPGR+  + +   +    VK F+LDE D+ML +       E  Q L       +L A   D   VL  S+     P+++ V  E +LTL G++Q+YV +   E K   L DL + L   Q VIF     + + L   L  + F   ++H  M Q+ R    ++F+    RIL+ T+L  RG+D+++V++V NYD+P++ + Y+HR+ R GRFG KG+A+ FV+D++ A+ + ++++ +   + E+P  I+LS ++
Sbjct:   33 EVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPTDGQVSVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRLA-LSRNKTLNLKHVKHFILDECDKMLEQLVT--ASEVEQLLHISPHQLLLDACFADLTVVLCCSSWQCYPPMEVFVDDETKLTLHGLQQYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCMALAQLLIEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAVTFVSDENDAKILNDVQDRFEVNVSELPDEIDLSSYI 421          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003898.1 (pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 gene:ENSPMAG00000003524.1 transcript:ENSPMAT00000003898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.57 bits (462), Expect = 4.006e-52
Identity = 133/402 (33.08%), Postives = 211/402 (52.49%), Query Frame = 2
Query:   53 VESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEG-HDVIAQAQSGTGKTATFSIAVLQNI----------DT-----SINSTQ------AIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQY----LSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLY-----ESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINL 1165
            +ESF +L L E ++  +    +E+P+ +QK AI P I+   D++A AQ+G+GKTA F + +L  I          DT     ++   Q      +++LAPTRELA+QI+            + C   GG ++ + +  L+ G H++V TPGR+ DM+++G +  D  +  VLDEAD ML  GF+  +   V+        + Q  + SAT P E+  ++ +F+ + + + V +     E I Q  V V +E  K   L DL      +SLT+    +F   K     L   L S+G+  +S+HGD  Q+ R++ +  FR+G   IL+ T +  RG+D+  V  VIN+DLP + E Y+HRIGR GR G  G A +F  +K+    +EL +      +E+P  L
Sbjct:   58 IESFHELELGEIIMSSVTLCRYERPTPVQKYAI-PIIKAKRDLMACAQTGSGKTAAFLLPILSQIYSGGPGKVVEDTKNQQETVKYGQRKQYPMSLVLAPTRELALQIYDEARKFAYRSCVRPCVVYGGADIGNQVRELQKGCHLLVATPGRLVDMMERGKVGLDHCRYLVLDEADRMLDMGFEPQIRRIVEQDVMPTKGDRQTLMFSATFPKEIQILARDFLEDYIFLAVGRVGSASENITQKVVWV-EEMDKRSFLLDLLNATGRDSLTL----VFVETKKGADALQGFLCSEGYSCTSIHGDRSQRDREEALSLFRTGRRPILVATAVAARGLDIPNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGQATSFYNEKNENMTRELLHLLVEAHQEVPSWL 453          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Sea Lamprey
Match: ddx59 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 59 [Source:ZFIN;Acc:ZDB-GENE-050208-665])

HSP 1 Score: 174.866 bits (442), Expect = 1.731e-49
Identity = 112/391 (28.64%), Postives = 210/391 (53.71%), Query Frame = 2
Query:   47 KIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNI----DTSINSTQAIILAPTRELAVQIH---KVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEG-------IRQFYVNVSQEEYK---FDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKS-KGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINL 1165
            + V  F    + E L + + A G+ +P+ +Q + + PA+ G DVI +A++G+GKTA F + ++  +     + +    A+++ PTRELA+QI    K +M    +M  +    IGG  +   ++ L   + +V+GTPGRV +++++  ++ + V++FV+DE D ML  GF+  V    +    E Q+ ++SAT+P   ++++     +PV+I V  E   + G       +RQ  + V +   K   F+ L D  E L     V+F + K     L D +++  G   +++H D  Q  R  +++   +G   ++++T +L RG+D+  V +V+N+DLP   + Y+H++GR GR GR+G A++ + ++D     +L +       ++P  L
Sbjct:  135 RPVLEFSHCPMPEALAQNLAACGYHEPTPVQMQMLPPALGGRDVIVRAETGSGKTAGFLVPIVALLAGCGPSEVRDPLAVVVTPTRELAMQIERQAKELMAGLPHM--RTALLIGGLPLPPQLHRLRQRVQLVIGTPGRVLEVLRRDALRLNSVRIFVIDEVDTMLKLGFREQVLAVREETPEERQSLLVSATLPTATVELAERLTRDPVRIAVAGEGSEVGGQAAPASNVRQIVLWVEEPSKKKKLFEILKD--EKLYHPPVVVFVDSKMGADLLADAVETVMGLKAAAMHADKPQTERTSVLQGLLAGEYEVVVSTGVLGRGLDLVNVRLVVNFDLPSTMDEYVHQVGRSGRLGRRGTAISLLNNRDRRLFLDLASRVEATGTQLPAQL 521          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Yeast
Match: TIF1 (Translation initiation factor eIF4A; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G; protein abundance increases in response to DNA replication stress; TIF1 has a paralog, TIF2, that arose from the whole genome duplication [Source:SGD;Acc:S000001767])

HSP 1 Score: 480.715 bits (1236), Expect = 7.395e-170
Identity = 240/385 (62.34%), Postives = 308/385 (80.00%), Query Frame = 2
Query:   23 GEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
             +I++NYDK+V  F+D+ L E+LLRG+F YGFE+PSAIQ+RAI+P IEGHDV+AQAQSGTGKT TFSIA LQ IDTS+ + QA++LAPTRELA+QI KV+M L  +M  K  +CIGG +  +D   L     +VVGTPGRV D I++   ++D +KMF+LDEADEMLS GF+  + +    L   TQ  +LSATMP++VL+V+ +FM NPV+ILVKK+ELTLEGI+QFYVNV +EEYK++ L DLY+S+++TQAVIFCN + KV  L   L++  F VS+++ D+ QQ RD IMKEFRSGSSRILI+TDLL RGIDVQQVS+VINYDLP NKENYIHRIGRGGRFGRKGVA+NFVT++D+  M+ELE FY+T+IEE+P +++  L
Sbjct:   11 SQIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLRDA-QIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATLL 394          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Yeast
Match: TIF2 (Translation initiation factor eIF4A; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G; protein abundance increases in response to DNA replication stress; TIF2 has a paralog, TIF1, that arose from the whole genome duplication [Source:SGD;Acc:S000003674])

HSP 1 Score: 480.715 bits (1236), Expect = 7.395e-170
Identity = 240/385 (62.34%), Postives = 308/385 (80.00%), Query Frame = 2
Query:   23 GEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
             +I++NYDK+V  F+D+ L E+LLRG+F YGFE+PSAIQ+RAI+P IEGHDV+AQAQSGTGKT TFSIA LQ IDTS+ + QA++LAPTRELA+QI KV+M L  +M  K  +CIGG +  +D   L     +VVGTPGRV D I++   ++D +KMF+LDEADEMLS GF+  + +    L   TQ  +LSATMP++VL+V+ +FM NPV+ILVKK+ELTLEGI+QFYVNV +EEYK++ L DLY+S+++TQAVIFCN + KV  L   L++  F VS+++ D+ QQ RD IMKEFRSGSSRILI+TDLL RGIDVQQVS+VINYDLP NKENYIHRIGRGGRFGRKGVA+NFVT++D+  M+ELE FY+T+IEE+P +++  L
Sbjct:   11 SQIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLRDA-QIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATLL 394          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Yeast
Match: FAL1 (Nucleolar protein required for maturation of 18S rRNA; member of the eIF4A subfamily of DEAD-box ATP-dependent RNA helicases; 18S rRNA biogenesis defect of the null mutant is functionally complemented by human EIF4A3 [Source:SGD;Acc:S000002428])

HSP 1 Score: 422.165 bits (1084), Expect = 8.769e-147
Identity = 216/379 (56.99%), Postives = 285/379 (75.20%), Query Frame = 2
Query:   47 KIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSR--GFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEF 1174
            K+  +FE +NLK+DLLRGI++YGFE PS+IQ RAI   I G DVIAQAQSGTGKTATF+I +LQ ID      QA+IL+PTRELA QI +V+  LGDYM     +  GG+ ++DD+  ++  G   V GTPGRV DMIKK  +++  V+M VLDEADE+LS   GF+  + +    L    Q  ++SATM  ++L+V+ +FMN+PVKILVK++E++LEGI+Q+ VNV +EE+KFDTLCD+Y+SLTITQ VIFCN K KV +L+  L    F V S+HGDM+Q+ RD++M +FR+G SR+LI+TD+  RGIDVQQVS+VINYDLP+  ENYIHRIGR GRFGRKGVA+NF+T  D+A+++E+E FY+ KI  MP N +E 
Sbjct:   20 KVSSTFESMNLKDDLLRGIYSYGFEAPSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGLLQAIDLRKKDLQALILSPTRELASQIGQVVKNLGDYMNVNAFAITGGKTLKDDLKKMQKHGCQAVSGTPGRVLDMIKKQMLQTRNVQMLVLDEADELLSETLGFKQQIYDIFAKLPKNCQVVVVSATMNKDILEVTRKFMNDPVKILVKRDEISLEGIKQYVVNVDKEEWKFDTLCDIYDSLTITQCVIFCNTKKKVDWLSQRLIQSNFAVVSMHGDMKQEERDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINYDLPEIIENYIHRIGRSGRFGRKGVAINFITKADLAKLREIEKFYSIKINPMPANFAEL 398          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Yeast
Match: DHH1 (Cytoplasmic DEAD-box helicase, stimulates mRNA decapping; coordinates distinct steps in mRNA function and decay, interacting with both decapping and deadenylase complexes; role in translational repression, mRNA decay, and possibly mRNA export; interacts and cooperates with Ngr1p to promote specific mRNA decay; ATP- and RNA-bound form promotes processing body (PB) assembly, while ATPase stimulation by Not1p promotes PB disassembly; forms cytoplasmic foci on replication stress [Source:SGD;Acc:S000002319])

HSP 1 Score: 288.115 bits (736), Expect = 5.840e-93
Identity = 160/373 (42.90%), Postives = 229/373 (61.39%), Query Frame = 2
Query:   59 SFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +FED  LK +LL GIF  GFEKPS IQ+ AI  AI G D++A+A++GTGKTA F I  L+ +   +N  QA+I+ PTRELA+Q  +V+ TLG + G  C    GG N+RDDI  L   +H++VGTPGRV D+  +         +F++DEAD+MLSR F+  + + + +L    Q+ + SAT P  V +   + ++ P +I +  EELTL+GI Q+Y  V +E  K   L  L+  L I QA+IFCN  N+V  L   +   G+     H  M+QQ R+++  EFR G  R L+ +DLL RGID+Q V++VIN+D PK  E Y+HRIGR GRFG  G+A+N +   D   + ++E    T+I  +P  + + L
Sbjct:   47 TFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINL-MEELTLKGITQYYAFV-EERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPATIDKSL 417          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Yeast
Match: DBP5 (Cytoplasmic ATP-dependent RNA helicase of the DEAD-box family; involved in mRNA export from the nucleus, remodeling messenger ribonucleoprotein particles (mRNPs), with ATPase activity stimulated by Gle1p, IP6 and Nup159p; involved in translation termination along with Sup45p (eRF1); role in the cellular response to heat stress [Source:SGD;Acc:S000005572])

HSP 1 Score: 239.58 bits (610), Expect = 1.564e-74
Identity = 153/360 (42.50%), Postives = 225/360 (62.50%), Query Frame = 2
Query:   53 VESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAI---EGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDI-NNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQ-YLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLP------KNKENYIHXXXXXXXXXXXXVALNFVTDKD 1099
             +SF++L L  +LL+GI+A  F+KPS IQ+RA LP +      ++IAQ+QSGTGKTA FS+ +L  ++    S QAI LAP+RELA Q  +V+  +G +   K  S +    V D    N +    V+VGTPG V D++++  ++   +K+FVLDEAD ML +    D C  V+ +L  +TQ  + SAT  D V + + + + N   + ++  E+ ++ I+Q Y++   E  KFD L +LY  +TI  ++IF   K     L   LKS+G  VS +HGD++ Q RD+++ +FR G S++LITT++L RGID+  VSMV+NYDLP       +   YIHRIGR GRFGRKGVA++FV DK+
Sbjct:   91 AKSFDELGLAPELLKGIYAMKFQKPSKIQERA-LPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKF--TKITSQL---IVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELYGLMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHDKN 444          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Nematostella
Match: EDO45225 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTJ5])

HSP 1 Score: 493.812 bits (1270), Expect = 2.735e-174
Identity = 249/389 (64.01%), Postives = 314/389 (80.72%), Query Frame = 2
Query:   29 IESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTS------INSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            IESN+D++VESF+D+NLKE LLRGI+AYGFEKPSAIQ+RAI P  +  DVIAQAQSGTGKTATF+I++LQ IDT+       +  QA++LAPTRELA QI KV++ LGDYM  KC +CIGG NVR+D   LE G+HVVVGTPGRV DMI +G + +  +K+FVLDEADEMLSRGF++ + +    L    Q  +LSATMP +VL+V+N+FM + V+ILVK+EE+TLEGI+QF+V V +E++K DTLCDLYE+LTITQAVIF N + KV +L   +  K   VSS+HGDM Q+ RD IMKEFRSGSSR+LITTDLL RGIDV QVS+VINYDLP N+ENYIHRIGRGGRFGRKG A+NFVT+ D+  ++++E +YNTKIEEMP+N+++ +
Sbjct:   24 IESNWDEVVESFDDMNLKEALLRGIYAYGFEKPSAIQQRAIRPCCQARDVIAQAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDYMHVKCHACIGGTNVREDRMKLEEGVHVVVGTPGRVFDMINRGVLNTRDIKLFVLDEADEMLSRGFKDQIYDVFTRLPTSVQVVLLSATMPTDVLEVTNKFMRDVVRILVKREEVTLEGIKQFFVLVEKEDWKLDTLCDLYETLTITQAVIFANTRRKVDWLAAKMTEKDHTVSSMHGDMSQKERDIIMKEFRSGSSRVLITTDLLARGIDVHQVSLVINYDLPSNRENYIHRIGRGGRFGRKGAAINFVTNDDVRMLKDIEQYYNTKIEEMPMNVADLI 412          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Nematostella
Match: EDO48460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIU5])

HSP 1 Score: 476.093 bits (1224), Expect = 2.033e-167
Identity = 226/385 (58.70%), Postives = 314/385 (81.56%), Query Frame = 2
Query:   26 EIESNYD-KIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            E E++ D +++ +F+ + L+EDLLRGI+AYGFEKPSAIQ+RAI P ++G DVIAQAQSGTGKTATFSI+VLQ IDT +   QA++L+PTRELA QI KV++ LGDYM  +C +CIGG N+ +DI  L+ G H+V GTPGRV DMI++ ++++  +KM VLDEADEML++GF+  + +  +YL   TQ  +LSAT+P E+L+++++FM +P++ILVK++ELTLEGI+QF+V V +EE+KFDTLCDLY++LTITQAVIFCN K KV +L + ++   F V+S+HGDM Q+ R+ IMK+FR+G SR+LI+TD+  RG+DVQQVS+VINYDLP N+E YIHRIGR GRFGRKGVA+NFV   DI  ++++E +Y+T+I+EMP+N+++ +
Sbjct:   23 EFETSEDVEVLPTFDAMKLREDLLRGIYAYGFEKPSAIQQRAIKPILKGRDVIAQAQSGTGKTATFSISVLQAIDTQLREPQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGGTNIGEDIRKLDYGQHIVSGTPGRVFDMIRRRNLRTRSIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVASMHGDMPQKEREAIMKDFRAGQSRVLISTDVWARGLDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPMNVADLI 407          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Nematostella
Match: EDO39940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8H2])

HSP 1 Score: 275.018 bits (702), Expect = 2.657e-88
Identity = 152/365 (41.64%), Postives = 231/365 (63.29%), Query Frame = 2
Query:   62 FEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMP 1156
            FED  LK +LL GIF  GF+KPS IQ+ +I  A+ G D++A+A++GTGKTA + + +L+  DT+ N  QA++L PTRELA+Q  ++ + LG +MGA+     GG +++DDI  L + +HV+V TPGRV D++KK        +M V+DEAD++LS  F+  + + +++L    Q  + SAT P  V     + +  P +I +  +ELTL G+ Q+Y  V +E+ K   L  L++ L I Q++IFCN   +V  L   +   GF    +H  M Q  R+++  +FR G  R L+ +DL  RGID+Q V++VIN+D PKN E Y+HRIGR GRFG  GVA+N +T  D  ++ ++EN  +T+I+ +P
Sbjct:   49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKHMGAQVMVTTGGTSLKDDILRLYNKVHVIVATPGRVLDLMKKKLADMSKCQMLVMDEADKLLSMDFKKMLEQIIKHLPENRQILLFSATFPISVRDFKEKHLRKPYEINL-MDELTLHGVTQYYAFV-EEKQKVHCLNTLFQKLQINQSIIFCNSVQRVELLARKILELGFSCFYIHARMSQSHRNRVFHDFRQGHCRNLVCSDLFTRGIDIQSVNVVINFDFPKNSETYLHRIGRSGRFGHLGVAINLITYDDRFDLYKIENELDTEIKPIP 411          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Nematostella
Match: EDO46214 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQR7])

HSP 1 Score: 242.662 bits (618), Expect = 3.188e-76
Identity = 150/374 (40.11%), Postives = 222/374 (59.36%), Query Frame = 2
Query:   62 FEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLG-DYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQE-------EYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTD-KDIAEMQELENFYNTKIEEMP 1156
            F  L L   LLRG+   GFEKPS IQ +AI     G D+IAQA+SGTGKT  FS+  L+N+ T  N  Q IIL PTRE+AVQ+  VI  +G  Y G  C   IGG ++ +D   L+S  H+ VGTPGRVK +I++ ++K++ V+MF+LDEAD++L   FQ  +      L    Q    SAT P+ +     ++M  P  + +   + +L+GI+QFY  V          + K D L  L  S+   Q ++F N++ +   L+D L  KG+  + + G   Q  R + M++ +S   RILI+TDL  RGID + V++V+N D+P N E Y+HRIGR GRFG +G+A+ +V + K+  E++++E   + K+E +P
Sbjct:   23 FHSLLLSPTLLRGLNEAGFEKPSPIQLKAIPLGRCGLDLIAQAKSGTGKTCVFSVIALENVITESNCIQIIILTPTREIAVQVKDVICAIGCHYDGLACKVFIGGISLEEDKKALKS-CHIAVGTPGRVKYLIEQKYLKTESVRMFILDEADKLLDESFQQQINWIFSALPENKQMMAFSATYPEVLANHLKKYMTEPTFVRLNAADPSLQGIKQFYSLVRFHPLPHKTFQEKVDGLIKLLSSVNFNQCLVFSNYQIRAKSLSDTLCRKGWPSTFIAGYQTQAKRLEAMEKLKSFHCRILISTDLTARGIDAENVNLVVNMDVPHNGETYLHRIGRAGRFGTEGMAVTYVANGKEERELRDIERSIDVKMELLP 395          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Nematostella
Match: EDO46520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPJ2])

HSP 1 Score: 223.787 bits (569), Expect = 1.401e-68
Identity = 142/382 (37.17%), Postives = 226/382 (59.16%), Query Frame = 2
Query:   53 VESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAI--LPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGM----HVVVGTPGRVKDMIKKGH-IKSDFVKMFVLDEADEMLS-RGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNK------ENYIHXXXXXXXXXXXXVALNFV-TDKDIAEMQELENFYNTKIEEM 1153
             +SFE+L L  +L RG++  GF KPS IQ+ A+  L A    ++IAQ+QSGTGKTA F + +L  +D +    Q I L+PT ELA Q  KV     + MG  C        VR   N    G     H+++GTPG + D I+K    +   V +FVLDEAD M++ +G Q+      + L  + Q  + SAT  ++V+K +   + NP+ I +++EE +L+ I+Q+YV     E KF+ LC++Y  L+I Q V+FC+ +    +L + +  +G  V+ + G++  + R  +++ FR G  ++LITT++  RGIDV+QV++VINYD+P +       E Y+HRIGR GRFG+ G+A+NF+   + +  M+++E  +  KI+ +
Sbjct:   45 AKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLADPPVNMIAQSQSGTGKTAAFVLTMLSRVDATKPYPQVICLSPTYELARQTGKV----AEAMGKHCPHIKINYAVRG--NQFPRGQKCTDHIIIGTPGTLLDWIRKSKCFEPRKVSVFVLDEADIMIALQGHQDQSIRIHKSLHKDCQVLLFSATYDEDVMKFAETVVPNPIIIRLRREEESLDNIKQYYVVCKNSEDKFEALCNMYGVLSIGQCVVFCHTRRNAAWLAEKMVKEGHAVALLSGEITIEQRIAVLERFRLGKEKLLITTNVSARGIDVEQVTLVINYDMPMDMQGKADFETYLHRIGRTGRFGKSGIAVNFIDGQRSMNIMKKIEEHFGKKIQHL 420          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Medaka
Match: eif4a1a (eukaryotic initiation factor 4A-I [Source:NCBI gene;Acc:101155548])

HSP 1 Score: 521.931 bits (1343), Expect = 0.000e+0
Identity = 253/390 (64.87%), Postives = 328/390 (84.10%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+++IV+SF+D+NL+E LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ ID  + +TQA++LAPTRELA QI KV++ LGDYMGA C +CIGG N+R+++  L++   H+VVGTPGRV DM+ + +I    +KMFVLDEADEMLSRGF++ + E  Q L++ TQ  +LSATMP +VL+V+ +FM  P++ILVKKEELTLEGIRQFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+N VT+ D   ++++E FYNT +EEMP+N+++ +
Sbjct:   16 MEPDGIIESNWNQIVDSFDDMNLREALLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQIDVEMKATQALVLAPTRELAQQIQKVVLALGDYMGANCYACIGGTNIRNEVQKLQAEAPHIVVGTPGRVFDMLSRKNISPKCIKMFVLDEADEMLSRGFKDQIYEIFQKLASSTQVVLLSATMPADVLEVTKKFMREPIRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNVADLI 405          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Medaka
Match: eif4a2 (eukaryotic translation initiation factor 4A2 [Source:NCBI gene;Acc:101167901])

HSP 1 Score: 519.62 bits (1337), Expect = 0.000e+0
Identity = 253/390 (64.87%), Postives = 326/390 (83.59%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLES-GMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            ME  G IESN+++I ++F+D+NLKE LLRGI+AYGFEKPSAIQ+RAI+P I+G+DVIAQAQSGTGKTATF+I++LQ +D     TQA++LAPTRELA QI KVI+ LGDYMGA C +CIGG N+R +I  L++   H+VVGTPGRV DM+ + H+   ++KMFVLDEADEMLSRGF++ + E  Q LS   Q  +LSATMP +VL+V+ +FM +P++ILVKKEELTLEGI+QFY+NV +EE+K DTLCDLYE+LTITQAVIF N + KV +L + + ++ F VS++HGDM+Q+ RD IM+EFRSGSSR+LITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT++D   ++++E FYNT +EEMP+N+++ +
Sbjct:   22 MEPDGIIESNWNEITDNFDDMNLKETLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLDIEQKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNLRSEIQKLQAEAPHIVVGTPGRVFDMLNRRHLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLSTNIQVVLLSATMPADVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 411          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Medaka
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:NCBI gene;Acc:101159793])

HSP 1 Score: 471.47 bits (1212), Expect = 3.733e-165
Identity = 224/376 (59.57%), Postives = 305/376 (81.12%), Query Frame = 2
Query:   50 IVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +  +F+ + L+EDLLRGI+AYGFEKPSAIQ+RAI   I+G DVIAQ+QSGTGKTATF I+VLQ +D  +  TQA+ILAPTRELA QI KV++ LGDYM  +C +CIGG NV +DI  L+ G HVV GTPGRV DMI++  +++  +KM VLDEADEML++GF+  + +  +YL   TQ  ++SAT+P E+L+++N+FM +P++ILVK++ELTLEGI+QF+V V +EE+KFDTLCDLY++LTITQAVIFCN K KV +L + ++   F VSS+HGDM Q+ R+ IMKEFRSG+SR+LI+TD+  RG+DV QVS++INYDLP N+E YIHRIGR GR+GRKGVA+NFV + DI  ++++E +Y+T+I+EMP+N+++ +
Sbjct:   31 VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCISVLQCLDIQVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Medaka
Match: ENSORLT00000028513.1 (probable ATP-dependent RNA helicase ddx6 [Source:NCBI gene;Acc:101166148])

HSP 1 Score: 276.944 bits (707), Expect = 5.360e-88
Identity = 157/373 (42.09%), Postives = 236/373 (63.27%), Query Frame = 2
Query:   62 FEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGA-KCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            FED  LK +LL GIF  G+EKPS IQ+ +I  A+ G D++A+A++GTGK+  + I +L+ ID   +  QAI++ PTRELA+Q+ ++ + +  +MG  K  +  GG N+RDDI  L+  +HVV+ TPGR+ D+IKKG  K D V+M V+DEAD++LS+ F   + + + +L+   Q  + SAT P  V K   + +  P +I +  EELTL+GI QFY  V+ E  K   L  L+  L I Q++IFCN   +V  L   +   G+    +H  M Q+ R+++  +FR+G  R L+ TDL  RGID+Q V++VIN+D PKN E Y+HRIGR GRFG  G+A+N +T +D   ++ +E    T I+ +P ++ + L
Sbjct:   91 FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDHIQAIVMVPTRELALQVSQISIQISKHMGGVKVMATTGGTNLRDDIMRLDEIVHVVIATPGRILDLIKKGVAKVDRVQMIVMDEADKLLSQDFVVLIEDIISFLAKNRQILLYSATFPMSVQKFMAKHLQKPYEINLM-EELTLKGITQFYAYVT-ERQKVHCLNTLFSRLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKMMQEYRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITSEDRFNLKAIEEQLVTDIKPIPSSIDKSL 461          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Medaka
Match: ENSORLT00000045064.1 (probable ATP-dependent RNA helicase ddx6 [Source:NCBI gene;Acc:101166148])

HSP 1 Score: 276.944 bits (707), Expect = 5.360e-88
Identity = 157/373 (42.09%), Postives = 236/373 (63.27%), Query Frame = 2
Query:   62 FEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGA-KCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            FED  LK +LL GIF  G+EKPS IQ+ +I  A+ G D++A+A++GTGK+  + I +L+ ID   +  QAI++ PTRELA+Q+ ++ + +  +MG  K  +  GG N+RDDI  L+  +HVV+ TPGR+ D+IKKG  K D V+M V+DEAD++LS+ F   + + + +L+   Q  + SAT P  V K   + +  P +I +  EELTL+GI QFY  V+ E  K   L  L+  L I Q++IFCN   +V  L   +   G+    +H  M Q+ R+++  +FR+G  R L+ TDL  RGID+Q V++VIN+D PKN E Y+HRIGR GRFG  G+A+N +T +D   ++ +E    T I+ +P ++ + L
Sbjct:   91 FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDHIQAIVMVPTRELALQVSQISIQISKHMGGVKVMATTGGTNLRDDIMRLDEIVHVVIATPGRILDLIKKGVAKVDRVQMIVMDEADKLLSQDFVVLIEDIISFLAKNRQILLYSATFPMSVQKFMAKHLQKPYEINLM-EELTLKGITQFYAYVT-ERQKVHCLNTLFSRLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKMMQEYRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITSEDRFNLKAIEEQLVTDIKPIPSSIDKSL 461          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Planmine SMEST
Match: SMESG000000613.1 (SMESG000000613.1)

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 337/389 (86.63%), Postives = 364/389 (93.57%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            MEN G IE+NYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSI+VLQNIDTSIN TQAIILAPTRELA QIHKVIMT+GDY+ AKCC+CIGGRNVRDDI+ LESGMHVVVGTPGRVKDM+K+GHIKS+++KMFVLDEADEMLSRGFQ DVCEC+ YL A+ Q FILSATMPDEVL V+  FM +PVKILVK EELTLEGIRQFYVNVSQEEYKFDTL DLYESLTITQAVIFCNFKNKVI L +NLKSKGFVVSSVHGDM+Q +RDQIM EFRSGS+RILITTDLLCRGIDVQQVS+VINYDLPKN+ENYIHRIGRGGRFGRKGVALNFVTD DI+E+Q LE FY TK++EMP+NL+EFL
Sbjct:    1 MENIGVIETNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSISVLQNIDTSINKTQAIILAPTRELAQQIHKVIMTIGDYLSAKCCACIGGRNVRDDISKLESGMHVVVGTPGRVKDMLKRGHIKSEYIKMFVLDEADEMLSRGFQEDVCECITYLEADAQMFILSATMPDEVLTVTKRFMKDPVKILVKTEELTLEGIRQFYVNVSQEEYKFDTLTDLYESLTITQAVIFCNFKNKVITLTENLKSKGFVVSSVHGDMDQSSRDQIMNEFRSGSTRILITTDLLCRGIDVQQVSLVINYDLPKNRENYIHRIGRGGRFGRKGVALNFVTDNDISELQALETFYKTKVDEMPMNLAEFL 389          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Planmine SMEST
Match: SMESG000058317.1 (SMESG000058317.1)

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 285/389 (73.26%), Postives = 342/389 (87.92%), Query Frame = 2
Query:   11 MENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            MENPGEIE+NY+K+ ESF+D+NLKEDLLRGI+AYGFEKPSAIQ+RA+LPAIEGHDVIAQAQSGTGKTATFS+A+LQ ID S N  QA++LAPTRELA QIHKVI+ LGDYMGAK  +CIGG  V++D+ NLE+G+HV+VGTPGRV DMI++G++K++ +KMFVLDEADEMLSRGF+  +   +QY+  +TQ  +LSATMP +VL+V+ +FM NPVKILVKKEELTLEGIRQFYVNV  EEYKF+TL DLYE+LTITQAVIFCN + KV  L D+LK K F+VSS+HGDM+Q  RDQIMKEFRSGSSRILITTDLL RGIDVQQVS+VINYDLP N+ENYIHRIGRGGRFGRKGVA+NFVT  DI  +Q+LE++Y+T IEEMP+N+++ +
Sbjct:    1 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGDEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 389          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Planmine SMEST
Match: SMESG000022208.1 (SMESG000022208.1)

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 276/378 (73.02%), Postives = 329/378 (87.04%), Query Frame = 2
Query:   44 DKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +KI+E+FEDLNLKE+LLRGIFAYGFEKPSAIQK AILPAIEGHDVIAQAQSG+GKT TF+I+VLQN+D S+N  QAIILAPTRELA Q + +I ++GD+MG KCCSCIGGRNV+DDI N++SGM VVVGTPGRVKDMI K HI++  +K+FVLDEADEMLSRGFQ DVC+C+ YL   TQ F+LSAT+PDEVL V+N FM +PV+ILV KEELTLEGIRQFYV+ S++EYK +TL DLY +LTI QAVIFCN+K  VI L +NL  +GF VS+VH D++Q  RDQIM +FR+GS+R+LITTDLLCRGIDVQ +S+VINYDLPKNKENYIHRIGR GR+GRKGVALNFVT+KD   M+E+E FYNT I+E+P++LSEFL
Sbjct:    3 NKIIETFEDLNLKEELLRGIFAYGFEKPSAIQKLAILPAIEGHDVIAQAQSGSGKTRTFTISVLQNVDQSLNKIQAIILAPTRELAQQTNNIITSIGDFMGVKCCSCIGGRNVKDDIRNIKSGMQVVVGTPGRVKDMINKRHIETAHIKIFVLDEADEMLSRGFQQDVCDCLGYLEPATQIFLLSATIPDEVLSVANSFMKDPVRILVNKEELTLEGIRQFYVDCSKDEYKCETLIDLYHNLTIKQAVIFCNYKTSVISLTENLTQQGFTVSAVHSDIDQATRDQIMIQFRNGSTRVLITTDLLCRGIDVQNISIVINYDLPKNKENYIHRIGRCGRYGRKGVALNFVTNKDFQAMKEIERFYNTAIQELPMDLSEFL 380          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Planmine SMEST
Match: SMESG000040535.1 (SMESG000040535.1)

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 274/378 (72.49%), Postives = 328/378 (86.77%), Query Frame = 2
Query:   44 DKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHXXXXXXXXXXXXVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL 1177
            +KI+E+FEDLNLKE+LLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSG+GKT TF+I+VLQN+D S+N  QAIILAPTRELA Q + +I ++GD+MG KCC+CIGGRNV+DDI N++SGM VVVGTPGRVKDMI K HI++  +K+FVLDEADEMLSRGFQ DVC+C+ YL   TQ F+LSATMPD+VL V+N FM +PV+ILV KEELTLEGIRQFYV+  ++EYK +TL DLY +LTI QAVIFCN+K  VI L +NL  +GF VS+VH D++Q  RDQIM +FR+GS+R+LITTDLL RGIDVQ +S+VINYDLPKNKENYIHRIGR GR+GRKGVALNFVT+KD   M+E+E FYNT I+E+P++LSEFL
Sbjct:    3 NKIIETFEDLNLKEELLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGSGKTGTFAISVLQNVDQSLNKVQAIILAPTRELAQQTNNIITSIGDFMGVKCCACIGGRNVKDDIRNIKSGMQVVVGTPGRVKDMINKRHIETTHIKIFVLDEADEMLSRGFQQDVCDCLGYLEPGTQIFLLSATMPDDVLSVANSFMKDPVRILVNKEELTLEGIRQFYVDCGRDEYKCETLVDLYHNLTIKQAVIFCNYKTSVISLTENLTQQGFTVSAVHSDIDQATRDQIMVQFRNGSTRVLITTDLLYRGIDVQNISIVINYDLPKNKENYIHRIGRCGRYGRKGVALNFVTNKDFQAMKEIERFYNTAIQELPMDLSEFL 380          
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Planmine SMEST
Match: SMESG000027666.1 (SMESG000027666.1)

HSP 1 Score: 516.153 bits (1328), Expect = 0.000e+0
Identity = 239/330 (72.42%), Postives = 285/330 (86.36%), Query Frame = 2
Query:   44 DKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELAVQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKDMIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSATMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLCDLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQIMKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIH 1033
            +KI+E+FEDLNLKE+LLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSG+GKT TF+I+VLQN+D S+N  QAIILAPTRELA Q + +I ++GD+MG KCC+CIGGRN++DDI N++SGM VVVGTPGRVKDMI K HI++  +K+FVLDEADEMLSRGFQ DVC+C+ YL   TQ F+LSATMPD+VL V+N FM +PV+ILV KEELTLEGIRQFYV+  + EYK +TL DLY +LTI Q VIFCN+K  VI L +NL  +GF VS+VH D++Q  RDQIM +FR+GS+R+LITTDLLCRGIDVQ +S+VINYDLPKNKENYIH
Sbjct:    3 NKIIETFEDLNLKEELLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGSGKTGTFAISVLQNVDQSLNKVQAIILAPTRELAQQTNNIITSIGDFMGVKCCACIGGRNIKDDIRNIKSGMQVVVGTPGRVKDMINKRHIETTHIKIFVLDEADEMLSRGFQQDVCDCLGYLEPGTQIFLLSATMPDDVLSVANSFMKDPVRILVNKEELTLEGIRQFYVDCGRAEYKCETLVDLYHNLTIKQVVIFCNYKTSVISLTENLTQQGFTVSAVHSDIDQATRDQIMVQFRNGSTRVLITTDLLCRGIDVQNISIVINYDLPKNKENYIH 332          
The following BLAST results are available for this feature:
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF4A10.000e+064.87eukaryotic translation initiation factor 4A1 [Sour... [more]
EIF4A20.000e+064.10eukaryotic translation initiation factor 4A2 [Sour... [more]
EIF4A20.000e+064.10eukaryotic translation initiation factor 4A2 [Sour... [more]
EIF4A24.320e-16964.62eukaryotic translation initiation factor 4A2 [Sour... [more]
EIF4A34.751e-16659.84eukaryotic translation initiation factor 4A3 [Sour... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inf-11.213e-17362.60Eukaryotic initiation factor 4A [Source:UniProtKB... [more]
inf-11.213e-17362.60Eukaryotic initiation factor 4A [Source:UniProtKB... [more]
inf-11.213e-17362.60Eukaryotic initiation factor 4A [Source:UniProtKB... [more]
Y65B4A.62.647e-16558.44pep chromosome:WBcel235:I:629492:636350:-1 gene:WB... [more]
F33D11.106.550e-16557.92pep chromosome:WBcel235:I:5866514:5868139:-1 gene:... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eIF4A1.370e-17764.10gene:FBgn0001942 transcript:FBtr0079178[more]
eIF4A1.370e-17764.10gene:FBgn0001942 transcript:FBtr0079175[more]
eIF4A1.370e-17764.10gene:FBgn0001942 transcript:FBtr0079177[more]
eIF4A1.370e-17764.10gene:FBgn0001942 transcript:FBtr0307068[more]
eIF4A1.370e-17764.10gene:FBgn0001942 transcript:FBtr0079176[more]
back to top
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4a1a0.000e+065.90eukaryotic translation initiation factor 4A1A [Sou... [more]
eif4a1b0.000e+066.41eukaryotic translation initiation factor 4A1B [Sou... [more]
eif4a1b0.000e+066.41eukaryotic translation initiation factor 4A1B [Sou... [more]
eif4a1b0.000e+066.41eukaryotic translation initiation factor 4A1B [Sou... [more]
eif4a1b0.000e+066.58eukaryotic translation initiation factor 4A1B [Sou... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4a10.000e+064.36eukaryotic translation initiation factor 4A1 [Sour... [more]
eif4a10.000e+064.36eukaryotic translation initiation factor 4A1 [Sour... [more]
eif4a10.000e+064.36eukaryotic translation initiation factor 4A1 [Sour... [more]
eif4a10.000e+064.36eukaryotic translation initiation factor 4A1 [Sour... [more]
eif4a10.000e+064.36eukaryotic translation initiation factor 4A1 [Sour... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eif4a10.000e+064.87eukaryotic translation initiation factor 4A1 [Sour... [more]
Eif4a20.000e+064.10eukaryotic translation initiation factor 4A2 [Sour... [more]
Eif4a20.000e+064.10eukaryotic translation initiation factor 4A2 [Sour... [more]
Eif4a22.966e-16964.62eukaryotic translation initiation factor 4A2 [Sour... [more]
Eif4a22.966e-16964.62eukaryotic translation initiation factor 4A2 [Sour... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-like Protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2HFP1|IF4A_CHAGB0.000e+066.23ATP-dependent RNA helicase eIF4A OS=Chaetomium glo... [more]
sp|A4QVP2|IF4A_MAGO70.000e+066.49ATP-dependent RNA helicase eIF4A OS=Magnaporthe or... [more]
sp|Q7RV88|IF4A_NEUCR0.000e+066.49ATP-dependent RNA helicase eIF4A OS=Neurospora cra... [more]
sp|P60843|IF4A1_MOUSE0.000e+064.87Eukaryotic initiation factor 4A-I OS=Mus musculus ... [more]
sp|P60842|IF4A1_HUMAN0.000e+064.87Eukaryotic initiation factor 4A-I OS=Homo sapiens ... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-like Protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|196280440.000e+072.49tr|A4V6N0|A4V6N0_DUGJA eIF4A isoform 1A protein OS... [more]
gnl|BL_ORD_ID|210470440.000e+067.87tr|A0A1V9XU99|A0A1V9XU99_9ACAR Eukaryotic initiati... [more]
gnl|BL_ORD_ID|106287610.000e+066.75tr|A0A162WHS4|A0A162WHS4_PHYB8 Uncharacterized pro... [more]
gnl|BL_ORD_ID|120654790.000e+066.49tr|A0A1Y2AK30|A0A1Y2AK30_9FUNG DEAD-domain-contain... [more]
gnl|BL_ORD_ID|106049850.000e+066.49tr|A0A162T1N1|A0A162T1N1_PHYB8 Uncharacterized pro... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4a1a0.000e+064.87eukaryotic initiation factor 4A-I [Source:NCBI gen... [more]
eif4a20.000e+064.87eukaryotic translation initiation factor 4A2 [Sour... [more]
eif4a37.977e-16559.31eukaryotic translation initiation factor 4A3 [Sour... [more]
eif4a1b6.783e-16360.51eukaryotic translation initiation factor 4A1B [Sou... [more]
eif4a33.609e-16260.38eukaryotic translation initiation factor 4A3 [Sour... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx68.299e-8741.02DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN... [more]
ENSPMAT00000000216.13.592e-5832.78pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-... [more]
ddx39aa1.147e-5735.37DEAD (Asp-Glu-Ala-Asp) box polypeptide 39Aa [Sourc... [more]
ENSPMAT00000003898.14.006e-5233.08pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 ... [more]
ddx591.731e-4928.64DEAD (Asp-Glu-Ala-Asp) box polypeptide 59 [Source:... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TIF17.395e-17062.34Translation initiation factor eIF4A; DEA(D/H)-box ... [more]
TIF27.395e-17062.34Translation initiation factor eIF4A; DEA(D/H)-box ... [more]
FAL18.769e-14756.99Nucleolar protein required for maturation of 18S r... [more]
DHH15.840e-9342.90Cytoplasmic DEAD-box helicase, stimulates mRNA dec... [more]
DBP51.564e-7442.50Cytoplasmic ATP-dependent RNA helicase of the DEAD... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO452252.735e-17464.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484602.033e-16758.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399402.657e-8841.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462143.188e-7640.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465201.401e-6837.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4a1a0.000e+064.87eukaryotic initiation factor 4A-I [Source:NCBI gen... [more]
eif4a20.000e+064.87eukaryotic translation initiation factor 4A2 [Sour... [more]
eif4a33.733e-16559.57eukaryotic translation initiation factor 4A3 [Sour... [more]
ENSORLT00000028513.15.360e-8842.09probable ATP-dependent RNA helicase ddx6 [Source:N... [more]
ENSORLT00000045064.15.360e-8842.09probable ATP-dependent RNA helicase ddx6 [Source:N... [more]
back to top
BLAST of Eukaryotic initiation factor 4A-like Protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000613.10.000e+086.63SMESG000000613.1[more]
SMESG000058317.10.000e+073.26SMESG000058317.1[more]
SMESG000022208.10.000e+073.02SMESG000022208.1[more]
SMESG000040535.10.000e+072.49SMESG000040535.1[more]
SMESG000027666.10.000e+072.42SMESG000027666.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003202 ID=SMED30003202|Name=Eukaryotic initiation factor 4A-like Protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1324bp
ATTAATAACAATGGAAAATCCAGGAGAAATAGAAAGTAATTACGACAAAA
TAGTTGAATCATTTGAAGATTTAAACTTAAAAGAAGATTTGTTAAGAGGA
ATCTTTGCTTATGGTTTTGAAAAACCTTCTGCTATTCAGAAGCGTGCTAT
TTTGCCAGCTATTGAAGGTCACGATGTCATTGCCCAAGCACAATCTGGAA
CCGGAAAAACTGCCACTTTCAGTATTGCTGTTTTGCAGAATATTGACACT
TCTATCAATTCTACACAAGCTATTATTCTAGCACCTACCAGAGAACTTGC
AGTTCAAATCCACAAAGTTATAATGACCCTTGGTGACTATATGGGAGCTA
AATGTTGCTCATGCATTGGTGGAAGAAATGTCCGTGACGACATTAACAAT
TTGGAAAGTGGAATGCATGTTGTTGTCGGTACTCCAGGACGAGTTAAAGA
TATGATAAAGAAGGGCCATATTAAATCAGATTTCGTGAAAATGTTTGTCC
TTGATGAAGCCGATGAAATGTTGAGTCGAGGTTTTCAAAATGACGTTTGT
GAATGCGTTCAATATTTATCTGCCGAAACCCAAAATTTCATTCTTTCTGC
AACAATGCCAGATGAAGTTTTAAAAGTCAGTAACGAATTCATGAATAATC
CAGTGAAAATTCTCGTTAAAAAAGAGGAATTGACTCTGGAAGGTATTCGT
CAATTCTACGTTAACGTTAGCCAAGAAGAATACAAATTTGATACCTTATG
TGATTTATATGAATCTCTGACCATCACCCAAGCTGTCATTTTCTGTAACT
TCAAAAACAAAGTTATATTTTTAAATGATAACTTGAAAAGTAAAGGATTT
GTTGTTTCATCAGTCCACGGTGACATGGAGCAACAAGCTAGAGACCAGAT
TATGAAAGAGTTCCGAAGTGGATCAAGTAGAATTCTCATCACCACAGATT
TGCTATGCCGAGGTATTGACGTCCAACAAGTCTCAATGGTCATTAATTAT
GATTTGCCTAAAAACAAAGAAAATTATATTCATCGAATTGGCAGAGGAGG
CCGATTCGGAAGGAAAGGAGTTGCACTAAATTTTGTCACAGACAAAGATA
TTGCTGAAATGCAGGAGCTGGAAAATTTTTATAACACCAAGATTGAAGAG
ATGCCCATTAATTTATCTGAATTCTTATAAATGATTTACCGCTATTTTTG
TAAATAAATTTTAATTTACAATTAAATTAGGTTATTCATAACTTCCTTTG
TTACGTAATTTTTGCTATCTTATCTATTTTTGTTAGTAATGTATTTATGC
TGCGTCACATTTTTGTTGCAAATT
back to top

protein sequence of SMED30003202-orf-1

>SMED30003202-orf-1 ID=SMED30003202-orf-1|Name=SMED30003202-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=393bp
LITMENPGEIESNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAI
LPAIEGHDVIAQAQSGTGKTATFSIAVLQNIDTSINSTQAIILAPTRELA
VQIHKVIMTLGDYMGAKCCSCIGGRNVRDDINNLESGMHVVVGTPGRVKD
MIKKGHIKSDFVKMFVLDEADEMLSRGFQNDVCECVQYLSAETQNFILSA
TMPDEVLKVSNEFMNNPVKILVKKEELTLEGIRQFYVNVSQEEYKFDTLC
DLYESLTITQAVIFCNFKNKVIFLNDNLKSKGFVVSSVHGDMEQQARDQI
MKEFRSGSSRILITTDLLCRGIDVQQVSMVINYDLPKNKENYIHRIGRGG
RFGRKGVALNFVTDKDIAEMQELENFYNTKIEEMPINLSEFL*
back to top
Aliases
The feature 'Eukaryotic initiation factor 4A-like Protein' has the following synonyms
Synonym
eIF4a-like
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002087primitive gut
PLANA:0000029primitive ectoderm
PLANA:0004517blastomere
PLANA:0000058embryonic digestive system
PLANA:0000023embryonic pharynx
PLANA:0000211primitive ectoderm cell
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000002Stage 2
PLANA:0000003Stage 3
PLANA:0000004Stage 4
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR000629RNA-helicase_DEAD-box_CS
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0003743translation initiation factor activity
GO:0004386helicase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0006413translational initiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 38..235
e-value: 6.1E-53
score: 191.9
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 50..220
score: 28.258
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 272..353
e-value: 3.6E-31
score: 119.6
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 245..353
e-value: 7.0E-29
score: 100.4
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 231..392
score: 24.078
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 44..208
e-value: 1.3E-43
score: 148.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 8..227
e-value: 7.9E-67
score: 226.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 228..392
e-value: 6.1E-57
score: 193.5
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 8..370
NoneNo IPR availablePANTHERPTHR24031:SF560coord: 8..370
NoneNo IPR availableCDDcd18046DEADc_EIF4AII_EIF4AI_DDX2coord: 21..221
e-value: 2.28388E-117
score: 337.496
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 232..347
e-value: 2.087E-42
score: 143.032
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 166..174
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 19..47
score: 10.705
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 87..373