Universal stress protein Rv1636

Overview
NameUniversal stress protein Rv1636
Smed IDSMED30003183
Length (bp)705
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Universal stress protein Rv1636 (SMED30003183) t-SNE clustered cells

Violin plots show distribution of expression levels for Universal stress protein Rv1636 (SMED30003183) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Universal stress protein Rv1636 (SMED30003183) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Universal stress protein Rv1636 (SMED30003183) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003183

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30003183h1SMcG0014428 Contig44420uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003183h1SMcG0014428 Contig44420newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30003183h1SMcG0014428 dd_Smed_v4_3388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003183h1SMcG0014428 dd_Smed_v4_3388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003183h1SMcG0014428 dd_Smed_v4_3388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30003183h1SMcG0014428 dd_Smed_v4_3388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30003183h1SMcG0014428 dd_Smed_v4_3388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Universal stress protein Rv1636 vs. UniProt/SwissProt
Match: sp|P72745|Y1101_SYNY3 (Universal stress protein Slr1101 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr1101 PE=3 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 6.569e-9
Identity = 30/95 (31.58%), Postives = 50/95 (52.63%), Query Frame = 2
Query:  233 LSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVP 517
            L+ +   QQ Q   ++G    ++    A   ++E +A   +   PG  + + AK+  +D+IVVG+RG   L    LGSV +Y+  HAH  + +VP
Sbjct:   12 LTMEVWQQQWQTFEQEGLDTLEKRRQQALALDIECQAE-QILGSPGKIICQRAKQDNSDIIVVGHRGRWGLSEILLGSVGNYVFHHAHCCVFVVP 105          
BLAST of Universal stress protein Rv1636 vs. UniProt/SwissProt
Match: sp|Q57951|Y531_METJA (Universal stress protein MJ0531 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ0531 PE=3 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 2.474e-8
Identity = 44/155 (28.39%), Postives = 82/155 (52.90%), Query Frame = 2
Query:   80 VLLPLDGSDNSERAFEWYIGQMHRRGD---LAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGL---ALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVPKEK 526
            +++P DGSD S  A +  I  + +  D    A+ +  V P    P   S E        +S+ ++   E+G++  ++   MA+   V+    IH +   G+    +V+ A++ +AD+IV+G  G + L R  LGSV++ ++++AH P+++V K K
Sbjct:   29 IVIPTDGSDVSLEAAKHAI-NIAKEFDAEVYAIYVVDVSPFVGLPAEGSWE-------LISELLK---EEGQEALKKVKKMAEEWGVK----IHTEMLEGVPANEIVEFAEKKKADLIVMGTTGKTGLERILLGSVAERVIKNAHCPVLVVKKPK 168          
BLAST of Universal stress protein Rv1636 vs. UniProt/SwissProt
Match: sp|Q8LGG8|USPAL_ARATH (Universal stress protein A-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g01520 PE=1 SV=2)

HSP 1 Score: 54.6842 bits (130), Expect = 4.794e-8
Identity = 36/141 (25.53%), Postives = 69/141 (48.94%), Query Frame = 2
Query:  107 NSERAFEWYIGQMHRR--GDLAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHV-DPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVPK 520
            + +RAFEW + ++ R    D  +L+  V+ V      +  ++   S +      Q     G  L + F++      V  +A+I   DPK    + +  K  R D +VVG+RG+ +  + F+G+VS + ++HA  P++ + +
Sbjct:   26 SCKRAFEWTLEKIVRSNTSDFKILLLHVQ-VVDEDGFDDVDSIYASPEDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKD--VICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKR 163          
BLAST of Universal stress protein Rv1636 vs. UniProt/SwissProt
Match: sp|P42297|YXIE_BACSU (Universal stress protein YxiE OS=Bacillus subtilis (strain 168) OX=224308 GN=yxiE PE=3 SV=1)

HSP 1 Score: 49.2914 bits (116), Expect = 2.408e-6
Identity = 39/146 (26.71%), Postives = 74/146 (50.68%), Query Frame = 2
Query:   80 VLLPLDGSDNSERAFEWYIG-QMHRRGDLAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIV 514
            +L+ +DGSD S +A +  +     ++ +L++L    E V  T  L       +    + +   ++ ++G ++ +     A    V+A+  I+ + +P   ++  AKE    +IVVG+RG+S L    LGSVS  + Q +  P++IV
Sbjct:    5 MLVAIDGSDMSAKALDAAVHLAKEQQAELSILHVGREAVVTTSSLTGI--VYVPEHFIDEIRNEVKKEGLKILENAKEKAAEKGVQAET-IYANGEPAHEILNHAKEKGVSLIVVGSRGISGLKEMMLGSVSHKVSQLSTCPVLIV 147          
BLAST of Universal stress protein Rv1636 vs. UniProt/SwissProt
Match: sp|P74148|Y1388_SYNY3 (Universal stress protein Sll1388 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1388 PE=3 SV=1)

HSP 1 Score: 47.7506 bits (112), Expect = 8.939e-6
Identity = 26/103 (25.24%), Postives = 51/103 (49.51%), Query Frame = 2
Query:  206 PLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIV 514
            P    E ++  +  + + +++   + ++  Q  +   +   V  +  + V  +PG  +   AK   AD++V+G RG+  L   FLGSVS Y++ H    ++IV
Sbjct:   51 PSFYGEAAIGFSQIIKEHLEEQQTEAREWLQSIVQQVQEDGVACEWDVKVG-EPGRWIRDMAKNWDADLVVLGRRGLKGLAEVFLGSVSSYVIHHVQCSVLIV 152          
BLAST of Universal stress protein Rv1636 vs. TrEMBL
Match: C1LTL1 (Universal stress protein OS=Schistosoma japonicum OX=6182 GN=Usp PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 2.761e-51
Identity = 76/151 (50.33%), Postives = 113/151 (74.83%), Query Frame = 2
Query:   71 TRVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVPKE 523
            +RV+L+P+DGSD+ +RAF WY+  M R  D    +++VEPVY+TPP   A+N  + +  ++Q M+  IE+GK+L Q+++H AK+  + A AF+HVD KPG +LVK   EH+ADVI++G+RG+  + RTFLGSVSDY+L HAH+P+VI+P +
Sbjct:    8 SRVILIPIDGSDHCDRAFRWYLENMKRDTDCIKFVHVVEPVYSTPPFGLADNYTMPD--ITQVMEISIENGKKLGQKYIHEAKSYKLSAHAFLHVDTKPGSSLVKAISEHKADVILMGSRGLGAIRRTFLGSVSDYVLHHAHIPVVIIPPQ 156          
BLAST of Universal stress protein Rv1636 vs. TrEMBL
Match: C1LAS3 (Universal stress protein OS=Schistosoma japonicum OX=6182 GN=Usp PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 3.705e-51
Identity = 76/151 (50.33%), Postives = 113/151 (74.83%), Query Frame = 2
Query:   71 TRVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVPKE 523
            +RV+L+P+DGSD+ +RAF WY+  M R  D    +++VEPVY+TPP   A+N  + +  ++Q M+  IE+GK+L Q+++H AK+  + A AF+HVD KPG +LVK   EH+ADVI++G+RG+  + RTFLGSVSDY+L HAH+P+VI+P +
Sbjct:    8 SRVILIPIDGSDHCDRAFRWYLENMKRDTDCIKFVHVVEPVYSTPPFGLADNYTMPD--ITQVMEISIENGKKLGQKYIHEAKSYKLSAHAFLHVDTKPGSSLVKAISEHKADVILMGSRGLGAIRRTFLGSVSDYVLHHAHIPVVIIPPQ 156          
BLAST of Universal stress protein Rv1636 vs. TrEMBL
Match: A0A4Z2DUK2 (Universal stress protein OS=Schistosoma japonicum OX=6182 GN=EWB00_004515 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 4.042e-51
Identity = 76/151 (50.33%), Postives = 112/151 (74.17%), Query Frame = 2
Query:   71 TRVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVPKE 523
            +RV+L+P+DGSD+ +RAF WY+  M R  D    +++VEPVY+TPP   A+N  + +  ++Q M+  IE GK+L Q+++H AK+  + A AF+HVD KPG +LVK   EH+ADVI++G+RG+  + RTFLGSVSDY+L HAH+P+VI+P +
Sbjct:    8 SRVILIPIDGSDHCDRAFRWYLENMKRDTDCIKFVHVVEPVYSTPPFGLADNYTMPD--ITQVMEISIESGKKLGQKYIHEAKSYKLSAHAFLHVDTKPGSSLVKAISEHKADVILMGSRGLGAIRRTFLGSVSDYVLHHAHIPVVIIPPQ 156          
BLAST of Universal stress protein Rv1636 vs. TrEMBL
Match: C1LTL4 (Universal stress protein OS=Schistosoma japonicum OX=6182 GN=Usp PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 7.598e-51
Identity = 75/151 (49.67%), Postives = 113/151 (74.83%), Query Frame = 2
Query:   71 TRVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVPKE 523
            +RV+L+P+DGSD+ +RAF WY+  M R  D    +++VEPVY+TPP   A+N  + +  ++Q M+  IE+G++L Q+++H AK+  + A AF+HVD KPG +LVK   EH+ADVI++G+RG+  + RTFLGSVSDY+L HAH+P+VI+P +
Sbjct:    8 SRVILIPIDGSDHCDRAFRWYLENMKRDTDCIKFVHVVEPVYSTPPFGLADNYTMPD--ITQVMEISIENGRKLGQKYIHEAKSYKLSAHAFLHVDTKPGSSLVKAISEHKADVILMGSRGLGAIRRTFLGSVSDYVLHHAHIPVVIIPPQ 156          
BLAST of Universal stress protein Rv1636 vs. TrEMBL
Match: A0A2H1CA34 (Stress response protein nhaX OS=Fasciola hepatica OX=6192 GN=D915_005208 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 2.832e-50
Identity = 76/154 (49.35%), Postives = 114/154 (74.03%), Query Frame = 2
Query:   62 KKDTRVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVPKE 523
            +K  RVVL+P DGS++SERA+EWY+  +H + D    I+++EPVY TP +  A  S    D +++ M++ I+ GK+L Q+++H AK   ++++AF+HVD KPG ALVK   EH+AD++V+GNRG+  + RTFLGSVSDY+L HAH+P++IVP +
Sbjct:   14 EKKGRVVLVPTDGSEHSERAYEWYVKNVHMKSDCVKFISVIEPVYTTPAIGMAMESPPLPD-MARVMEESIQSGKKLCQQYMHKAKADGIDSQAFLHVDNKPGAALVKSITEHKADLVVMGNRGIGAVRRTFLGSVSDYVLHHAHVPVIIVPPQ 166          
BLAST of Universal stress protein Rv1636 vs. Ensembl Nematostella
Match: EDO45800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRQ2])

HSP 1 Score: 114.775 bits (286), Expect = 2.715e-32
Identity = 55/153 (35.95%), Postives = 95/153 (62.09%), Query Frame = 2
Query:   65 KDTRVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVPKE 523
            K  R +LLP+D S +SE AFEWY+  MH   D  +L+++++       ++S     L +D    +M   +++ K L +++   A+ A+++AK  +    KPG  + +C+K+   D+I++G+RG+  + RT LGSVSDY+L HAH+P +I+PK+
Sbjct:    7 KKVRRILLPIDSSKHSEDAFEWYVNNMHHEEDELILVHVLDSAAIQTRVSS---HGLVDDEFKNEMNKGLKEVKALEEKYKTKAETASLKAKIEVR-GGKPGETICQCSKDEHCDLILMGSRGLGSIRRTILGSVSDYVLHHAHVPTIIIPKK 155          
BLAST of Universal stress protein Rv1636 vs. Ensembl Nematostella
Match: EDO49708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFF6])

HSP 1 Score: 100.908 bits (250), Expect = 8.216e-27
Identity = 54/155 (34.84%), Postives = 93/155 (60.00%), Query Frame = 2
Query:   59 SKKDTRVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVE--PVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVP 517
            +K + R VLL +D S++S RAFEWY   +HR  +L +L++  E  P++  P    A  + L N+ +++  +  ++  K+L + F  M K  + E +  +     PG A++K  K+ + + +V+G+RG S + RT +GSVSD+I+ HAH+P+ I P
Sbjct:    9 TKYEKRRVLLAIDHSEHSMRAFEWYFENIHRDDNLLMLVHSQELPPIFIPP---DAFGTTLYNEWLAEAKKASLQ-SKKLLEGFERMCKERHCECEKHLLEGDNPGPAIIKLIKKSKPNYVVIGSRGQSMVRRTVMGSVSDFIIHHAHVPVCISP 159          
BLAST of Universal stress protein Rv1636 vs. Ensembl Nematostella
Match: EDO38238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDJ5])

HSP 1 Score: 97.4413 bits (241), Expect = 1.300e-25
Identity = 53/151 (35.10%), Postives = 91/151 (60.26%), Query Frame = 2
Query:   71 TRVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPV-YATPPL-NSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVP 517
            T  +L P+DGSD+S RAF++Y+ ++ R  D  +L +IVEP    TP L +    S    D++ ++M+   E  +++T  +  + +  N+  ++ I      G  + + AK   AD I++GNRG+  + RT LGSV+DY++QH+H+ ++IVP
Sbjct:    4 TESILFPVDGSDHSSRAFDYYLDKVKRADDQVLLAHIVEPTGIPTPTLAHGVTRSRAEWDTIMRRME---ETAREITADYEKICEAENIPFQS-IWGAGNAGEGICELAKNEGADFILIGNRGLGSIKRTLLGSVTDYVVQHSHVAVLIVP 150          
BLAST of Universal stress protein Rv1636 vs. Ensembl Nematostella
Match: EDO42478 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1B3])

HSP 1 Score: 94.3597 bits (233), Expect = 2.450e-24
Identity = 50/158 (31.65%), Postives = 87/158 (55.06%), Query Frame = 2
Query:   59 SKKDTRVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHV-----DPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVP 517
            S K+  VVL+P+DGS NS RAF+WY    H+  D  ++++     Y  PP+ +A+++ +   +   + Q + +  +   +  L + +   +  K  I         K G  ++  AK+   D I++G+RG+ K  RT LGSVSDY++ HA +P+++VP
Sbjct:    4 SPKERNVVLIPVDGSKNSIRAFDWYKDHYHQENDKVLIVS----AYEIPPMQAAKHASVDFKNQLLEWQILRQKAEDKARSILKVFEQRCLPFKELISYRLLPGGGKAGEVIIGIAKQENVDEIIIGSRGLGKFRRTILGSVSDYVVHHASVPVIVVP 157          
BLAST of Universal stress protein Rv1636 vs. Ensembl Nematostella
Match: EDO44805 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT2])

HSP 1 Score: 94.3597 bits (233), Expect = 2.837e-24
Identity = 48/151 (31.79%), Postives = 84/151 (55.63%), Query Frame = 2
Query:   74 RVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVPKEK 526
            R +++P+DGS +SERAF+WY G +HR  D   +++  +P  A              +   Q M+  ++D K + + +    K++ ++    +     PG  + + AK+  AD I++G+RG+  + RT +GSVS++ L H H+P+ IVP EK
Sbjct:   10 RKIVIPVDGSKHSERAFDWYKGALHRGNDEVFVVHAFDPYAAP--PTPYPYGFAFPEDWEQHMKKTVDDAKSVMEYYEKKCKDSKMKC-TMLTKPGDPGETICEIAKDKNADQIIMGSRGLGTVRRTIVGSVSEFCLHHTHIPMSIVPPEK 157          
BLAST of Universal stress protein Rv1636 vs. Planmine SMEST
Match: SMESG000022085.1 (SMESG000022085.1)

HSP 1 Score: 329.717 bits (844), Expect = 1.462e-116
Identity = 160/161 (99.38%), Postives = 160/161 (99.38%), Query Frame = 2
Query:   53 MYSKKDTRVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVPKEKILD 535
            MYSKKDTRVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPG ALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVPKEKILD
Sbjct:    1 MYSKKDTRVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGPALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVPKEKILD 161          
BLAST of Universal stress protein Rv1636 vs. Planmine SMEST
Match: SMESG000016283.1 (SMESG000016283.1)

HSP 1 Score: 183.726 bits (465), Expect = 6.446e-59
Identity = 84/150 (56.00%), Postives = 113/150 (75.33%), Query Frame = 2
Query:   74 RVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVPKE 523
            R +++P+D S++S+RAF WYI  M +  DL + I++VEPVYATP +   E   +  D +S+ M+D I +GK+L Q F+H AK+  +E KAFIHVD KPG ALVK AK+H+ADVI++GNRGV  L RTFLGSVSD+IL HAH+P+V+VP E
Sbjct:    4 RSIMIPIDSSEHSKRAFRWYIKNMKQPNDLVLFIHVVEPVYATPAVGMMEPPPIVLDDMSRMMEDAINEGKKLGQEFMHEAKDTGLEPKAFIHVDTKPGAALVKSAKDHQADVIIIGNRGVGTLRRTFLGSVSDHILHHAHIPVVVVPPE 153          
BLAST of Universal stress protein Rv1636 vs. Planmine SMEST
Match: SMESG000039918.1 (SMESG000039918.1)

HSP 1 Score: 137.887 bits (346), Expect = 6.374e-41
Identity = 61/158 (38.61%), Postives = 102/158 (64.56%), Query Frame = 2
Query:   53 MYSKKDTRVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVPKEK 526
            M  +   R +L+P+D SD+S RAFEWY   + + GD+  L++IVEP YAT  ++ ++      + ++ +M    +  K+L Q+++ +A++  +  K  I+VD K G A++K A E+R  ++++GNRG+  L RT LGS SD+IL HA++P++IVP  K
Sbjct:    1 MAHESSNRNILIPVDSSDHSRRAFEWYQANIKQEGDVLFLVHIVEPQYATSAISISDTIKFKMEDMTSKMDSASKKAKELLQKYIKLAEDDRIHTKGIINVDNKAGDAIIKIASENRVSLVIIGNRGIGTLRRTILGSTSDFILNHANVPVIIVPPPK 158          
BLAST of Universal stress protein Rv1636 vs. Planmine SMEST
Match: SMESG000035960.1 (SMESG000035960.1)

HSP 1 Score: 133.65 bits (335), Expect = 1.357e-38
Identity = 60/164 (36.59%), Postives = 105/164 (64.02%), Query Frame = 2
Query:   35 VTIIQIMYSKKDTRVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPVYATPPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVPKEK 526
            +TI   +   ++ R++L+P+D S+NSERAF WY  + HR  D+  LI++V     +   +S+     + +  ++ MQ+ +E GK++  ++L   K  +++AK  +H+  KPG  +V+  KEH+ + IV+GNR +S   RT LGSVS+Y++++A+ P+V+VP EK
Sbjct:   14 ITIKDSVELDENKRIILMPVDFSENSERAFNWYHTEFHRENDILFLIHVVNSSGTSVSYDSSSKIGSNTNEFNEIMQEQLETGKKVGHKYLDRCKEKSIKAKFTVHIGSKPGEHIVRLTKEHKINTIVIGNRAISNFRRTILGSVSEYVIRNANCPVVVVPPEK 177          
BLAST of Universal stress protein Rv1636 vs. Planmine SMEST
Match: SMESG000020952.1 (SMESG000020952.1)

HSP 1 Score: 124.405 bits (311), Expect = 1.057e-35
Identity = 58/149 (38.93%), Postives = 95/149 (63.76%), Query Frame = 2
Query:   74 RVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPVYATPPLN-SAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIHVDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLPIVIVP 517
            RV+L+P+D S+++ERA +WY+  + +  DL  +I+IVEP+Y +  +    E + L  + +  +++  ++ GK L ++F H  +     AK ++ VD K G A++K    H+ D+I+V NRG   + RTFLGSVSDY+L HA  P+VI+P
Sbjct:   11 RVILMPVDRSEHTERAIDWYVENLMKPNDLVQMIHIVEPMYTSTAVGIGMEVAFLPVEDLESKIKKQLDKGKSLVKKFTHELQEKGGRAKGYVIVDSKVGEAIIKVCHTHKVDLIIVANRGEGLIRRTFLGSVSDYVLHHADRPVVIIP 159          
The following BLAST results are available for this feature:
BLAST of Universal stress protein Rv1636 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Universal stress protein Rv1636 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Universal stress protein Rv1636 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Universal stress protein Rv1636 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Universal stress protein Rv1636 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Universal stress protein Rv1636 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Universal stress protein Rv1636 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P72745|Y1101_SYNY36.569e-931.58Universal stress protein Slr1101 OS=Synechocystis ... [more]
sp|Q57951|Y531_METJA2.474e-828.39Universal stress protein MJ0531 OS=Methanocaldococ... [more]
sp|Q8LGG8|USPAL_ARATH4.794e-825.53Universal stress protein A-like protein OS=Arabido... [more]
sp|P42297|YXIE_BACSU2.408e-626.71Universal stress protein YxiE OS=Bacillus subtilis... [more]
sp|P74148|Y1388_SYNY38.939e-625.24Universal stress protein Sll1388 OS=Synechocystis ... [more]
back to top
BLAST of Universal stress protein Rv1636 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1LTL12.761e-5150.33Universal stress protein OS=Schistosoma japonicum ... [more]
C1LAS33.705e-5150.33Universal stress protein OS=Schistosoma japonicum ... [more]
A0A4Z2DUK24.042e-5150.33Universal stress protein OS=Schistosoma japonicum ... [more]
C1LTL47.598e-5149.67Universal stress protein OS=Schistosoma japonicum ... [more]
A0A2H1CA342.832e-5049.35Stress response protein nhaX OS=Fasciola hepatica ... [more]
back to top
BLAST of Universal stress protein Rv1636 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Universal stress protein Rv1636 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Universal stress protein Rv1636 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Universal stress protein Rv1636 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458002.715e-3235.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497088.216e-2734.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382381.300e-2535.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424782.450e-2431.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448052.837e-2431.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Universal stress protein Rv1636 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Universal stress protein Rv1636 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022085.11.462e-11699.38SMESG000022085.1[more]
SMESG000016283.16.446e-5956.00SMESG000016283.1[more]
SMESG000039918.16.374e-4138.61SMESG000039918.1[more]
SMESG000035960.11.357e-3836.59SMESG000035960.1[more]
SMESG000020952.11.057e-3538.93SMESG000020952.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003183 ID=SMED30003183|Name=Universal stress protein Rv1636|organism=Schmidtea mediterranea sexual|type=transcript|length=705bp
ATCACCGAACGAGATATAATTGGGCTAAACTGAAGTCACAATTATACAAA
TCATGTATTCAAAAAAAGATACGAGAGTTGTATTATTGCCCTTAGATGGT
TCGGACAATTCAGAAAGAGCTTTCGAATGGTATATTGGTCAAATGCACCG
CAGAGGTGACCTCGCGGTTTTGATTAATATCGTCGAACCGGTTTATGCGA
CTCCTCCGTTGAATTCAGCAGAGAATTCCGTTTTGTCAAATGACAGTGTT
TCCCAACAGATGCAAGACATCATCGAAGACGGCAAACAATTGACTCAACG
ATTTCTTCATATGGCTAAGAATGCCAATGTAGAGGCAAAAGCTTTCATTC
ATGTTGATCCCAAACCCGGCCTAGCACTTGTGAAATGCGCCAAAGAACAT
CGAGCCGATGTAATTGTTGTTGGAAATCGTGGGGTTAGCAAATTACATCG
AACTTTTTTGGGTAGTGTCAGTGATTACATTCTTCAACATGCCCATTTGC
CAATCGTAATTGTTCCCAAAGAAAAGATTTTAGATTGATGCTCATAAAGG
TTCGGATTTCAATTTATTTCAAAGCATGACTGTCACGTATCAATTTTATT
CTATTGTAAAATTGTTATGAGGAGATTCAATTTATATTTAGATTTTAAGA
AATTCTATACAAGATTAAAAGTTTACAAATAAAAATTTTAACTTAAAAAA
AACAA
back to top

protein sequence of SMED30003183-orf-1

>SMED30003183-orf-1 ID=SMED30003183-orf-1|Name=SMED30003183-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=162bp
MYSKKDTRVVLLPLDGSDNSERAFEWYIGQMHRRGDLAVLINIVEPVYAT
PPLNSAENSVLSNDSVSQQMQDIIEDGKQLTQRFLHMAKNANVEAKAFIH
VDPKPGLALVKCAKEHRADVIVVGNRGVSKLHRTFLGSVSDYILQHAHLP
IVIVPKEKILD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005618cell wall
GO:0005886plasma membrane
Vocabulary: biological process
TermDefinition
GO:0046677response to antibiotic
GO:0006950response to stress
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR006015Universal_stress_UspA
IPR014729Rossmann-like_a/b/a_fold
IPR006016UspA
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006015Universal stress protein A familyPRINTSPR01438UNVRSLSTRESScoord: 115..127
score: 43.08
coord: 133..155
score: 33.91
coord: 7..25
score: 34.95
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 3..159
e-value: 8.7E-35
score: 122.5
IPR006016UspAPFAMPF00582Uspcoord: 8..155
e-value: 8.1E-24
score: 84.7
NoneNo IPR availablePANTHERPTHR46989FAMILY NOT NAMEDcoord: 8..158
NoneNo IPR availableCDDcd00293USP_Likecoord: 10..154
e-value: 6.19645E-24
score: 88.581
NoneNo IPR availableSUPERFAMILYSSF52402Adenine nucleotide alpha hydrolases-likecoord: 10..157