Adenosine kinase

Overview
NameAdenosine kinase
Smed IDSMED30003196
Length (bp)1162
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Adenosine kinase (SMED30003196) t-SNE clustered cells

Violin plots show distribution of expression levels for Adenosine kinase (SMED30003196) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Adenosine kinase (SMED30003196) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Adenosine kinase (SMED30003196) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003196

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30003196SMESG000027213.1 Contig958GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30003196SMESG000027213.1 tr5_1296mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30003196SMESG000062286.1 SMESG000027213.1 dd_Smed_v4_627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30003196SMESG000062286.1 SMESG000027213.1 dd_Smed_v4_627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003196SMESG000062286.1 SMESG000027213.1 dd_Smed_v4_627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003196SMESG000062286.1 SMESG000027213.1 dd_Smed_v4_627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003196SMESG000027213.1 Contig49456uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003196SMESG000027213.1 Contig49456newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Adenosine kinase vs. Ensembl Human
Match: ADK (adenosine kinase [Source:HGNC Symbol;Acc:HGNC:257])

HSP 1 Score: 316.62 bits (810), Expect = 7.935e-106
Identity = 157/344 (45.64%), Postives = 221/344 (64.24%), Query Frame = 1
Query:   34 SKMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            + + + +LFGMGNPLLDI A V  D + KY+LK ND ILAE+KH  L+DE+V  +KV Y  GG+TQN+IKVAQW++++ + A+ + GC+  DK+G+ L     +  V   Y Y    + TG CA  ITG NRSL+ +L A+ C     HLD  + W  VE++ + YI+ FF+T   E+++KVA H+ ENN+ F LNL A F+ +F+   + + + Y D +FGNE EA   A+   + T DIKEIA K   LP  N  R R V+ TQG D TI+  + +V AF ++      I+DT GAGDAFVGGFL+QL+  K L +C++  ++ A +IIR+ GCTFPEK D+
Sbjct:    2 TSVRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKAAEAHVDAHY-YEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDF 344          
BLAST of Adenosine kinase vs. Ensembl Human
Match: ADK (adenosine kinase [Source:HGNC Symbol;Acc:HGNC:257])

HSP 1 Score: 317.39 bits (812), Expect = 9.428e-106
Identity = 157/342 (45.91%), Postives = 220/342 (64.33%), Query Frame = 1
Query:   40 MTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            + + +LFGMGNPLLDI A V  D + KY+LK ND ILAE+KH  L+DE+V  +KV Y  GG+TQN+IKVAQW++++ + A+ + GC+  DK+G+ L     +  V   Y Y    + TG CA  ITG NRSL+ +L A+ C     HLD  + W  VE++ + YI+ FF+T   E+++KVA H+ ENN+ F LNL A F+ +F+   + + + Y D +FGNE EA   A+   + T DIKEIA K   LP  N  R R V+ TQG D TI+  + +V AF ++      I+DT GAGDAFVGGFL+QL+  K L +C++  ++ A +IIR+ GCTFPEK D+
Sbjct:   21 LRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKAAEAHVDAHY-YEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDF 361          
BLAST of Adenosine kinase vs. Ensembl Human
Match: ADK (adenosine kinase [Source:HGNC Symbol;Acc:HGNC:257])

HSP 1 Score: 281.567 bits (719), Expect = 2.349e-92
Identity = 145/344 (42.15%), Postives = 207/344 (60.17%), Query Frame = 1
Query:   34 SKMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            + + + +LFGMGNPLLDI A V  D + K+                  DE+V  +KV Y  GG+TQN+IKVAQW++++ + A+ + GC+  DK+G+ L     +  V   Y Y    + TG CA  ITG NRSL+ +L A+ C     HLD  + W  VE++ + YI+ FF+T   E+++KVA H+ ENN+ F LNL A F+ +F+   + + + Y D +FGNE EA   A+   + T DIKEIA K   LP  N  R R V+ TQG D TI+  + +V AF ++      I+DT GAGDAFVGGFL+QL+  K L +C++  ++ A +IIR+ GCTFPEK D+
Sbjct:    2 TSVRENILFGMGNPLLDISAVVDKDFLDKF------------------DELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKAAEAHVDAHY-YEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDF 326          
BLAST of Adenosine kinase vs. Ensembl Human
Match: ADK (adenosine kinase [Source:HGNC Symbol;Acc:HGNC:257])

HSP 1 Score: 272.707 bits (696), Expect = 1.428e-88
Identity = 139/305 (45.57%), Postives = 192/305 (62.95%), Query Frame = 1
Query:   40 MTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFL 948
            + + +LFGMGNPLLDI A V  D + KY+LK ND ILAE+KH  L+DE+V  +KV Y  GG+TQN+IKVAQW++++ + A+ + GC+  DK+G+ L     +  V   Y Y    + TG CA  ITG NRSL+ +L A+ C     HLD  + W  VE++ + YI+ FF+T   E+++KVA H+ ENN+ F LNL A F+ +F+   + + + Y D +FGNE EA   A+   + T DIKEIA K   LP  N  R R V+ TQG D TI+  + +V AF ++      I+DT GAGDAFVGG L
Sbjct:   21 LRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKAAEAHVDAHY-YEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGIL 324          
BLAST of Adenosine kinase vs. Ensembl Human
Match: ADK (adenosine kinase [Source:HGNC Symbol;Acc:HGNC:257])

HSP 1 Score: 267.314 bits (682), Expect = 2.399e-86
Identity = 137/304 (45.07%), Postives = 191/304 (62.83%), Query Frame = 1
Query:   34 SKMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVG 939
            + + + +LFGMGNPLLDI A V  D + KY+LK ND ILAE+KH  L+DE+V  +KV Y  GG+TQN+IKVAQW++++ + A+ + GC+  DK+G+ L     +  V   Y Y    + TG CA  ITG NRSL+ +L A+ C     HLD  + W  VE++ + YI+ FF+T   E+++KVA H+ ENN+ F LNL A F+ +F+   + + + Y D +FGNE EA   A+   + T DIKEIA K   LP  N  R R V+ TQG D TI+  + +V AF ++      I+DT GAGDAFVG
Sbjct:    2 TSVRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKAAEAHVDAHY-YEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVG 304          
BLAST of Adenosine kinase vs. Ensembl Celegans
Match: R07H5.8 (pep chromosome:WBcel235:IV:11209309:11210831:-1 gene:WBGene00011128.1 transcript:R07H5.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R07H5.8)

HSP 1 Score: 307.76 bits (787), Expect = 1.094e-102
Identity = 158/344 (45.93%), Postives = 215/344 (62.50%), Query Frame = 1
Query:   34 SKMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPET--TGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            S + +  L GM NPLLDI   V    + K+ LKENDAIL ++KH  ++ E+  ++KV YIPGGA QN+++VAQW+L     +V+ G V  D+YG  L    ++ GV   YQ N   ET  TG CA LI G +RSL   L A+  FT DHL K E  K +EQ+  FY++ FFIT C  A++++A HS E NKTF LNL A F+ +FF  +++E I   D +FGNE EA   A+   + TT +KEIA+K + LP K+  + R VV TQG +P I+V   +V  FP+ ++    IVDT GAGDAFVGGFL+Q + GK +E  V C ++ A  II++ GCT P  C +
Sbjct:    2 SPLPENTLIGMCNPLLDIQTTVEKAFLDKWGLKENDAILCDDKHNDMFTELTRDFKVEYIPGGAAQNSLRVAQWILNAPNRTVFFGAVGKDQYGDLLASKAKEAGVNVHYQIN---ETVKTGTCAALINGTHRSLCAHLAAANTFTQDHLQKEENQKIIEQAKYFYVTGFFITVCPPAILQLASHSAEFNKTFTLNLSAPFISQFFFDKLSEIIPLVDVLFGNEDEAAAFAKANGWETTCVKEIALKAAALPKKS-TKPRLVVFTQGPEPVIVVEGDKVTEFPVTRLPKEEIVDTNGAGDAFVGGFLSQFIQGKGVEASVTCGSYAAQEIIKKHGCTVPSVCKY 341          
BLAST of Adenosine kinase vs. Ensembl Fly
Match: AdenoK (gene:FBgn0036337 transcript:FBtr0346531)

HSP 1 Score: 300.056 bits (767), Expect = 1.576e-99
Identity = 140/336 (41.67%), Postives = 221/336 (65.77%), Query Frame = 1
Query:   34 SKMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTF 1041
            S + + +L G GNPLLDI A V L+ ++KY++ E+DAILAE++HMP+Y E+V+ Y+  ++ GG+ QN++++AQW+L++   +V+ GCV +D+Y   L E  +  G+   YQ       TG CA LITG +RSL  +L A+  FT DHL++P     V+ +  +YIS FF+T    ++++VA  +    + F +NL A F+ +F+ A +  ++ Y D +FGNEAEA   A+   + + D++EI  ++  +  KNP R R  ++TQG DP +++ +  V+ FP+ K++ + IVDT GAGDAFVGGFL+Q + GKSL+ C++C N+ AG II+  GCT+
Sbjct:    3 STLQEGILVGCGNPLLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQAEFLAGGSVQNSLRIAQWILRQPRVAVFFGCVGEDRYANILKEKAQAAGLDVHYQVKKD-VPTGTCAVLITGTHRSLCANLAAANNFTIDHLEEPSNKALVDNAQYYYISGFFLTVNPPSIMQVAATAHAKQRPFLMNLSAPFISQFYMAPLLAALPYVDIIFGNEAEAQAFAEAQQWPSGDLREIGKRLVAMEKKNPTRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDAFVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTY 337          
BLAST of Adenosine kinase vs. Ensembl Fly
Match: AdenoK (gene:FBgn0036337 transcript:FBtr0075895)

HSP 1 Score: 300.056 bits (767), Expect = 1.576e-99
Identity = 140/336 (41.67%), Postives = 221/336 (65.77%), Query Frame = 1
Query:   34 SKMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTF 1041
            S + + +L G GNPLLDI A V L+ ++KY++ E+DAILAE++HMP+Y E+V+ Y+  ++ GG+ QN++++AQW+L++   +V+ GCV +D+Y   L E  +  G+   YQ       TG CA LITG +RSL  +L A+  FT DHL++P     V+ +  +YIS FF+T    ++++VA  +    + F +NL A F+ +F+ A +  ++ Y D +FGNEAEA   A+   + + D++EI  ++  +  KNP R R  ++TQG DP +++ +  V+ FP+ K++ + IVDT GAGDAFVGGFL+Q + GKSL+ C++C N+ AG II+  GCT+
Sbjct:    3 STLQEGILVGCGNPLLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQAEFLAGGSVQNSLRIAQWILRQPRVAVFFGCVGEDRYANILKEKAQAAGLDVHYQVKKD-VPTGTCAVLITGTHRSLCANLAAANNFTIDHLEEPSNKALVDNAQYYYISGFFLTVNPPSIMQVAATAHAKQRPFLMNLSAPFISQFYMAPLLAALPYVDIIFGNEAEAQAFAEAQQWPSGDLREIGKRLVAMEKKNPTRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDAFVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTY 337          
BLAST of Adenosine kinase vs. Ensembl Fly
Match: AdenoK (gene:FBgn0036337 transcript:FBtr0075896)

HSP 1 Score: 298.901 bits (764), Expect = 3.879e-99
Identity = 139/335 (41.49%), Postives = 221/335 (65.97%), Query Frame = 1
Query:   37 KMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTF 1041
            ++ + +L G GNPLLDI A V L+ ++KY++ E+DAILAE++HMP+Y E+V+ Y+  ++ GG+ QN++++AQW+L++   +V+ GCV +D+Y   L E  +  G+   YQ       TG CA LITG +RSL  +L A+  FT DHL++P     V+ +  +YIS FF+T    ++++VA  +    + F +NL A F+ +F+ A +  ++ Y D +FGNEAEA   A+   + + D++EI  ++  +  KNP R R  ++TQG DP +++ +  V+ FP+ K++ + IVDT GAGDAFVGGFL+Q + GKSL+ C++C N+ AG II+  GCT+
Sbjct:    4 RVREGILVGCGNPLLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQAEFLAGGSVQNSLRIAQWILRQPRVAVFFGCVGEDRYANILKEKAQAAGLDVHYQVKKD-VPTGTCAVLITGTHRSLCANLAAANNFTIDHLEEPSNKALVDNAQYYYISGFFLTVNPPSIMQVAATAHAKQRPFLMNLSAPFISQFYMAPLLAALPYVDIIFGNEAEAQAFAEAQQWPSGDLREIGKRLVAMEKKNPTRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDAFVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTY 337          
BLAST of Adenosine kinase vs. Ensembl Fly
Match: CG3809 (gene:FBgn0037995 transcript:FBtr0082545)

HSP 1 Score: 216.468 bits (550), Expect = 1.924e-66
Identity = 116/349 (33.24%), Postives = 195/349 (55.87%), Query Frame = 1
Query:   31 KSKMTDKLLFGMGNPLLDIIADVSLDLI-KKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKG-QVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCT------FPEKC 1053
            +  + + +L G GNPLLDI   V  ++I +KY L+ N AI+A+EKH  L+DE+++   V+Y  GGA QN++++ QW+++  + +V+ G V  DK G ++ +  +  G+ TLYQ       TG CA +I G NRSLV +LGA+  F+ D +D+ +    ++++  FY + FF+  C  A+ +VA+   E N+   LN  A F+++     +   ++Y D +  N+ EA+  +   ++ T +I EI  ++ Q+P +N  R R V+IT    P ++     +V  +P+  +    I DT G GDAFVGGFLA  +    L+ C++   + +  ++   G        F EKC
Sbjct:   49 RMDLPEGILMGFGNPLLDITCTVEDNVILEKYGLEANAAIIADEKHDALFDELMNMENVIYSAGGACQNSMRIFQWIVQTPFRAVFIGSVGKDKLGDRIEKRAKSDGLLTLYQLKE-ELPTGSCAVIINGPNRSLVANLGAASLFSDDWIDEDDNICALDRAEYFYFTGFFLAVCPPAVERVARMCCETNRIMILNFSAVFVLQMQKEALGNILQYVDIIICNKEEAIAFSDTNDWKTKNIFEIGSRLQQMPKEN-TRPRLVMITDAVCPVLVFQDNDRVLEYPVPPVKQGEIFDTNGCGDAFVGGFLAMYVQRMPLDYCIRTGIFASQQVLHVVGVQIDKLPKFSEKC 395          
BLAST of Adenosine kinase vs. Ensembl Fly
Match: Ady43A (gene:FBgn0026602 transcript:FBtr0089050)

HSP 1 Score: 111.309 bits (277), Expect = 4.326e-27
Identity = 88/350 (25.14%), Postives = 159/350 (45.43%), Query Frame = 1
Query:   43 TDKLLFGMGNPLLDIIADVS-LDLIKKYNLK-ENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHL------DKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIV--YKGQVRAFPIVKISDNR------IVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFP 1044
            T + +   GN LLD +  +    L++++ L+  +   L  EK   L  E  ++ + +  PGG+  NT ++ + +      +++ G V  DK+ ++L +     G+    Q       TG C CL+   N +L  ++GAS +F    L      +     + VE+  + Y+  FF+    +    + +H +   +   LNL A ++V   +  + +    A ++FGN  E   LA+    G  ++ E+A  + Q         + + +T G+    ++  Y  ++     V   D R      +VD TGAGDAFV GFL   L  +SL +C++ A+  A  ++ Q GC  P
Sbjct:   27 TPRKVICFGNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSALNTARILKQL---GTDALFFGAVGADKHAEELRQIIRDRGIEARLQ-TVEDAHTGQCVCLMYQDNPTLYANIGASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRLALNLSAPYIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAG-GFRNVDELADHLLQ-----SGGTKVIFVTNGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLVDATGAGDAFVAGFLHAWLEKRSLGECIRMASSVAAKVVTQVGCNLP 366          
BLAST of Adenosine kinase vs. Ensembl Zebrafish
Match: adka (adenosine kinase a [Source:ZFIN;Acc:ZDB-GENE-030425-3])

HSP 1 Score: 343.199 bits (879), Expect = 2.983e-116
Identity = 170/345 (49.28%), Postives = 227/345 (65.80%), Query Frame = 1
Query:   31 KSKMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            + K++   LFGMGNPLLDI A V  D + KY LK ND ILAE+KH  +++EMV  +KV Y  GGATQN++KVAQW++++ +    + GC+  DK+GK L E  E+  V   Y Y    E TG CA  ITG NRSLV +L A+ C     HLD  E WK VE++ ++YI+ FF+T   E+++KVAKH+ ENNK FCLNL A F+ EFF   + + + Y D +FGNE EA   A+   + T DI+EIA K   LP +N  R R VV TQG + T++    +V  FP+++I  + IVDT GAGDAFVGGFL+QL+  K+ E C++  ++ A VIIR AGCTFPEK D+
Sbjct:   15 EKKLSQNALFGMGNPLLDICAVVDKDFLDKYGLKPNDQILAEDKHKEMFEEMVKKFKVEYRAGGATQNSVKVAQWMIQEPHNVGTFFGCIGKDKFGKILKEKAEEAHVDAHY-YEQSEEPTGSCAACITGDNRSLVANLAAANCYKKEKHLDLEENWKLVEKAQVYYIAGFFLTVSLESILKVAKHASENNKIFCLNLSAPFICEFFKEALMKVMPYVDILFGNETEAAAFAREQGFETEDIEEIAKKAQSLPKENKKRQRIVVFTQGKEGTVMAKGDKVETFPVLEIDQSEIVDTNGAGDAFVGGFLSQLVQDKTFEQCIRAGHYAANVIIRHAGCTFPEKPDF 358          
BLAST of Adenosine kinase vs. Ensembl Zebrafish
Match: adka (adenosine kinase a [Source:ZFIN;Acc:ZDB-GENE-030425-3])

HSP 1 Score: 340.502 bits (872), Expect = 2.471e-115
Identity = 169/337 (50.15%), Postives = 223/337 (66.17%), Query Frame = 1
Query:   55 LFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            LFGMGNPLLDI A V  D + KY LK ND ILAE+KH  +++EMV  +KV Y  GGATQN++KVAQW++++ +    + GC+  DK+GK L E  E+  V   Y Y    E TG CA  ITG NRSLV +L A+ C     HLD  E WK VE++ ++YI+ FF+T   E+++KVAKH+ ENNK FCLNL A F+ EFF   + + + Y D +FGNE EA   A+   + T DI+EIA K   LP +N  R R VV TQG + T++    +V  FP+++I  + IVDT GAGDAFVGGFL+QL+  K+ E C++  ++ A VIIR AGCTFPEK D+
Sbjct:    9 LFGMGNPLLDICAVVDKDFLDKYGLKPNDQILAEDKHKEMFEEMVKKFKVEYRAGGATQNSVKVAQWMIQEPHNVGTFFGCIGKDKFGKILKEKAEEAHVDAHY-YEQSEEPTGSCAACITGDNRSLVANLAAANCYKKEKHLDLEENWKLVEKAQVYYIAGFFLTVSLESILKVAKHASENNKIFCLNLSAPFICEFFKEALMKVMPYVDILFGNETEAAAFAREQGFETEDIEEIAKKAQSLPKENKKRQRIVVFTQGKEGTVMAKGDKVETFPVLEIDQSEIVDTNGAGDAFVGGFLSQLVQDKTFEQCIRAGHYAANVIIRHAGCTFPEKPDF 344          
BLAST of Adenosine kinase vs. Ensembl Zebrafish
Match: adka (adenosine kinase a [Source:ZFIN;Acc:ZDB-GENE-030425-3])

HSP 1 Score: 333.569 bits (854), Expect = 9.241e-113
Identity = 166/334 (49.70%), Postives = 220/334 (65.87%), Query Frame = 1
Query:   64 MGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            MGNPLLDI A V  D + KY LK ND ILAE+KH  +++EMV  +KV Y  GGATQN++KVAQW++++ +    + GC+  DK+GK L E  E+  V   Y Y    E TG CA  ITG NRSLV +L A+ C     HLD  E WK VE++ ++YI+ FF+T   E+++KVAKH+ ENNK FCLNL A F+ EFF   + + + Y D +FGNE EA   A+   + T DI+EIA K   LP +N  R R VV TQG + T++    +V  FP+++I  + IVDT GAGDAFVGGFL+QL+  K+ E C++  ++ A VIIR AGCTFPEK D+
Sbjct:    1 MGNPLLDICAVVDKDFLDKYGLKPNDQILAEDKHKEMFEEMVKKFKVEYRAGGATQNSVKVAQWMIQEPHNVGTFFGCIGKDKFGKILKEKAEEAHVDAHY-YEQSEEPTGSCAACITGDNRSLVANLAAANCYKKEKHLDLEENWKLVEKAQVYYIAGFFLTVSLESILKVAKHASENNKIFCLNLSAPFICEFFKEALMKVMPYVDILFGNETEAAAFAREQGFETEDIEEIAKKAQSLPKENKKRQRIVVFTQGKEGTVMAKGDKVETFPVLEIDQSEIVDTNGAGDAFVGGFLSQLVQDKTFEQCIRAGHYAANVIIRHAGCTFPEKPDF 333          
BLAST of Adenosine kinase vs. Ensembl Zebrafish
Match: adkb (adenosine kinase b [Source:ZFIN;Acc:ZDB-GENE-030131-948])

HSP 1 Score: 319.316 bits (817), Expect = 5.321e-107
Identity = 158/337 (46.88%), Postives = 219/337 (64.99%), Query Frame = 1
Query:   55 LFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            LFGMGNPLLDI A V  D + KY LK ND ILAEEKH  L+DE+V+  KV Y  GG+TQN++K+AQW++++ +  + + GC+  D +G+ L +   +  V   Y Y    E TG CA  ITG NRSLV +L A+ C     HLD    W  VE++ ++YI+ FF+T   ++++KVAKH+ +NNK F LNL A F+ +FF   + + + Y D +FGNE EA   A+   + T DI EIA ++  LP  N NR R VV TQG + T+     +V+ FP++ I  N IVDT GAGDAFVGGFL+ L+  + LE+C++  ++ A VIIR++GCTFPEK D+
Sbjct:    9 LFGMGNPLLDISAVVDKDFLDKYGLKPNDQILAEEKHKALFDEIVNKSKVEYHAGGSTQNSVKIAQWMIQEPHKVATFFGCIGTDHFGEILKQKAAEAHVDAHY-YEQNQEPTGTCAACITGDNRSLVANLAAANCYNKEKHLDIDRNWSLVEKARVYYIAGFFLTVSPDSILKVAKHASDNNKIFGLNLSAPFISQFFKEPLMKVLPYVDIIFGNETEAATFAKEQGFETEDIAEIAHRVQNLPKVNKNRQRIVVFTQGREDTVATVGDKVKMFPVLDIDQNDIVDTNGAGDAFVGGFLSALVQDQPLEECIRAGHYAAHVIIRRSGCTFPEKPDF 344          
BLAST of Adenosine kinase vs. Ensembl Zebrafish
Match: adkb (adenosine kinase b [Source:ZFIN;Acc:ZDB-GENE-030131-948])

HSP 1 Score: 204.142 bits (518), Expect = 7.690e-64
Identity = 98/213 (46.01%), Postives = 139/213 (65.26%), Query Frame = 1
Query:  424 RSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            RSLV +L A+ C     HLD    W  VE++ ++YI+ FF+T   ++++KVAKH+ +NNK F LNL A F+ +FF   + + + Y D +FGNE EA   A+   + T DI EIA ++  LP  N NR R VV TQG + T+     +V+ FP++ I  N IVDT GAGDAFVGGFL+ L+  + LE+C++  ++ A VIIR++GCTFPEK D+
Sbjct:    1 RSLVANLAAANCYNKEKHLDIDRNWSLVEKARVYYIAGFFLTVSPDSILKVAKHASDNNKIFGLNLSAPFISQFFKEPLMKVLPYVDIIFGNETEAATFAKEQGFETEDIAEIAHRVQNLPKVNKNRQRIVVFTQGREDTVATVGDKVKMFPVLDIDQNDIVDTNGAGDAFVGGFLSALVQDQPLEECIRAGHYAAHVIIRRSGCTFPEKPDF 213          
BLAST of Adenosine kinase vs. Ensembl Xenopus
Match: tpte2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:Xenbase;Acc:XB-GENE-1015881])

HSP 1 Score: 330.872 bits (847), Expect = 1.905e-111
Identity = 164/344 (47.67%), Postives = 226/344 (65.70%), Query Frame = 1
Query:   34 SKMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            S + + LLFGMGNPLLDI A V  D + KY LK ND ILAE+KH  L++E+V  +KV Y  GG+TQN++KVAQW+++K Y  + + GC+  DK+G+ L +  E+  V   Y Y    + TG CA  ITG NRSLV  L A+ C     HLD  E W+ V+++ ++YI+ FF+T   E+++KVA  S E NK FC+NL A F+ +F+   + + + Y D +FGNE EA   A+   + T DIKEIA K   L   N  R R V+ TQG D TI+     V AFP+++I  ++IVDT GAGDAFVGGFL+QL+  + LE+CV+  +++A V+IR+AGCTFPEK D+
Sbjct:    2 SALRENLLFGMGNPLLDICAVVDKDFLDKYGLKANDQILAEDKHKELFEELVKKFKVEYHAGGSTQNSVKVAQWMIQKPYKVATFFGCIGTDKFGEILKKKAEEAHVDAHY-YEQSEQPTGTCAACITGENRSLVAHLAAANCYDKTKHLDLKENWELVQKAKVYYIAGFFLTVSPESILKVATQSSEQNKVFCMNLSAPFISQFYKDPLMKVMPYVDILFGNETEAATFAREQGFETEDIKEIAKKAQALQKVNSKRPRIVIFTQGQDDTIVATDNDVVAFPVIEIDQSKIVDTNGAGDAFVGGFLSQLVSDQPLEECVRAGHYSANVVIRRAGCTFPEKPDF 344          
BLAST of Adenosine kinase vs. Ensembl Xenopus
Match: tpte2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:Xenbase;Acc:XB-GENE-1015881])

HSP 1 Score: 330.872 bits (847), Expect = 4.189e-111
Identity = 163/343 (47.52%), Postives = 226/343 (65.89%), Query Frame = 1
Query:   37 KMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            ++ + LLFGMGNPLLDI A V  D + KY LK ND ILAE+KH  L++E+V  +KV Y  GG+TQN++KVAQW+++K Y  + + GC+  DK+G+ L +  E+  V   Y Y    + TG CA  ITG NRSLV  L A+ C     HLD  E W+ V+++ ++YI+ FF+T   E+++KVA  S E NK FC+NL A F+ +F+   + + + Y D +FGNE EA   A+   + T DIKEIA K   L   N  R R V+ TQG D TI+     V AFP+++I  ++IVDT GAGDAFVGGFL+QL+  + LE+CV+  +++A V+IR+AGCTFPEK D+
Sbjct:   19 ELRENLLFGMGNPLLDICAVVDKDFLDKYGLKANDQILAEDKHKELFEELVKKFKVEYHAGGSTQNSVKVAQWMIQKPYKVATFFGCIGTDKFGEILKKKAEEAHVDAHY-YEQSEQPTGTCAACITGENRSLVAHLAAANCYDKTKHLDLKENWELVQKAKVYYIAGFFLTVSPESILKVATQSSEQNKVFCMNLSAPFISQFYKDPLMKVMPYVDILFGNETEAATFAREQGFETEDIKEIAKKAQALQKVNSKRPRIVIFTQGQDDTIVATDNDVVAFPVIEIDQSKIVDTNGAGDAFVGGFLSQLVSDQPLEECVRAGHYSANVVIRRAGCTFPEKPDF 360          
BLAST of Adenosine kinase vs. Ensembl Xenopus
Match: tpte2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:Xenbase;Acc:XB-GENE-1015881])

HSP 1 Score: 330.487 bits (846), Expect = 8.222e-111
Identity = 166/352 (47.16%), Postives = 228/352 (64.77%), Query Frame = 1
Query:   19 HYNFKSK---MTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            H+N   K     + LLFGMGNPLLDI A V  D + KY LK ND ILAE+KH  L++E+V  +KV Y  GG+TQN++KVAQW+++K Y  + + GC+  DK+G+ L +  E+  V   Y Y    + TG CA  ITG NRSLV  L A+ C     HLD  E W+ V+++ ++YI+ FF+T   E+++KVA  S E NK FC+NL A F+ +F+   + + + Y D +FGNE EA   A+   + T DIKEIA K   L   N  R R V+ TQG D TI+     V AFP+++I  ++IVDT GAGDAFVGGFL+QL+  + LE+CV+  +++A V+IR+AGCTFPEK D+
Sbjct:   19 HHNITRKGIPQPENLLFGMGNPLLDICAVVDKDFLDKYGLKANDQILAEDKHKELFEELVKKFKVEYHAGGSTQNSVKVAQWMIQKPYKVATFFGCIGTDKFGEILKKKAEEAHVDAHY-YEQSEQPTGTCAACITGENRSLVAHLAAANCYDKTKHLDLKENWELVQKAKVYYIAGFFLTVSPESILKVATQSSEQNKVFCMNLSAPFISQFYKDPLMKVMPYVDILFGNETEAATFAREQGFETEDIKEIAKKAQALQKVNSKRPRIVIFTQGQDDTIVATDNDVVAFPVIEIDQSKIVDTNGAGDAFVGGFLSQLVSDQPLEECVRAGHYSANVVIRRAGCTFPEKPDF 369          
BLAST of Adenosine kinase vs. Ensembl Xenopus
Match: tpte2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:Xenbase;Acc:XB-GENE-1015881])

HSP 1 Score: 328.946 bits (842), Expect = 1.280e-110
Identity = 163/340 (47.94%), Postives = 224/340 (65.88%), Query Frame = 1
Query:   46 DKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            + LLFGMGNPLLDI A V  D + KY LK ND ILAE+KH  L++E+V  +KV Y  GG+TQN++KVAQW+++K Y  + + GC+  DK+G+ L +  E+  V   Y Y    + TG CA  ITG NRSLV  L A+ C     HLD  E W+ V+++ ++YI+ FF+T   E+++KVA  S E NK FC+NL A F+ +F+   + + + Y D +FGNE EA   A+   + T DIKEIA K   L   N  R R V+ TQG D TI+     V AFP+++I  ++IVDT GAGDAFVGGFL+QL+  + LE+CV+  +++A V+IR+AGCTFPEK D+
Sbjct:    9 ENLLFGMGNPLLDICAVVDKDFLDKYGLKANDQILAEDKHKELFEELVKKFKVEYHAGGSTQNSVKVAQWMIQKPYKVATFFGCIGTDKFGEILKKKAEEAHVDAHY-YEQSEQPTGTCAACITGENRSLVAHLAAANCYDKTKHLDLKENWELVQKAKVYYIAGFFLTVSPESILKVATQSSEQNKVFCMNLSAPFISQFYKDPLMKVMPYVDILFGNETEAATFAREQGFETEDIKEIAKKAQALQKVNSKRPRIVIFTQGQDDTIVATDNDVVAFPVIEIDQSKIVDTNGAGDAFVGGFLSQLVSDQPLEECVRAGHYSANVVIRRAGCTFPEKPDF 347          
BLAST of Adenosine kinase vs. Ensembl Xenopus
Match: tpte2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:Xenbase;Acc:XB-GENE-1015881])

HSP 1 Score: 328.561 bits (841), Expect = 1.976e-110
Identity = 163/338 (48.22%), Postives = 223/338 (65.98%), Query Frame = 1
Query:   52 LLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            LLFGMGNPLLDI A V  D + KY LK ND ILAE+KH  L++E+V  +KV Y  GG+TQN++KVAQW+++K Y  + + GC+  DK+G+ L +  E+  V   Y Y    + TG CA  ITG NRSLV  L A+ C     HLD  E W+ V+++ ++YI+ FF+T   E+++KVA  S E NK FC+NL A F+ +F+   + + + Y D +FGNE EA   A+   + T DIKEIA K   L   N  R R V+ TQG D TI+     V AFP+++I  ++IVDT GAGDAFVGGFL+QL+  + LE+CV+  +++A V+IR+AGCTFPEK D+
Sbjct:    9 LLFGMGNPLLDICAVVDKDFLDKYGLKANDQILAEDKHKELFEELVKKFKVEYHAGGSTQNSVKVAQWMIQKPYKVATFFGCIGTDKFGEILKKKAEEAHVDAHY-YEQSEQPTGTCAACITGENRSLVAHLAAANCYDKTKHLDLKENWELVQKAKVYYIAGFFLTVSPESILKVATQSSEQNKVFCMNLSAPFISQFYKDPLMKVMPYVDILFGNETEAATFAREQGFETEDIKEIAKKAQALQKVNSKRPRIVIFTQGQDDTIVATDNDVVAFPVIEIDQSKIVDTNGAGDAFVGGFLSQLVSDQPLEECVRAGHYSANVVIRRAGCTFPEKPDF 345          
BLAST of Adenosine kinase vs. Ensembl Mouse
Match: Adk (adenosine kinase [Source:MGI Symbol;Acc:MGI:87930])

HSP 1 Score: 323.168 bits (827), Expect = 2.485e-108
Identity = 160/342 (46.78%), Postives = 223/342 (65.20%), Query Frame = 1
Query:   40 MTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            +++ +LFGMGNPLLDI A V  D + KY+LK ND ILAE+KH  L+DE+V  +KV Y  GG+TQN++KVAQW++++ + A+ + GC+  DK+G+ L        V   Y Y    + TG CA  ITG NRSLV +L A+ C     HLD    W  VE++ ++YI+ FF+T   E+++KVA+++ ENN+ F LNL A F+ +FF   + + + Y D +FGNE EA   A+   + T DIKEIA K   LP  N  R RTV+ TQG D TI+  +  V AFP++  +   I+DT GAGDAFVGGFL+QL+  K L +C++  ++ A VIIR+ GCTFPEK D+
Sbjct:   20 LSENVLFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSMKVAQWLIQEPHKAATFFGCIGIDKFGEILKRKAADAHVDAHY-YEQNEQPTGTCAACITGGNRSLVANLAAANCYKKEKHLDLERNWVLVEKARVYYIAGFFLTVSPESVLKVARYAAENNRVFTLNLSAPFISQFFKEALMDVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKAQALPKVNSKRQRTVIFTQGRDDTIVAAENDVTAFPVLDQNQEEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASVIIRRTGCTFPEKPDF 360          
BLAST of Adenosine kinase vs. Ensembl Mouse
Match: Adk (adenosine kinase [Source:MGI Symbol;Acc:MGI:87930])

HSP 1 Score: 321.627 bits (823), Expect = 6.252e-108
Identity = 160/344 (46.51%), Postives = 223/344 (64.83%), Query Frame = 1
Query:   34 SKMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            +  ++ +LFGMGNPLLDI A V  D + KY+LK ND ILAE+KH  L+DE+V  +KV Y  GG+TQN++KVAQW++++ + A+ + GC+  DK+G+ L        V   Y Y    + TG CA  ITG NRSLV +L A+ C     HLD    W  VE++ ++YI+ FF+T   E+++KVA+++ ENN+ F LNL A F+ +FF   + + + Y D +FGNE EA   A+   + T DIKEIA K   LP  N  R RTV+ TQG D TI+  +  V AFP++  +   I+DT GAGDAFVGGFL+QL+  K L +C++  ++ A VIIR+ GCTFPEK D+
Sbjct:    2 TSTSENVLFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSMKVAQWLIQEPHKAATFFGCIGIDKFGEILKRKAADAHVDAHY-YEQNEQPTGTCAACITGGNRSLVANLAAANCYKKEKHLDLERNWVLVEKARVYYIAGFFLTVSPESVLKVARYAAENNRVFTLNLSAPFISQFFKEALMDVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKAQALPKVNSKRQRTVIFTQGRDDTIVAAENDVTAFPVLDQNQEEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASVIIRRTGCTFPEKPDF 344          
BLAST of Adenosine kinase vs. Ensembl Mouse
Match: Adk (adenosine kinase [Source:MGI Symbol;Acc:MGI:87930])

HSP 1 Score: 146.747 bits (369), Expect = 8.287e-42
Identity = 76/167 (45.51%), Postives = 107/167 (64.07%), Query Frame = 1
Query:   40 MTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISS 534
            +++ +LFGMGNPLLDI A V  D + KY+LK ND ILAE+KH  L+DE+V  +KV Y  GG+TQN++KVAQW++++ + A+ + GC+  DK+G+ L        V   Y Y    + TG CA  ITG NRSLV +L A+ C     HLD    W  VE++ ++YI+ 
Sbjct:   18 LSENVLFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSMKVAQWLIQEPHKAATFFGCIGIDKFGEILKRKAADAHVDAHY-YEQNEQPTGTCAACITGGNRSLVANLAAANCYKKEKHLDLERNWVLVEKARVYYIAE 183          
BLAST of Adenosine kinase vs. Ensembl Mouse
Match: Adk (adenosine kinase [Source:MGI Symbol;Acc:MGI:87930])

HSP 1 Score: 106.686 bits (265), Expect = 1.165e-27
Identity = 52/108 (48.15%), Postives = 74/108 (68.52%), Query Frame = 1
Query:   43 TDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLY 363
            ++ +LFGMGNPLLDI A V  D + KY+LK ND ILAE+KH  L+DE+V  +KV Y  GG+TQN++KVAQW++++ + A+ + GC+  DK+G+ L        V   Y
Sbjct:   12 SENVLFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSMKVAQWLIQEPHKAATFFGCIGIDKFGEILKRKAADAHVDAHY 119          
BLAST of Adenosine kinase vs. UniProt/SwissProt
Match: sp|Q9SF85|ADK1_ARATH (Adenosine kinase 1 OS=Arabidopsis thaliana OX=3702 GN=ADK1 PE=1 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 7.360e-111
Identity = 153/338 (45.27%), Postives = 224/338 (66.27%), Query Frame = 1
Query:   46 DKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            D +L GMGNPLLD+ A V    + KY++K N+AILAE+KH+P+YDEM   + V YI GGATQN+IKVAQW+L+   A+ Y G +  DKYG+ + +     GV   Y Y      TG C   + G  RSL+ +L A+  +  +HL KPE W  VE++  +YI+ FF+T   E++  V +H+  NNK F +NL A F+ EFF     + + Y DY+FGNE EA   +++  + T D+++IA+K+SQLP  +    RT VITQGADP ++   G+V+ +P++ +   ++VDT GAGDAFVGGFL+QL+HGK +E+CV+   + + V+I+++GCT+PEK D+
Sbjct:    7 DGILLGMGNPLLDVSAVVDQQFLDKYDIKLNNAILAEDKHLPMYDEMSQKFNVEYIAGGATQNSIKVAQWMLQVPGATSYMGSIGKDKYGEAMKKDATAAGVYVHY-YEDEATPTGTCGVCVLGGERSLIANLSAANCYKVEHLKKPENWALVEKAKFYYIAGFFLTVSPESIQLVREHAAANNKVFTMNLSAPFICEFFKDVQEKCLPYMDYIFGNETEARTFSRVHGWETDDVEQIAIKMSQLPKASGTYKRTTVITQGADPVVVAEDGKVKKYPVIPLPKEKLVDTNGAGDAFVGGFLSQLVHGKGIEECVRAGCYASNVVIQRSGCTYPEKPDF 343          
BLAST of Adenosine kinase vs. UniProt/SwissProt
Match: sp|Q9LZG0|ADK2_ARATH (Adenosine kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ADK2 PE=1 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 1.543e-110
Identity = 155/338 (45.86%), Postives = 224/338 (66.27%), Query Frame = 1
Query:   46 DKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            D +L GMGNPLLDI A V  + + KY++K N+AILAE+KH+P+YDEM   + V YI GGATQN+IKVAQW+L+   A+ Y G +  DKYG+ + +     GV   Y Y      TG C   + G  RSL+ +L A+  +  DHL KPE W  VE++  +YI+ FF+T   E++  V++H+  NNK F +NL A F+ EFF     + + Y D+VFGNE EA   +++  + T D+++IA+KISQLP       RT VITQGADP ++   G+V+ +P++ +   ++VDT GAGDAFVGGF++QL+  KS+E+CVK   + + V+I+++GCT+PEK D+
Sbjct:    8 DGILLGMGNPLLDISAVVDDEFLTKYDIKLNNAILAEDKHLPMYDEMSSKFNVEYIAGGATQNSIKVAQWMLQIPGATSYMGSIGKDKYGEAMKKDATAAGVNVHY-YEDESAPTGTCGVCVVGGERSLIANLSAANCYKVDHLKKPENWALVEKAKFYYIAGFFLTVSPESIQLVSEHAAANNKVFTMNLSAPFICEFFKDVQEKFLPYMDFVFGNETEARTFSRVHGWETEDVEQIAIKISQLPKATGTYKRTTVITQGADPVVVAEDGKVKKYPVIPLPKEKLVDTNGAGDAFVGGFMSQLVKEKSIEECVKAGCYASNVVIQRSGCTYPEKPDF 344          
BLAST of Adenosine kinase vs. UniProt/SwissProt
Match: sp|Q64640|ADK_RAT (Adenosine kinase OS=Rattus norvegicus OX=10116 GN=Adk PE=1 SV=3)

HSP 1 Score: 327.02 bits (837), Expect = 6.889e-109
Identity = 163/342 (47.66%), Postives = 223/342 (65.20%), Query Frame = 1
Query:   40 MTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            +++ +LFGMGNPLLDI A V  D + KY+LK ND ILAE+KH  L+DE+V  +KV Y  GG+TQN++KVAQW++++ + A+ + GC+  DK+G+ L        V   Y Y    + TG CA  ITG NRSLV +L A+ C     HLD    W  VE++ ++YI+ FF+T   E+++KVA+++ ENN+TF LNL A F+ +FF   + E + Y D +FGNE EA   A+   + T DIKEIA K   LP  N  R RTV+ TQG D TI+     V AFP++  +   IVDT GAGDAFVGGFL+QL+  K L +C++  ++ A VIIR+ GCTFPEK D+
Sbjct:   20 LSENVLFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSMKVAQWMIQEPHRAATFFGCIGIDKFGEILKSKAADAHVDAHY-YEQNEQPTGTCAACITGGNRSLVANLAAANCYKKEKHLDLENNWMLVEKARVYYIAGFFLTVSPESVLKVARYAAENNRTFTLNLSAPFISQFFKEALMEVMPYVDILFGNETEAATFAREQGFETKDIKEIARKTQALPKVNSKRQRTVIFTQGRDDTIVATGNDVTAFPVLDQNQEEIVDTNGAGDAFVGGFLSQLVSNKPLTECIRAGHYAASVIIRRTGCTFPEKPDF 360          
BLAST of Adenosine kinase vs. UniProt/SwissProt
Match: sp|P55262|ADK_CRIGR (Adenosine kinase OS=Cricetulus griseus OX=10029 GN=ADK PE=1 SV=2)

HSP 1 Score: 324.324 bits (830), Expect = 6.535e-108
Identity = 162/342 (47.37%), Postives = 224/342 (65.50%), Query Frame = 1
Query:   40 MTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            +++ +LFGMGNPLLDI A V  D + KY+LK ND ILAEEKH  L+DE+V  +KV Y  GG+TQN+IKVAQW+++K + A+ + GC+  DK+G+ L     +  V   Y Y    + TG CA  ITG NRSLV +L A+ C     HLD    W  VE++ ++YI+ FF+T   E+++KVA+++ ENN+ F LNL A F+ +FF   + E + Y D +FGNE EA   A+   + T DIKEIA K   L   N  R RTVV TQG D T++  + +V AF ++  +   I+DT GAGDAFVGGFL+QL++ K L +C++  ++ A VIIR+ GCTFPEK D+
Sbjct:   20 LSENVLFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEEKHKELFDELVRKFKVEYHAGGSTQNSIKVAQWMIQKPHKAATFFGCIGIDKFGEILKSKAAEAHVDAHY-YEQNEQPTGTCAACITGDNRSLVANLAAANCYKKEKHLDLENNWVLVEKARVYYIAGFFLTVSPESVLKVARYAAENNRIFTLNLSAPFISQFFKESLMEVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKAQALAKVNSKRPRTVVFTQGRDDTVVATENEVMAFAVLDQNQKEIIDTNGAGDAFVGGFLSQLVYNKPLTECIRAGHYAASVIIRRTGCTFPEKPDF 360          
BLAST of Adenosine kinase vs. UniProt/SwissProt
Match: sp|P55264|ADK_MOUSE (Adenosine kinase OS=Mus musculus OX=10090 GN=Adk PE=1 SV=2)

HSP 1 Score: 323.168 bits (827), Expect = 1.738e-107
Identity = 160/342 (46.78%), Postives = 223/342 (65.20%), Query Frame = 1
Query:   40 MTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            +++ +LFGMGNPLLDI A V  D + KY+LK ND ILAE+KH  L+DE+V  +KV Y  GG+TQN++KVAQW++++ + A+ + GC+  DK+G+ L        V   Y Y    + TG CA  ITG NRSLV +L A+ C     HLD    W  VE++ ++YI+ FF+T   E+++KVA+++ ENN+ F LNL A F+ +FF   + + + Y D +FGNE EA   A+   + T DIKEIA K   LP  N  R RTV+ TQG D TI+  +  V AFP++  +   I+DT GAGDAFVGGFL+QL+  K L +C++  ++ A VIIR+ GCTFPEK D+
Sbjct:   20 LSENVLFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSMKVAQWLIQEPHKAATFFGCIGIDKFGEILKRKAADAHVDAHY-YEQNEQPTGTCAACITGGNRSLVANLAAANCYKKEKHLDLERNWVLVEKARVYYIAGFFLTVSPESVLKVARYAAENNRVFTLNLSAPFISQFFKEALMDVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKAQALPKVNSKRQRTVIFTQGRDDTIVAAENDVTAFPVLDQNQEEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASVIIRRTGCTFPEKPDF 360          
BLAST of Adenosine kinase vs. TrEMBL
Match: A0A1S3HBF6 (adenosine kinase 2 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106153802 PE=4 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 2.105e-121
Identity = 173/344 (50.29%), Postives = 241/344 (70.06%), Query Frame = 1
Query:   31 KSKMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVV-YIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            K ++++ +LFGMGNPLLDI A V  D +KKY+LK NDAILAE+KH PLY +M+D YK V YI GGATQN I+VA W+L    ++ + GCV  DK+G+ L    E  GV   YQYN   E+TG C  L+TG NRSL  +L A+  FT DHLD P+ W  VE+++ +YI+ FF+T C  A+ KVAKH+ E NKTF +NL A FL +FF   +  ++ Y D +FGNE EA   ++  N+ T D+KEIA+K + L  +N +R R VV TQGA P +I ++G+V  +P++ I++  +VDT GAGDAFVGGFLAQ + GK +E+CV+C ++ A ++I+++GCT+P+K D+
Sbjct:    9 KMEISEGVLFGMGNPLLDICATVDDDFLKKYDLKANDAILAEDKHKPLYQDMLDTYKSVDYIAGGATQNAIRVATWLLGTPQSTTFMGCVGKDKFGEILKSKAEGDGVNVKYQYNE-KESTGTCGVLLTGENRSLCANLAAANCFTVDHLDVPDNWALVEKANYYYIAGFFLTVCPPAIQKVAKHACEKNKTFMMNLSAPFLCQFFKEPMMAALPYVDILFGNETEAATFSKEQNFDTEDVKEIALKAAALTKENKSRSRMVVFTQGASPVLIAHEGKVTEYPVIPIAEKDMVDTNGAGDAFVGGFLAQYVLGKPVEECVRCGHYAANIVIKRSGCTYPDKPDF 351          
BLAST of Adenosine kinase vs. TrEMBL
Match: A0A1Y3N3K9 (PfkB domain-containing protein OS=Piromyces sp. (strain E2) OX=73868 GN=PIROE2DRAFT_67672 PE=4 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 2.240e-121
Identity = 168/335 (50.15%), Postives = 235/335 (70.15%), Query Frame = 1
Query:   43 TDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPE 1047
            T+++L GMGNPLLD+IADV  D++ KY L  ND+I+AEEKHMP+Y+E+ +NYK+ Y+ GGATQN+I+ AQW+L     S + G V  D Y K L ++ E+ GV   Y YN  P  TG CACLIT +NRSLV +L A+ K++ +HL KPE W+ VE++  +YI  FF T  HE+++ VAKH+ ENNK F  NL A FL +F+   + E+  Y D +FGNE+EA+  A   NYGT D+KEIA+K++ +   N +R RTV+ITQGADPTI+  +G+V  +P++ +    IVD+ GAGDAFVGGFL+QL+  +  E C+   N+ A V+++Q+G TFP+
Sbjct:    3 TERILLGMGNPLLDMIADVPKDMLTKYGLNANDSIMAEEKHMPIYEELKNNYKITYVAGGATQNSIRGAQWLLPPNSTS-FIGSVGKDDYAKALEKASEEDGVNVQYMYNDVP--TGTCACLITDNNRSLVANLSAADKYSIEHLKKPENWELVEKAKFYYIGGFFFTHSHESIMAVAKHATENNKVFTQNLSAPFLPQFYTKFLDEAAPYWDIIFGNESEAIAFADAHNYGTKDVKEIALKMAAIEKVNKSRPRTVIITQGADPTIVACEGKVTEYPVLDLKKEAIVDSNGAGDAFVGGFLSQLVQNQPFEKCIAAGNFVANVVLQQSGATFPK 334          
BLAST of Adenosine kinase vs. TrEMBL
Match: A0A1S3HE59 (adenosine kinase 2 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106153802 PE=4 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 1.901e-120
Identity = 172/337 (51.04%), Postives = 236/337 (70.03%), Query Frame = 1
Query:   52 LLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVV-YIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            +LFGMGNPLLDI A V  D +KKY+LK NDAILAE+KH PLY +M+D YK V YI GGATQN I+VA W+L    ++ + GCV  DK+G+ L    E  GV   YQYN   E+TG C  L+TG NRSL  +L A+  FT DHLD P+ W  VE+++ +YI+ FF+T C  A+ KVAKH+ E NKTF +NL A FL +FF   +  ++ Y D +FGNE EA   ++  N+ T D+KEIA+K + L  +N +R R VV TQGA P +I ++G+V  +P++ I++  +VDT GAGDAFVGGFLAQ + GK +E+CV+C ++ A ++I+++GCT+P+K D+
Sbjct:    6 VLFGMGNPLLDICATVDDDFLKKYDLKANDAILAEDKHKPLYQDMLDTYKSVDYIAGGATQNAIRVATWLLGTPQSTTFMGCVGKDKFGEILKSKAEGDGVNVKYQYNE-KESTGTCGVLLTGENRSLCANLAAANCFTVDHLDVPDNWALVEKANYYYIAGFFLTVCPPAIQKVAKHACEKNKTFMMNLSAPFLCQFFKEPMMAALPYVDILFGNETEAATFSKEQNFDTEDVKEIALKAAALTKENKSRSRMVVFTQGASPVLIAHEGKVTEYPVIPIAEKDMVDTNGAGDAFVGGFLAQYVLGKPVEECVRCGHYAANIVIKRSGCTYPDKPDF 341          
BLAST of Adenosine kinase vs. TrEMBL
Match: A0A1Y1VII2 (PfkB domain-containing protein OS=Piromyces finnis OX=1754191 GN=BCR36DRAFT_580549 PE=4 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 1.918e-120
Identity = 166/335 (49.55%), Postives = 235/335 (70.15%), Query Frame = 1
Query:   43 TDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPE 1047
            T+++L GMGNPLLD+IADVS D++ KYNL  ND+I+AEEKHMP+Y+E+ +NYK+ Y+ GGATQN+I+ AQW+L     S + G V  D + K L  + E+ GV   Y YN  P  TG CACLIT +NRSLV +L A+ K++ +HL KPE W+ VE++  +YI  FF T  HE+++ VAKH+ ENNK F  NL A FL +F++  + E+  Y D +FGNE+EA+  A   NYGT D+KEIA+K++ +   N +R R VVITQGA+PTI+   G+V  +P+  +  + IVD+ GAGDAFVGGFL+QL+  +  E C+   N+ A ++++Q+G T+P+
Sbjct:    3 TERILLGMGNPLLDMIADVSKDMLTKYNLNANDSIMAEEKHMPIYEELKNNYKITYVAGGATQNSIRGAQWLLPPNSTS-FIGSVGKDDFAKALESASEEDGVNVQYMYNDVP--TGTCACLITDNNRSLVANLSAADKYSIEHLKKPENWELVEKAKFYYIGGFFFTHSHESIMAVAKHAAENNKVFTQNLSAPFLPQFYSNLLDEAAPYWDIIFGNESEAIAFADSHNYGTKDVKEIALKMAAIEKVNKSRSRIVVITQGAEPTIVARDGKVTEYPVYDLEKSAIVDSNGAGDAFVGGFLSQLVQDQPFERCIDAGNFVANIVLQQSGATYPK 334          
BLAST of Adenosine kinase vs. TrEMBL
Match: A0A1Y2BCY9 (Adenosine kinase b OS=Neocallimastix californiae OX=1754190 GN=LY90DRAFT_662056 PE=4 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 2.510e-119
Identity = 170/335 (50.75%), Postives = 235/335 (70.15%), Query Frame = 1
Query:   43 TDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPE 1047
            T+++L GMGNPLLD+IA+   D++ KYNL  ND+I+AEEKHMPLY+E+  N+KV Y+ GGATQN+I+ AQW+L     S + GCV  D+Y K L ++  + GV   Y +   P  TG CACLIT +NRSLV +L A+ K+  DHL KPE W  VE++  FYI  FF T  HE+++ VAKH+ ENNK F  NL A FL +F+   + E+  Y D +FGNE+EA   A+  NYGT D+KEIA+K++++   N NR R VVITQGADPTI+ Y+G+++ +P+ ++    IVD+  AGDAFVGGFL+QL+ GK L+ C+   N+ A V+++Q+G TFP+
Sbjct:    3 TERILLGMGNPLLDMIAETPKDMLTKYNLNANDSIMAEEKHMPLYEELQKNFKVTYVAGGATQNSIRAAQWILPPNSTS-FIGCVGKDEYAKTLEKAANEDGVNVPYMHVDDP--TGTCACLITDNNRSLVANLSAADKYKIDHLKKPENWALVEKAKYFYIGGFFFTHSHESIMAVAKHAAENNKYFIQNLSAPFLSQFYTKFLDEAAPYWDIIFGNESEAAAFAEAHNYGTKDVKEIALKMAEIEKVNKNRPRMVVITQGADPTIVAYEGKIKEYPVRELKKEDIVDSNAAGDAFVGGFLSQLVQGKDLDTCIDAGNYVANVVLKQSGATFPK 334          
BLAST of Adenosine kinase vs. Ensembl Cavefish
Match: adka (adenosine kinase [Source:NCBI gene;Acc:103039309])

HSP 1 Score: 337.035 bits (863), Expect = 9.615e-114
Identity = 167/342 (48.83%), Postives = 225/342 (65.79%), Query Frame = 1
Query:   40 MTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            +++  LFGMGNPLLDI A V  D + KY LK ND ILAE+KH  ++DE+V  +KV Y  GGATQN++KVAQW+++K +  + + GC+  DK+G+ L E  E+  V   Y Y    E TG CA  ITG NRSLV +L A+ C     HLD  E WK VE++ ++YI+ FF+T   E+++KVAKH+ ENNK F LNL A F+ +FF   + + + Y D +FGNE EA   A+   + T DI+EI+ K   LP  N  R R VV TQG + T++    +V  FP+++I    IVDT GAGDAFVGGFL++L+  KSLE C++  ++ A VIIR AGCTFPEK D+
Sbjct:   20 ISENALFGMGNPLLDICAVVDKDFLDKYGLKPNDQILAEDKHKEMFDEIVKKFKVEYHAGGATQNSVKVAQWMIQKPHKVATFFGCIGKDKFGEILKEKAEESHVDAHY-YEQSEEPTGTCAACITGDNRSLVANLAAANCYKKEKHLDLEENWKLVEKAKVYYIAGFFLTVSTESILKVAKHASENNKIFTLNLSAPFICQFFKESLMKVMPYVDVLFGNETEAAAFAREQGFETKDIEEISKKAQSLPKVNKKRQRIVVFTQGKEGTVMTKGDKVETFPVIEIDQKEIVDTNGAGDAFVGGFLSELVQEKSLEQCIRAGHYAANVIIRHAGCTFPEKPDF 360          
BLAST of Adenosine kinase vs. Ensembl Cavefish
Match: adka (adenosine kinase [Source:NCBI gene;Acc:103039309])

HSP 1 Score: 335.88 bits (860), Expect = 1.337e-113
Identity = 167/341 (48.97%), Postives = 224/341 (65.69%), Query Frame = 1
Query:   43 TDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            ++  LFGMGNPLLDI A V  D + KY LK ND ILAE+KH  ++DE+V  +KV Y  GGATQN++KVAQW+++K +  + + GC+  DK+G+ L E  E+  V   Y Y    E TG CA  ITG NRSLV +L A+ C     HLD  E WK VE++ ++YI+ FF+T   E+++KVAKH+ ENNK F LNL A F+ +FF   + + + Y D +FGNE EA   A+   + T DI+EI+ K   LP  N  R R VV TQG + T++    +V  FP+++I    IVDT GAGDAFVGGFL++L+  KSLE C++  ++ A VIIR AGCTFPEK D+
Sbjct:    3 SENALFGMGNPLLDICAVVDKDFLDKYGLKPNDQILAEDKHKEMFDEIVKKFKVEYHAGGATQNSVKVAQWMIQKPHKVATFFGCIGKDKFGEILKEKAEESHVDAHY-YEQSEEPTGTCAACITGDNRSLVANLAAANCYKKEKHLDLEENWKLVEKAKVYYIAGFFLTVSTESILKVAKHASENNKIFTLNLSAPFICQFFKESLMKVMPYVDVLFGNETEAAAFAREQGFETKDIEEISKKAQSLPKVNKKRQRIVVFTQGKEGTVMTKGDKVETFPVIEIDQKEIVDTNGAGDAFVGGFLSELVQEKSLEQCIRAGHYAANVIIRHAGCTFPEKPDF 342          
BLAST of Adenosine kinase vs. Ensembl Cavefish
Match: adka (adenosine kinase [Source:NCBI gene;Acc:103039309])

HSP 1 Score: 323.939 bits (829), Expect = 6.504e-109
Identity = 164/342 (47.95%), Postives = 220/342 (64.33%), Query Frame = 1
Query:   40 MTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            +++  LFGMGNPLLDI A V  D + KY LK ND ILAE+KH  ++DE+V  +KV Y  GGATQN++KVAQW+++K +  + + GC+  DK+G+ L E  E+  V   Y Y    E TG CA  ITG NRSLV +L A+ C     HLD  E WK VE++ ++YI+ FF+T   E+++KVAKH+ ENNK F LNL A F+ +FF   + + + Y D +FGNE             T DI+EI+ K   LP  N  R R VV TQG + T++    +V  FP+++I    IVDT GAGDAFVGGFL++L+  KSLE C++  ++ A VIIR AGCTFPEK D+
Sbjct:   20 ISENALFGMGNPLLDICAVVDKDFLDKYGLKPNDQILAEDKHKEMFDEIVKKFKVEYHAGGATQNSVKVAQWMIQKPHKVATFFGCIGKDKFGEILKEKAEESHVDAHY-YEQSEEPTGTCAACITGDNRSLVANLAAANCYKKEKHLDLEENWKLVEKAKVYYIAGFFLTVSTESILKVAKHASENNKIFTLNLSAPFICQFFKESLMKVMPYVDVLFGNET------------TKDIEEISKKAQSLPKVNKKRQRIVVFTQGKEGTVMTKGDKVETFPVIEIDQKEIVDTNGAGDAFVGGFLSELVQEKSLEQCIRAGHYAANVIIRHAGCTFPEKPDF 348          
BLAST of Adenosine kinase vs. Ensembl Cavefish
Match: adka (adenosine kinase [Source:NCBI gene;Acc:103039309])

HSP 1 Score: 322.398 bits (825), Expect = 3.434e-108
Identity = 163/342 (47.66%), Postives = 221/342 (64.62%), Query Frame = 1
Query:   40 MTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            +++  LFGMGNPLLDI A V  D + KY LK ND ILAE+KH  ++DE+V  +KV Y  GGATQN++KVAQW+++K +  + + GC+  DK+G+ L E  E+  V   Y Y    E TG CA  ITG NRSLV +L A+ C     HLD  E WK VE++ ++YI+ FF+T   E+++KVAKH+ ENNK F LNL A F+ +FF   + + + Y D +FGNE  A+           +I+EI+ K   LP  N  R R VV TQG + T++    +V  FP+++I    IVDT GAGDAFVGGFL++L+  KSLE C++  ++ A VIIR AGCTFPEK D+
Sbjct:   22 ISENALFGMGNPLLDICAVVDKDFLDKYGLKPNDQILAEDKHKEMFDEIVKKFKVEYHAGGATQNSVKVAQWMIQKPHKVATFFGCIGKDKFGEILKEKAEESHVDAHY-YEQSEEPTGTCAACITGDNRSLVANLAAANCYKKEKHLDLEENWKLVEKAKVYYIAGFFLTVSTESILKVAKHASENNKIFTLNLSAPFICQFFKESLMKVMPYVDVLFGNETSAV---------FRNIEEISKKAQSLPKVNKKRQRIVVFTQGKEGTVMTKGDKVETFPVIEIDQKEIVDTNGAGDAFVGGFLSELVQEKSLEQCIRAGHYAANVIIRHAGCTFPEKPDF 353          
BLAST of Adenosine kinase vs. Ensembl Cavefish
Match: adkb (adenosine kinase-like [Source:NCBI gene;Acc:103035400])

HSP 1 Score: 317.005 bits (811), Expect = 5.797e-106
Identity = 156/344 (45.35%), Postives = 220/344 (63.95%), Query Frame = 1
Query:   34 SKMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            S+++   LFGMGNPLLDI A V  D + KY LK ND ILA+EKH  L++EM    KV Y  GG+TQN++K+AQW++++ +  + + GC+  D +G+ L +   +  V   Y Y    + TG CA  ITG NRSL+ +L A+ C     HLD    W  VE++ ++YI+ FF+T   ++++KVAKH+ E+NK F LNL A F+ +FF   +   + Y D +FGNE EA   A+   + T DI EIA ++  LP  N NR R VV TQG D T+     +V  FP++ I  N IVDT GAGDAFVGGFL++L+  KSLE C++  ++ A +II+++GCTFPEK D+
Sbjct:   13 SRLSQNALFGMGNPLLDICAVVDKDFLDKYGLKPNDQILADEKHKALFEEMAKKSKVEYHAGGSTQNSVKIAQWMIQEPHKVATFFGCIGTDHFGEILKQKAAEAHVDAHY-YEQSEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLDSNWGLVEKARVYYIAGFFLTVSPDSIMKVAKHACEHNKIFGLNLSAPFISQFFKEPLMNVMPYVDILFGNETEAATFAKEQGFETDDIAEIARRVQLLPKVNKNRPRIVVFTQGKDDTVATVGEKVTMFPVIDIDQNEIVDTNGAGDAFVGGFLSELVQEKSLEQCIRAGHYAANIIIQRSGCTFPEKPDF 355          
BLAST of Adenosine kinase vs. Ensembl Yeast
Match: ADO1 (Adenosine kinase; required for the utilization of S-adenosylmethionine (AdoMet); may be involved in recycling adenosine produced through the methyl cycle [Source:SGD;Acc:S000003866])

HSP 1 Score: 241.891 bits (616), Expect = 8.803e-78
Identity = 136/343 (39.65%), Postives = 196/343 (57.14%), Query Frame = 1
Query:   40 MTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKH----MPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNY--GTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEK 1050
            MT  L+  +GNPLLD  ADV+ + + KY+LKENDAIL + K     M ++DE++   +   + GGA QNT + A +VL      VY G V  DK+ ++L    E+ GV+++YQ       TG CA LITGHNRSLVT LGA+  FT DHLDK   W  VE + LFYI  F +T   +A++K+ +H+ EN+K F LN  A F+   F   +   + YA  +  NE+EA             TD++ IA +I     K+    +TV+ T G +PT++V       +P+  +  ++IVDT GAGDAF GGF+A L  G+ LE  +    W A + I++ G ++P +
Sbjct:    1 MTAPLVV-LGNPLLDFQADVTAEYLAKYSLKENDAILVDAKSGDAKMAIFDELLQMPETKLVAGGAAQNTARGAAYVLGAGQV-VYFGSVGKDKFSERLLNENEKAGVKSMYQVQNDI-GTGKCAALITGHNRSLVTDLGAANFFTPDHLDKH--WDLVEAAKLFYIGGFHLTVSPDAIVKLGQHAKENSKPFVLNFSAPFIPHVFKDALARVLPYATVIIANESEAEAFCDAFQLDCANTDLEAIAQRIV----KDSPVEKTVIFTHGVEPTVVVSSKGTSTYPVKPLDSSKIVDTNGAGDAFAGGFMAGLTKGEDLETSIDMGQWLAALSIQEVGPSYPSE 334          
BLAST of Adenosine kinase vs. Ensembl Yeast
Match: RBK1 (Putative ribokinase [Source:SGD;Acc:S000000632])

HSP 1 Score: 55.0694 bits (131), Expect = 5.605e-9
Identity = 68/274 (24.82%), Postives = 111/274 (40.51%), Query Frame = 1
Query:  268 KYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLIT----GHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQ------------LPSKNPNRLRT--VVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGC 1035
            +Y+    G V +D +GK+L ++    GV   +        TG    LI     G NR L+   GA+ K   D     EI+   ++   + +    I     ++IK   H+   N     N         F A   +  E  D +  NE E L++ +   +    ++EI  KI              L  K  NR +   VV+T G+   +           +  I +  +VDTTGAGD F+GG + QL  G++L   +K +   + + I++ G 
Sbjct:   56 RYSVRMIGNVGNDTFGKQLKDTLSDCGVDITHVGTYEGINTGTATILIEEKAGGQNRILIVE-GANSKTIYDPKQLCEIFPEGKEEEEYVVFQHEIPDPL-SIIKWI-HANRPNFQIVYNPSP------FKAMPKKDWELVDLLVVNEIEGLQIVE-SVFDNELVEEIREKIKDDFLGEYRKICELLYEKLMNRKKRGIVVMTLGSRGVLFCSHESPEVQFLPAIQNVSVVDTTGAGDTFLGGLVTQLYQGETLSTAIKFSTLASSLTIQRKGA 319          
BLAST of Adenosine kinase vs. Ensembl Nematostella
Match: EDO43711 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXR7])

HSP 1 Score: 338.576 bits (867), Expect = 5.503e-115
Identity = 163/336 (48.51%), Postives = 227/336 (67.56%), Query Frame = 1
Query:   28 FKSKMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVL-KKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAG 1032
            +K ++++ +L GMGNPLLDI A V  D + KY L EN+AILAE+KH P+Y EM+D + V Y+PGGATQN+I++AQW+L K+  A+ Y GC+ +D +GK L +     GV   Y  N     TG CA  ITG +RSLV +L A+  +T  HLD+PE W  V +++ FYI  FF+T   E+++ V K++ E +K F +NL A FL +FF   +  ++ Y D +FGNE EAL  A+  N+ T D+KEI +K+S+L   N  R RTVVIT G  PT++   G+VR FPI+ I +  IVDT GAGDAFVGG+L+QL+ GK +E+CV+C +W A  II+Q+G
Sbjct:    8 YKLELSEGVLLGMGNPLLDISATVDKDFLDKYGLDENNAILAEDKHKPMYQEMIDKFNVDYLPGGATQNSIRIAQWLLGKETKATSYMGCIGEDAFGKTLTDIATAAGVHVNYLINK-EIPTGTCAVCITGKHRSLVANLAAANNYTKSHLDQPENWALVVKANFFYIGGFFLTVSPESIVAVGKYAAETDKLFMMNLSAPFLCQFFKEPMMNAMPYIDILFGNETEALVFAKEQNFKTEDLKEIILKMSKLTKVNEKRSRTVVITHGKKPTLVAQDGEVREFPIIAIKEEDIVDTNGAGDAFVGGYLSQLVLGKPVEECVRCGHWCANYIIQQSG 342          
BLAST of Adenosine kinase vs. Ensembl Medaka
Match: adka (adenosine kinase [Source:NCBI gene;Acc:101173404])

HSP 1 Score: 337.806 bits (865), Expect = 7.063e-114
Identity = 172/344 (50.00%), Postives = 226/344 (65.70%), Query Frame = 1
Query:   34 SKMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            S+++   LFGMGNPLLDI A V  D + KY LK ND ILAE+KH  L++E+V  +KV Y  GGATQN+IKVAQW+++K +    + GC+  DK+G  L +  E+  +   Y Y    E TG CA  ITG NRSLV +L A+ C     HLD  E W+ VE++ +FYI+ FF+T   E+++KVAKH+ E NK FCLNL A F+ +FF   + +   Y D +FGNE EA   A+  ++ T DIKEIA K   LP  N  R R VV+TQG D T++    +V  FP+VKI    IVDT GAGDAFVGGFL+ L+  KSL+ CVK  +++A VII++AGCTFPEK D+
Sbjct:   32 SELSPNSLFGMGNPLLDICAVVDKDFLDKYTLKPNDQILAEDKHKALFEELVKKFKVEYHAGGATQNSIKVAQWMIQKPHNVGTFFGCIGKDKFGDILKQKAEEAHIDAHY-YEQEEEPTGTCAACITGDNRSLVANLAAANCYKKEKHLDLEENWELVEKAKVFYIAGFFLTVSVESILKVAKHASETNKLFCLNLSAPFICQFFKDNLMKVFPYVDVLFGNETEAAAFAKEQDFETKDIKEIAKKAQALPKVNTKRQRVVVLTQGKDVTVMAQGDKVETFPVVKIDPKDIVDTNGAGDAFVGGFLSGLVQEKSLDQCVKAGHYSANVIIKRAGCTFPEKPDF 374          
BLAST of Adenosine kinase vs. Ensembl Medaka
Match: ADK (adenosine kinase [Source:NCBI gene;Acc:101174705])

HSP 1 Score: 324.324 bits (830), Expect = 4.610e-109
Identity = 160/341 (46.92%), Postives = 222/341 (65.10%), Query Frame = 1
Query:   43 TDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            ++ +LFGMGNPLLDI A V  D + K+ LK ND ILAE+KH  L+ E+V   KV Y  GG+TQN++K+AQW+++K +  + + GC+  D++G+ L +  E+  V   Y Y    E TG CA  ITG+NRSLV +L A+ C     HLD    W+ VE++ ++YI+ FF+T   E+++KVAKH+ ENNK FC+NL A F+ +FF   + + + Y D +FGNE EA   A+   + T DI EIA K   LP +N  R R VV TQG D T+     QV  FP+V I  N IVDT GAGDAFVGGFL+ L+  + LE+C++  ++ A VII++ GCTFPEK ++
Sbjct:    5 SENILFGMGNPLLDISAVVDKDFLDKFGLKPNDQILAEDKHKALFAEIVKRNKVEYHAGGSTQNSVKIAQWMIQKPHKVATFFGCIGTDRFGEILKKKAEEAHVDARY-YEQNEEPTGTCAACITGNNRSLVANLAAANCYKKEKHLDLDSNWELVEKAKVYYIAGFFLTVSPESILKVAKHASENNKIFCMNLSAPFISQFFKEPLMKVMPYVDILFGNETEAATFAKEQGFETDDIAEIARKTQNLPKENTRRQRVVVFTQGKDDTVATVDDQVTMFPVVDIDQNDIVDTNGAGDAFVGGFLSALVQEQPLEECIRAGHYAANVIIKRVGCTFPEKPNF 344          
BLAST of Adenosine kinase vs. Ensembl Medaka
Match: adka (adenosine kinase [Source:NCBI gene;Acc:101173404])

HSP 1 Score: 305.449 bits (781), Expect = 8.006e-102
Identity = 156/315 (49.52%), Postives = 206/315 (65.40%), Query Frame = 1
Query:  121 YNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDW 1059
            Y LK ND ILAE+KH  L++E+V  +KV Y  GGATQN+IKVAQW+++K +    + GC+  DK+G  L +  E+  +   Y Y    E TG CA  ITG NRSLV +L A+ C     HLD  E W+ VE++ +FYI+ FF+T   E+++KVAKH+ E NK FCLNL A F+ +FF   + +   Y D +FGNE EA   A+  ++ T DIKEIA K   LP  N  R R VV+TQG D T++    +V  FP+VKI    IVDT GAGDAFVGGFL+ L+  KSL+ CVK  +++A VII++AGCTFPEK D+
Sbjct:   22 YTLKPNDQILAEDKHKALFEELVKKFKVEYHAGGATQNSIKVAQWMIQKPHNVGTFFGCIGKDKFGDILKQKAEEAHIDAHY-YEQEEEPTGTCAACITGDNRSLVANLAAANCYKKEKHLDLEENWELVEKAKVFYIAGFFLTVSVESILKVAKHASETNKLFCLNLSAPFICQFFKDNLMKVFPYVDVLFGNETEAAAFAKEQDFETKDIKEIAKKAQALPKVNTKRQRVVVLTQGKDVTVMAQGDKVETFPVVKIDPKDIVDTNGAGDAFVGGFLSGLVQEKSLDQCVKAGHYSANVIIKRAGCTFPEKPDF 335          
BLAST of Adenosine kinase vs. Ensembl Medaka
Match: adka (adenosine kinase [Source:NCBI gene;Acc:101173404])

HSP 1 Score: 290.812 bits (743), Expect = 6.904e-96
Identity = 152/315 (48.25%), Postives = 201/315 (63.81%), Query Frame = 1
Query:   34 SKMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLA---QLLH 963
            S+++   LFGMGNPLLDI A V  D + KY LK ND ILAE+KH  L++E+V  +KV Y  GGATQN+IKVAQW+++K +    + GC+  DK+G  L +  E+  +   Y Y    E TG CA  ITG NRSLV +L A+ C     HLD  E W+ VE++ +FYI+ FF+T   E+++KVAKH+ E NK FCLNL A F+ +FF   + +   Y D +FGNE EA   A+  ++ T DIKEIA K   LP  N  R R VV+TQG D T++    +V  FP+VKI    IVDT GAGDAFVGG ++   +L+H
Sbjct:   32 SELSPNSLFGMGNPLLDICAVVDKDFLDKYTLKPNDQILAEDKHKALFEELVKKFKVEYHAGGATQNSIKVAQWMIQKPHNVGTFFGCIGKDKFGDILKQKAEEAHIDAHY-YEQEEEPTGTCAACITGDNRSLVANLAAANCYKKEKHLDLEENWELVEKAKVFYIAGFFLTVSVESILKVAKHASETNKLFCLNLSAPFICQFFKDNLMKVFPYVDVLFGNETEAAAFAKEQDFETKDIKEIAKKAQALPKVNTKRQRVVVLTQGKDVTVMAQGDKVETFPVVKIDPKDIVDTNGAGDAFVGGEISICLRLMH 345          
BLAST of Adenosine kinase vs. Ensembl Medaka
Match: adka (adenosine kinase [Source:NCBI gene;Acc:101173404])

HSP 1 Score: 289.271 bits (739), Expect = 1.273e-95
Identity = 152/315 (48.25%), Postives = 200/315 (63.49%), Query Frame = 1
Query:   34 SKMTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKY-ASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGAS-CKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLA---QLLH 963
            S ++   LFGMGNPLLDI A V  D + KY LK ND ILAE+KH  L++E+V  +KV Y  GGATQN+IKVAQW+++K +    + GC+  DK+G  L +  E+  +   Y Y    E TG CA  ITG NRSLV +L A+ C     HLD  E W+ VE++ +FYI+ FF+T   E+++KVAKH+ E NK FCLNL A F+ +FF   + +   Y D +FGNE EA   A+  ++ T DIKEIA K   LP  N  R R VV+TQG D T++    +V  FP+VKI    IVDT GAGDAFVGG ++   +L+H
Sbjct:    2 SSVSPNSLFGMGNPLLDICAVVDKDFLDKYTLKPNDQILAEDKHKALFEELVKKFKVEYHAGGATQNSIKVAQWMIQKPHNVGTFFGCIGKDKFGDILKQKAEEAHIDAHY-YEQEEEPTGTCAACITGDNRSLVANLAAANCYKKEKHLDLEENWELVEKAKVFYIAGFFLTVSVESILKVAKHASETNKLFCLNLSAPFICQFFKDNLMKVFPYVDVLFGNETEAAAFAKEQDFETKDIKEIAKKAQALPKVNTKRQRVVVLTQGKDVTVMAQGDKVETFPVVKIDPKDIVDTNGAGDAFVGGEISICLRLMH 315          
BLAST of Adenosine kinase vs. Planmine SMEST
Match: SMESG000027213.1 (SMESG000027213.1)

HSP 1 Score: 707.597 bits (1825), Expect = 0.000e+0
Identity = 341/341 (100.00%), Postives = 341/341 (100.00%), Query Frame = 1
Query:   40 MTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDWC 1062
            MTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDWC
Sbjct:    1 MTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDWC 341          
BLAST of Adenosine kinase vs. Planmine SMEST
Match: SMESG000027213.1 (SMESG000027213.1)

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 333/333 (100.00%), Postives = 333/333 (100.00%), Query Frame = 1
Query:   64 MGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDWC 1062
            MGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDWC
Sbjct:    1 MGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMVDNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCEQIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPEIWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVEFFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSKNPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVGGFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDWC 333          
The following BLAST results are available for this feature:
BLAST of Adenosine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADK7.935e-10645.64adenosine kinase [Source:HGNC Symbol;Acc:HGNC:257][more]
ADK9.428e-10645.91adenosine kinase [Source:HGNC Symbol;Acc:HGNC:257][more]
ADK2.349e-9242.15adenosine kinase [Source:HGNC Symbol;Acc:HGNC:257][more]
ADK1.428e-8845.57adenosine kinase [Source:HGNC Symbol;Acc:HGNC:257][more]
ADK2.399e-8645.07adenosine kinase [Source:HGNC Symbol;Acc:HGNC:257][more]
back to top
BLAST of Adenosine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
R07H5.81.094e-10245.93pep chromosome:WBcel235:IV:11209309:11210831:-1 ge... [more]
back to top
BLAST of Adenosine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AdenoK1.576e-9941.67gene:FBgn0036337 transcript:FBtr0346531[more]
AdenoK1.576e-9941.67gene:FBgn0036337 transcript:FBtr0075895[more]
AdenoK3.879e-9941.49gene:FBgn0036337 transcript:FBtr0075896[more]
CG38091.924e-6633.24gene:FBgn0037995 transcript:FBtr0082545[more]
Ady43A4.326e-2725.14gene:FBgn0026602 transcript:FBtr0089050[more]
back to top
BLAST of Adenosine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adka2.983e-11649.28adenosine kinase a [Source:ZFIN;Acc:ZDB-GENE-03042... [more]
adka2.471e-11550.15adenosine kinase a [Source:ZFIN;Acc:ZDB-GENE-03042... [more]
adka9.241e-11349.70adenosine kinase a [Source:ZFIN;Acc:ZDB-GENE-03042... [more]
adkb5.321e-10746.88adenosine kinase b [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
adkb7.690e-6446.01adenosine kinase b [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
back to top
BLAST of Adenosine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpte21.905e-11147.67transmembrane phosphoinositide 3-phosphatase and t... [more]
tpte24.189e-11147.52transmembrane phosphoinositide 3-phosphatase and t... [more]
tpte28.222e-11147.16transmembrane phosphoinositide 3-phosphatase and t... [more]
tpte21.280e-11047.94transmembrane phosphoinositide 3-phosphatase and t... [more]
tpte21.976e-11048.22transmembrane phosphoinositide 3-phosphatase and t... [more]
back to top
BLAST of Adenosine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Adk2.485e-10846.78adenosine kinase [Source:MGI Symbol;Acc:MGI:87930][more]
Adk6.252e-10846.51adenosine kinase [Source:MGI Symbol;Acc:MGI:87930][more]
Adk8.287e-4245.51adenosine kinase [Source:MGI Symbol;Acc:MGI:87930][more]
Adk1.165e-2748.15adenosine kinase [Source:MGI Symbol;Acc:MGI:87930][more]
back to top
BLAST of Adenosine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9SF85|ADK1_ARATH7.360e-11145.27Adenosine kinase 1 OS=Arabidopsis thaliana OX=3702... [more]
sp|Q9LZG0|ADK2_ARATH1.543e-11045.86Adenosine kinase 2 OS=Arabidopsis thaliana OX=3702... [more]
sp|Q64640|ADK_RAT6.889e-10947.66Adenosine kinase OS=Rattus norvegicus OX=10116 GN=... [more]
sp|P55262|ADK_CRIGR6.535e-10847.37Adenosine kinase OS=Cricetulus griseus OX=10029 GN... [more]
sp|P55264|ADK_MOUSE1.738e-10746.78Adenosine kinase OS=Mus musculus OX=10090 GN=Adk P... [more]
back to top
BLAST of Adenosine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HBF62.105e-12150.29adenosine kinase 2 isoform X1 OS=Lingula unguis OX... [more]
A0A1Y3N3K92.240e-12150.15PfkB domain-containing protein OS=Piromyces sp. (s... [more]
A0A1S3HE591.901e-12051.04adenosine kinase 2 isoform X2 OS=Lingula unguis OX... [more]
A0A1Y1VII21.918e-12049.55PfkB domain-containing protein OS=Piromyces finnis... [more]
A0A1Y2BCY92.510e-11950.75Adenosine kinase b OS=Neocallimastix californiae O... [more]
back to top
BLAST of Adenosine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adka9.615e-11448.83adenosine kinase [Source:NCBI gene;Acc:103039309][more]
adka1.337e-11348.97adenosine kinase [Source:NCBI gene;Acc:103039309][more]
adka6.504e-10947.95adenosine kinase [Source:NCBI gene;Acc:103039309][more]
adka3.434e-10847.66adenosine kinase [Source:NCBI gene;Acc:103039309][more]
adkb5.797e-10645.35adenosine kinase-like [Source:NCBI gene;Acc:103035... [more]
back to top
BLAST of Adenosine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenosine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ADO18.803e-7839.65Adenosine kinase; required for the utilization of ... [more]
RBK15.605e-924.82Putative ribokinase [Source:SGD;Acc:S000000632][more]
back to top
BLAST of Adenosine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO437115.503e-11548.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Adenosine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adka7.063e-11450.00adenosine kinase [Source:NCBI gene;Acc:101173404][more]
ADK4.610e-10946.92adenosine kinase [Source:NCBI gene;Acc:101174705][more]
adka8.006e-10249.52adenosine kinase [Source:NCBI gene;Acc:101173404][more]
adka6.904e-9648.25adenosine kinase [Source:NCBI gene;Acc:101173404][more]
adka1.273e-9548.25adenosine kinase [Source:NCBI gene;Acc:101173404][more]
back to top
BLAST of Adenosine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000027213.10.000e+0100.00SMESG000027213.1[more]
SMESG000027213.10.000e+0100.00SMESG000027213.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003196 ID=SMED30003196|Name=Adenosine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1162bp
CAATGATATTCTTCAAATCATTACAATTTCAAAAGTAAAATGACTGATAA
GCTTCTATTTGGCATGGGAAATCCTTTATTGGATATTATTGCAGATGTTA
GTTTAGATCTCATTAAAAAGTATAATCTGAAAGAAAATGATGCAATATTA
GCTGAAGAAAAGCATATGCCACTATATGATGAAATGGTTGATAATTATAA
AGTTGTATATATTCCAGGTGGGGCTACCCAGAATACTATTAAAGTTGCGC
AATGGGTATTGAAAAAGAAATATGCGTCTGTATATGCTGGATGTGTCAAA
GATGACAAATATGGCAAGAAGTTAAACGAATCTTGTGAACAAATAGGAGT
TCGGACGCTATATCAGTATAATACAGGCCCTGAAACTACCGGAGTTTGTG
CTTGTTTAATTACCGGTCACAATAGATCATTAGTTACATCACTGGGAGCA
TCGTGTAAATTTACGGCTGACCACCTGGACAAGCCAGAAATCTGGAAATA
CGTTGAACAATCTTCTTTGTTCTATATTTCTTCGTTTTTCATTACTTCTT
GTCATGAAGCGTTAATTAAAGTCGCTAAACATTCTTTGGAAAATAATAAA
ACCTTTTGTTTAAATCTGGGTGCAGAATTTCTCGTTGAATTTTTCAATGC
ACAAGTTACTGAATCGATTGAATACGCTGATTACGTGTTCGGAAACGAAG
CCGAAGCTCTGAAATTGGCGCAAATCGGAAACTACGGAACGACTGATATT
AAAGAAATTGCTGTGAAAATCTCACAATTGCCATCAAAGAATCCTAATCG
ACTTCGAACTGTCGTAATTACTCAAGGCGCCGATCCGACAATTATTGTTT
ACAAAGGCCAAGTTAGGGCTTTTCCTATTGTTAAGATTTCCGACAATAGA
ATCGTCGATACAACAGGAGCAGGTGACGCATTCGTTGGGGGATTTCTCGC
CCAATTGCTACACGGGAAATCGCTTGAGGATTGCGTCAAATGCGCCAATT
GGACAGCTGGAGTGATCATTCGGCAAGCTGGCTGCACGTTTCCAGAGAAA
TGCGATTGGTGTTAGACAATACATTAGGAAATGTTTTATTAGAATAAAAT
TTGATTGATTTTTAATTTATTAATTTTATATCGGATAATTTTGAAATAAA
ATTTAACTTTGC
back to top

protein sequence of SMED30003196-orf-1

>SMED30003196-orf-1 ID=SMED30003196-orf-1|Name=SMED30003196-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=342bp
MTDKLLFGMGNPLLDIIADVSLDLIKKYNLKENDAILAEEKHMPLYDEMV
DNYKVVYIPGGATQNTIKVAQWVLKKKYASVYAGCVKDDKYGKKLNESCE
QIGVRTLYQYNTGPETTGVCACLITGHNRSLVTSLGASCKFTADHLDKPE
IWKYVEQSSLFYISSFFITSCHEALIKVAKHSLENNKTFCLNLGAEFLVE
FFNAQVTESIEYADYVFGNEAEALKLAQIGNYGTTDIKEIAVKISQLPSK
NPNRLRTVVITQGADPTIIVYKGQVRAFPIVKISDNRIVDTTGAGDAFVG
GFLAQLLHGKSLEDCVKCANWTAGVIIRQAGCTFPEKCDWC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR001805Adenokinase
IPR029056Ribokinase-like
IPR011611PfkB_dom
IPR002173Carboh/pur_kinase_PfkB_CS
Vocabulary: molecular function
TermDefinition
GO:0004001adenosine kinase activity
GO:0016773phosphotransferase activity, alcohol group as acceptor
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006166purine ribonucleoside salvage
GO:0006167AMP biosynthetic process
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001805Adenosine kinasePRINTSPR00989ADENOKINASEcoord: 114..129
score: 53.12
coord: 82..96
score: 40.83
coord: 261..280
score: 44.38
coord: 152..178
score: 38.89
coord: 65..74
score: 65.0
IPR029056Ribokinase-likeGENE3DG3DSA:3.40.1190.20coord: 7..327
e-value: 4.4E-122
score: 409.0
IPR029056Ribokinase-likeSUPERFAMILYSSF53613Ribokinase-likecoord: 6..334
IPR011611Carbohydrate kinase PfkBPFAMPF00294PfkBcoord: 27..335
e-value: 4.0E-65
score: 220.1
NoneNo IPR availableGENE3DG3DSA:3.30.1110.10coord: 14..134
e-value: 4.4E-122
score: 409.0
NoneNo IPR availablePANTHERPTHR45769FAMILY NOT NAMEDcoord: 4..339
NoneNo IPR availableCDDcd01168adenosine_kinasecoord: 6..335
e-value: 1.65996E-121
score: 350.376
IPR002173Carbohydrate/puine kinase, PfkB, conserved sitePROSITEPS00584PFKB_KINASES_2coord: 290..303