Bardet-Biedl syndrome 2 protein homolog

Overview
NameBardet-Biedl syndrome 2 protein homolog
Smed IDSMED30003177
Length (bp)2326
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bardet-Biedl syndrome 2 protein homolog (SMED30003177) t-SNE clustered cells

Violin plots show distribution of expression levels for Bardet-Biedl syndrome 2 protein homolog (SMED30003177) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bardet-Biedl syndrome 2 protein homolog (SMED30003177) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bardet-Biedl syndrome 2 protein homolog (SMED30003177) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003177

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003177SMESG000075151.1 SMESG000074964.1 SMESG000074953.1 SmedASXL_016199SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30003177SMESG000075151.1 SMESG000074964.1 dd_Smed_v4_10186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30003177SMESG000075151.1 SMESG000074964.1 dd_Smed_v4_10186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30003177SMESG000075151.1 SMESG000074964.1 dd_Smed_v4_10186_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Human
Match: BBS2 (Bardet-Biedl syndrome 2 [Source:HGNC Symbol;Acc:HGNC:967])

HSP 1 Score: 308.531 bits (789), Expect = 3.203e-93
Identity = 144/324 (44.44%), Postives = 213/324 (65.74%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
             EL   T+ND ++R V+IFAEGIF GESHVVHP IH LS+ + + I PPKDV VDLH+K  VGY++  QFH+FE  R LP+FSMY   +   P  +P  YV F + ER  R ++W+ QNFLL ++  +++       + F S+R    L I I   + ++ ++T++I+ AG+I+QS+  +  +EDL    +FP  F  L  V+ K+D   + HQ++++D+AD SN+I++ +V AED RLMR M  M   Y EL  LNR+L+N Y+IRCNNH ELL  LK +N  IQ+ G LRVG+ + QV+ +CR A++ N++N + ++++ GT
Sbjct:  400 TELRISTSNDTIIRAVLIFAEGIFTGESHVVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSL-DPASEPISYVNFTIAERAQRVVVWLGQNFLLPEDTHIQN---APFQVCFTSLRNGGHLHIKIK-LSGEITINTDDIDLAGDIIQSMASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADHSNLIRSLLVGAEDARLMRDMKTMKSRYMELYDLNRDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVITACRDAIRSNNINTLFKIMRVGT 718          

HSP 2 Score: 254.988 bits (650), Expect = 5.197e-79
Identity = 131/272 (48.16%), Postives = 178/272 (65.44%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWS---------VADNAISKDIPSNILNINQTILSLKTGHFN-KLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            LL  +   L+  I P  VAIG+++ +   L AA   GKV + N  +         V  + +  D+  ++L+INQ +  L  G  N +L +D   + VGT ++LL YDV NNSD+FY+E+ADG +   +G LG     + +IGG+C+L  F++ G ++ W+VTGDNV SLA+ D    G  EL+VGSEDF+IRVF ED+I+ EMTETE VT+LC + GS FGY L+NGTVGVYD+ +R WRIKSK+  + I  FD+N DGV ELITGWSNGKV
Sbjct:    2 LLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDV--SLLSINQAVSCLTAGVLNPELGYDA--LLVGTQTNLLAYDVYNNSDLFYREVADGANAIVLGTLGDISSPLAIIGGNCALQGFNHEGSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKV 269          

HSP 3 Score: 61.6178 bits (148), Expect = 5.197e-79
Identity = 38/92 (41.30%), Postives = 52/92 (56.52%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGVI----SQDYIYELNLKKQNLLMELKTYE 1137
            K+D R   +GEV+FKD+   +IAG+    +       L+ CS DGE+R Y   TA      G ++     QD I EL+ KKQNLL+EL+ YE
Sbjct:  268 KVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDGHIQLICCSVDGEIRGYLPGTA---EMRGNLMDTSAEQDLIRELSQKKQNLLLELRNYE 356          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Human
Match: BBS2 (Bardet-Biedl syndrome 2 [Source:HGNC Symbol;Acc:HGNC:967])

HSP 1 Score: 251.521 bits (641), Expect = 6.704e-78
Identity = 131/272 (48.16%), Postives = 178/272 (65.44%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWS---------VADNAISKDIPSNILNINQTILSLKTGHFN-KLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            LL  +   L+  I P  VAIG+++ +   L AA   GKV + N  +         V  + +  D+  ++L+INQ +  L  G  N +L +D   + VGT ++LL YDV NNSD+FY+E+ADG +   +G LG     + +IGG+C+L  F++ G ++ W+VTGDNV SLA+ D    G  EL+VGSEDF+IRVF ED+I+ EMTETE VT+LC + GS FGY L+NGTVGVYD+ +R WRIKSK+  + I  FD+N DGV ELITGWSNGKV
Sbjct:    2 LLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDV--SLLSINQAVSCLTAGVLNPELGYDA--LLVGTQTNLLAYDVYNNSDLFYREVADGANAIVLGTLGDISSPLAIIGGNCALQGFNHEGSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKV 269          

HSP 2 Score: 61.6178 bits (148), Expect = 6.704e-78
Identity = 38/92 (41.30%), Postives = 52/92 (56.52%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGVI----SQDYIYELNLKKQNLLMELKTYE 1137
            K+D R   +GEV+FKD+   +IAG+    +       L+ CS DGE+R Y   TA      G ++     QD I EL+ KKQNLL+EL+ YE
Sbjct:  268 KVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDGHIQLICCSVDGEIRGYLPGTA---EMRGNLMDTSAEQDLIRELSQKKQNLLLELRNYE 356          

HSP 3 Score: 257.299 bits (656), Expect = 1.299e-74
Identity = 129/323 (39.94%), Postives = 186/323 (57.59%), Query Frame = 3
Query: 1305 ELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            EL   T+ND ++R V+IFAEGIF GESHVVHP IH LS+ + + I PPKDV VDLH+K  VGY++  QFH+FE  R LP+FSMY   +   P  +P  YV F + ER  R ++W+ QNFLL ++  +++       + F S+R    L I               I+ +G                                 ++D   + HQ++++D+AD SN+I++ +V AED RLMR M  M   Y EL  LNR+L+N Y+IRCNNH ELL  LK +N  IQ+ G LRVG+ + QV+ +CR A++ N++N + ++++ GT
Sbjct:  401 ELRISTSNDTIIRAVLIFAEGIFTGESHVVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSL-DPASEPISYVNFTIAERAQRVVVWLGQNFLLPEDTHIQN---APFQVCFTSLRNGGHLHI--------------KIKLSG---------------------------------EVDEYHSVHQKLSADMADHSNLIRSLLVGAEDARLMRDMKTMKSRYMELYDLNRDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVITACRDAIRSNNINTLFKIMRVGT 672          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Human
Match: BBS2 (Bardet-Biedl syndrome 2 [Source:HGNC Symbol;Acc:HGNC:967])

HSP 1 Score: 138.272 bits (347), Expect = 1.883e-37
Identity = 62/135 (45.93%), Postives = 93/135 (68.89%), Query Frame = 3
Query: 1869 CNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
             +FP  F  L  V+ K+D   + HQ++++D+AD SN+I++ +V AED RLMR M  M   Y EL  LNR+L+N Y+IRCNNH ELL  LK +N  IQ+ G LRVG+ + QV+ +CR A++ N++N + ++++ GT
Sbjct:    5 ADFPVYFEELRKVLVKVDEYHSVHQKLSADMADHSNLIRSLLVGAEDARLMRDMKTMKSRYMELYDLNRDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVITACRDAIRSNNINTLFKIMRVGT 139          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Human
Match: BBS2 (Bardet-Biedl syndrome 2 [Source:HGNC Symbol;Acc:HGNC:967])

HSP 1 Score: 108.227 bits (269), Expect = 3.885e-27
Identity = 51/76 (67.11%), Postives = 61/76 (80.26%), Query Frame = 3
Query:  603 DDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            D+I+ EMTETE VT+LC + GS FGY L+NGTVGVYD+ +R WRIKSK+  + I  FD+N DGV ELITGWSNGKV
Sbjct:    1 DEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKV 76          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Human
Match: BBS2 (Bardet-Biedl syndrome 2 [Source:HGNC Symbol;Acc:HGNC:967])

HSP 1 Score: 84.3445 bits (207), Expect = 3.264e-19
Identity = 38/79 (48.10%), Postives = 56/79 (70.89%), Query Frame = 3
Query: 2037 MNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            M   Y EL  LNR+L+N Y+IRCNNH ELL  LK +N  IQ+ G LRVG+ + QV+ +CR A++ N++N + ++++ GT
Sbjct:    4 MKSRYMELYDLNRDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVITACRDAIRSNNINTLFKIMRVGT 82          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Celegans
Match: bbs-2 (Bardet-Biedl syndrome 2 protein homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19640])

HSP 1 Score: 167.162 bits (422), Expect = 1.261e-87
Identity = 98/334 (29.34%), Postives = 174/334 (52.10%), Query Frame = 3
Query: 1296 QGVELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTR----LPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAE--GQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIE--LEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            Q + L  E ++++ +R V+IFAEG+FEGES++  PP ++  +R    +P+ I   KD   DLH KV +G    N+  + E  R LPKF  +  + E   + F  PT Y+QF +  R  +   WV ++F ++  + ++  D+ E   +F+ +R   E  L   I+       +  + IE  G IVQS   +  ++++ SV +FP  F   ++++ +ID +     R+T+++ +    +K  I+RAED   + ++P   K Y  L   +       ++R NN +  +  L+ +N  I+    LRVG    Q+V SCR A+ D++   I ++++ G 
Sbjct:  383 QLLSLRVEASHNIPIRGVLIFAEGLFEGESYIWIPP-NEYQSRSVIDIPLVID--KDSTNDLHTKVFLGQVDSNKLMVMENTRILPKFCRFTLLREEYSKFFYMPTAYIQFDINSRAAKLSEWVQESFTIDASL-VEMFDEPEGEFKFMGLRPKHEKSLMFKISHSEKTCKIYHDKIETMGAIVQSYASFYQIQNMESVAHFPDVFKEADEILEEIDPMTEVRDRLTAELQERQAAVKEIIIRAEDSIAIDNIPDARKFYIRLKANDAAARQAAQLRWNNQERCVKSLRRLNKIIENCSRLRVGEPGRQIVVSCRSAIADDNKQIITKILQYGA 712          

HSP 2 Score: 155.221 bits (391), Expect = 1.261e-87
Identity = 97/264 (36.74%), Postives = 138/264 (52.27%), Query Frame = 3
Query:   39 MQLLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAISKDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            ++L + + ++L Q I+ G V            + A++     VTN   + D   S       LNI +TI  +    F       D I +GT SS++ YDV NN  VF  ++ DGVSC   GKLG+ D+  +  GG+C +  FD  G    W+VTGD VT++ + D  N G  EL++GS DFEIRVF  D +  E+ ET+ +T L  +    F Y L NGT+G Y    R WRIKSKS    I  F+  ++G+  ++  W  GKV
Sbjct:   26 VELANVFSYSLDQRIMEGCVISAILEPRGLETIVAVS-----VTNKIIIKDKETS-------LNITETIRCIAAAPF---GDGYDCIIIGTDSSVICYDVHNNLTVFRNDVPDGVSCFVYGKLGELDE-AIYCGGNCCIWGFDKTGANTYWTVTGDQVTTMCLSDYDNDGETELVIGSPDFEIRVFKNDLMRTELMETDEITCLAHVANGCFAYSLNNGTIGTYVLKERQWRIKSKSNVSKIFNFE--EEGL--MVVVWKQGKV 269          

HSP 3 Score: 43.1282 bits (100), Expect = 1.261e-87
Identity = 37/122 (30.33%), Postives = 58/122 (47.54%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGVISQDYIYELNLKKQNLLMELKTYENSTSISQ-HPDASYVMAIPTDTSVNFTMQLVNTQ 1236
            K+D+R   +GEVL +D +   +A          S   + V   DG+V+ +K   A N S      +Q  I E   KK NL+MEL  YE    ++    D  + + + T+ +V F   +VNT+
Sbjct:  268 KVDLRFAHNGEVLSRDSVSSHVASASVSKKGDES--FITVVCLDGKVKGFKIQRAQNGSIDK---TQQLIREFGQKKHNLMMELSNYEQEEQLADVEKDRDFRIPVDTEVAVVF---VVNTE 381          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Zebrafish
Match: bbs2 (Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:259187])

HSP 1 Score: 291.197 bits (744), Expect = 4.248e-162
Identity = 146/325 (44.92%), Postives = 214/325 (65.85%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQY-VAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            +EL   T N+ ++R V+IFAEGIFEGESHVVHP    LS  + V I PPKD+ VDLH+K  VG KT  QFH+FE+ R LP+FSMY   V    P  +PTG V F + +R  R ++W+NQNFLL + I+  S D T     F ++R    L I++ + + ++ + T++I+ AG++VQSL  +L +EDL +  +FP  F  L   ++++D   + HQ++T+ +AD SN I+N +V+AED RLM     M K Y EL  LNR+L+N Y+IR NNH  LL  LK +N  IQ+ G LRVG+ ++QV+ +CR A+K+N++N + ++++ GT
Sbjct:  398 IELNISTPNETIIRAVLIFAEGIFEGESHVVHPSAQNLSGCVRVPIIPPKDIPVDLHIKAFVGGKTSTQFHVFEITRQLPRFSMYDLNVDPSAP--EPTGKVTFCINDRPQRVVMWLNQNFLLPEGID--SPDVT-----FSALRGGGLLRISLQT-SGEITLRTDDIDLAGDLVQSLASFLAIEDLQAESDFPVYFKELRATLTEVDEFHSVHQKLTAAMADHSNYIRNMLVQAEDARLMGDWRNMKKRYIELYDLNRDLVNEYKIRSNNHNALLARLKSVNQAIQRAGRLRVGKPKSQVITACRDAIKNNNINALFKIMRAGT 712          

HSP 2 Score: 261.151 bits (666), Expect = 4.248e-162
Identity = 131/269 (48.70%), Postives = 173/269 (64.31%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAIS-------KDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            L+  +   L   I P  VAIGK++     L AA   GKV + N  + A    +       +D   ++LNINQ++  L  G     S   D + VG+ ++LL YDV +N+DVFYKE+ DG +   +GKLG     + +IGG+C+L  FDY G+++ W+VTGDNV SL + D    G NEL+VGSEDF+IRVF ED+++ EM E ETVT+LC + GS FGY LANGTVGVYDR  R WRIKSK+  + I  FD+N DGV+ELITGWSNGK+
Sbjct:    2 LVPIFTLKLNHKINPRMVAIGKYDGIHPCLTAATQAGKVFIHNPHTRAQRPTAHRLSQSTQDSDISLLNINQSVSCLTAGTLGPKS-TGDTLLVGSQTNLLAYDVHDNTDVFYKEVTDGANAIVLGKLGDIQSPLAIIGGNCALQGFDYEGNDLFWTVTGDNVRSLVLCDFTADGKNELLVGSEDFDIRVFKEDELVTEMAENETVTSLCHMHGSRFGYALANGTVGVYDRTARYWRIKSKNHAMSIHAFDLNADGVVELITGWSNGKI 269          

HSP 3 Score: 63.1586 bits (152), Expect = 4.248e-162
Identity = 41/115 (35.65%), Postives = 65/115 (56.52%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSN-DGEVRIYKKVTAT-NNSYSGGVISQDYIYELNLKKQNLLMELKTY-ENSTSISQHPDASYVMA-IPTDTSV 1206
            KID R   +GEV+FKD+   S+AG+      +  GQ+ L+C++ +GEVR Y   +     +     I QD I EL+ +KQNL++EL+ Y EN+ ++    +    M  IP +T +
Sbjct:  268 KIDARSDRTGEVIFKDNFSSSVAGV-VEGDYRMDGQIQLICTSVEGEVRGYLPASKEMKGNLMDSSIEQDLIRELSQRKQNLMLELRNYEENAKALPGLSEGESKMGVIPANTQL 381          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Zebrafish
Match: bbs2 (Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:259187])

HSP 1 Score: 291.197 bits (744), Expect = 4.248e-162
Identity = 146/325 (44.92%), Postives = 214/325 (65.85%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQY-VAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            +EL   T N+ ++R V+IFAEGIFEGESHVVHP    LS  + V I PPKD+ VDLH+K  VG KT  QFH+FE+ R LP+FSMY   V    P  +PTG V F + +R  R ++W+NQNFLL + I+  S D T     F ++R    L I++ + + ++ + T++I+ AG++VQSL  +L +EDL +  +FP  F  L   ++++D   + HQ++T+ +AD SN I+N +V+AED RLM     M K Y EL  LNR+L+N Y+IR NNH  LL  LK +N  IQ+ G LRVG+ ++QV+ +CR A+K+N++N + ++++ GT
Sbjct:  398 IELNISTPNETIIRAVLIFAEGIFEGESHVVHPSAQNLSGCVRVPIIPPKDIPVDLHIKAFVGGKTSTQFHVFEITRQLPRFSMYDLNVDPSAP--EPTGKVTFCINDRPQRVVMWLNQNFLLPEGID--SPDVT-----FSALRGGGLLRISLQT-SGEITLRTDDIDLAGDLVQSLASFLAIEDLQAESDFPVYFKELRATLTEVDEFHSVHQKLTAAMADHSNYIRNMLVQAEDARLMGDWRNMKKRYIELYDLNRDLVNEYKIRSNNHNALLARLKSVNQAIQRAGRLRVGKPKSQVITACRDAIKNNNINALFKIMRAGT 712          

HSP 2 Score: 261.151 bits (666), Expect = 4.248e-162
Identity = 131/269 (48.70%), Postives = 173/269 (64.31%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAIS-------KDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            L+  +   L   I P  VAIGK++     L AA   GKV + N  + A    +       +D   ++LNINQ++  L  G     S   D + VG+ ++LL YDV +N+DVFYKE+ DG +   +GKLG     + +IGG+C+L  FDY G+++ W+VTGDNV SL + D    G NEL+VGSEDF+IRVF ED+++ EM E ETVT+LC + GS FGY LANGTVGVYDR  R WRIKSK+  + I  FD+N DGV+ELITGWSNGK+
Sbjct:    2 LVPIFTLKLNHKINPRMVAIGKYDGIHPCLTAATQAGKVFIHNPHTRAQRPTAHRLSQSTQDSDISLLNINQSVSCLTAGTLGPKS-TGDTLLVGSQTNLLAYDVHDNTDVFYKEVTDGANAIVLGKLGDIQSPLAIIGGNCALQGFDYEGNDLFWTVTGDNVRSLVLCDFTADGKNELLVGSEDFDIRVFKEDELVTEMAENETVTSLCHMHGSRFGYALANGTVGVYDRTARYWRIKSKNHAMSIHAFDLNADGVVELITGWSNGKI 269          

HSP 3 Score: 63.1586 bits (152), Expect = 4.248e-162
Identity = 41/115 (35.65%), Postives = 65/115 (56.52%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSN-DGEVRIYKKVTAT-NNSYSGGVISQDYIYELNLKKQNLLMELKTY-ENSTSISQHPDASYVMA-IPTDTSV 1206
            KID R   +GEV+FKD+   S+AG+      +  GQ+ L+C++ +GEVR Y   +     +     I QD I EL+ +KQNL++EL+ Y EN+ ++    +    M  IP +T +
Sbjct:  268 KIDARSDRTGEVIFKDNFSSSVAGV-VEGDYRMDGQIQLICTSVEGEVRGYLPASKEMKGNLMDSSIEQDLIRELSQRKQNLMLELRNYEENAKALPGLSEGESKMGVIPANTQL 381          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Zebrafish
Match: bbs2 (Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:259187])

HSP 1 Score: 291.197 bits (744), Expect = 4.248e-162
Identity = 146/325 (44.92%), Postives = 214/325 (65.85%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQY-VAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            +EL   T N+ ++R V+IFAEGIFEGESHVVHP    LS  + V I PPKD+ VDLH+K  VG KT  QFH+FE+ R LP+FSMY   V    P  +PTG V F + +R  R ++W+NQNFLL + I+  S D T     F ++R    L I++ + + ++ + T++I+ AG++VQSL  +L +EDL +  +FP  F  L   ++++D   + HQ++T+ +AD SN I+N +V+AED RLM     M K Y EL  LNR+L+N Y+IR NNH  LL  LK +N  IQ+ G LRVG+ ++QV+ +CR A+K+N++N + ++++ GT
Sbjct:  398 IELNISTPNETIIRAVLIFAEGIFEGESHVVHPSAQNLSGCVRVPIIPPKDIPVDLHIKAFVGGKTSTQFHVFEITRQLPRFSMYDLNVDPSAP--EPTGKVTFCINDRPQRVVMWLNQNFLLPEGID--SPDVT-----FSALRGGGLLRISLQT-SGEITLRTDDIDLAGDLVQSLASFLAIEDLQAESDFPVYFKELRATLTEVDEFHSVHQKLTAAMADHSNYIRNMLVQAEDARLMGDWRNMKKRYIELYDLNRDLVNEYKIRSNNHNALLARLKSVNQAIQRAGRLRVGKPKSQVITACRDAIKNNNINALFKIMRAGT 712          

HSP 2 Score: 261.151 bits (666), Expect = 4.248e-162
Identity = 131/269 (48.70%), Postives = 173/269 (64.31%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAIS-------KDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            L+  +   L   I P  VAIGK++     L AA   GKV + N  + A    +       +D   ++LNINQ++  L  G     S   D + VG+ ++LL YDV +N+DVFYKE+ DG +   +GKLG     + +IGG+C+L  FDY G+++ W+VTGDNV SL + D    G NEL+VGSEDF+IRVF ED+++ EM E ETVT+LC + GS FGY LANGTVGVYDR  R WRIKSK+  + I  FD+N DGV+ELITGWSNGK+
Sbjct:    2 LVPIFTLKLNHKINPRMVAIGKYDGIHPCLTAATQAGKVFIHNPHTRAQRPTAHRLSQSTQDSDISLLNINQSVSCLTAGTLGPKS-TGDTLLVGSQTNLLAYDVHDNTDVFYKEVTDGANAIVLGKLGDIQSPLAIIGGNCALQGFDYEGNDLFWTVTGDNVRSLVLCDFTADGKNELLVGSEDFDIRVFKEDELVTEMAENETVTSLCHMHGSRFGYALANGTVGVYDRTARYWRIKSKNHAMSIHAFDLNADGVVELITGWSNGKI 269          

HSP 3 Score: 63.1586 bits (152), Expect = 4.248e-162
Identity = 41/115 (35.65%), Postives = 65/115 (56.52%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSN-DGEVRIYKKVTAT-NNSYSGGVISQDYIYELNLKKQNLLMELKTY-ENSTSISQHPDASYVMA-IPTDTSV 1206
            KID R   +GEV+FKD+   S+AG+      +  GQ+ L+C++ +GEVR Y   +     +     I QD I EL+ +KQNL++EL+ Y EN+ ++    +    M  IP +T +
Sbjct:  268 KIDARSDRTGEVIFKDNFSSSVAGV-VEGDYRMDGQIQLICTSVEGEVRGYLPASKEMKGNLMDSSIEQDLIRELSQRKQNLMLELRNYEENAKALPGLSEGESKMGVIPANTQL 381          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Xenopus
Match: krt59 (keratin 59 [Source:Xenbase;Acc:XB-GENE-876286])

HSP 1 Score: 320.857 bits (821), Expect = 6.259e-170
Identity = 153/326 (46.93%), Postives = 223/326 (68.40%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKP--TGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            VEL   T+ND ++R V+IFAEGIFEGESHVVHP    LS  + V I PPKDV VDLH+K  VGYK+  QFH+FE+ R LP+FSMY       P   P  + YV F   ERL R +LW+NQNFLL ++ E+++       + F S+R+   L +++ + + ++ + T++++ AG+I+QSL  +L +EDL+   +FP  F+ L  V+ ++D   + HQ++T+D+AD SN+I++ +V+AED RLMR M  M K Y+EL  LNR+LINRY+IRCNNH ELLN LK +N  IQ+ G LRVG+ + QV+ +CR A++ N++N + R+++ G 
Sbjct:  413 VELSISTSNDTIIRAVLIFAEGIFEGESHVVHPSTQHLSGLVRVPISPPKDVPVDLHIKAFVGYKSSVQFHVFELTRQLPRFSMYVL---SNPSSAPETSSYVTFTTSERLQRVVLWLNQNFLLPEDAEIQN---APFQISFTSLRDGGTLLLSMKA-SGEISLRTDDMDLAGDIIQSLASFLAIEDLAVEADFPKYFDQLRKVLVQVDESHSVHQKLTADMADQSNLIRSMLVQAEDARLMRDMKNMKKRYNELYDLNRDLINRYKIRCNNHAELLNNLKCVNQAIQRAGRLRVGKPKVQVITACRDAIRSNNINALFRIMRVGA 731          

HSP 2 Score: 256.529 bits (654), Expect = 6.259e-170
Identity = 130/272 (47.79%), Postives = 176/272 (64.71%), Query Frame = 3
Query:   39 MQLLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAI-------SKDIPSNILNINQTILSLKTGHFN-KLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            + L+  +   L   I P  V++G+++     L AA   GKV + N  S +           S+D   ++LNINQ +  L  G F+ ++ +D   + VGT ++LL YDV NNSD+FYKEI DG +   +G LG     + VIGG+C+L  FD +G+++ W+VTGDNV SLA+ D       EL+VGSEDF+IRVF ED+I+ EM+ETET+T LC + GS FGY L+NGTVGVYDR  R WRIKSK++ + I  FD+N DGV ELITGWSNGK+
Sbjct:   12 IMLVPIFTLKLNHKINPRMVSVGRYDGVHPCLTAATQAGKVFIHNPHSRSQRVSAQRLVQSSQDSDVSLLNINQNVSCLTAGVFDPRVGYDS--LIVGTQTNLLAYDVHNNSDLFYKEIVDGANAVVLGSLGDITSPLAVIGGNCALQGFDCSGNDLFWTVTGDNVRSLALCDFDGDEKKELLVGSEDFDIRVFKEDEIVAEMSETETITALCPMYGSRFGYALSNGTVGVYDRTARYWRIKSKNLAMSIHAFDLNSDGVCELITGWSNGKI 281          

HSP 3 Score: 65.0846 bits (157), Expect = 6.259e-170
Identity = 51/141 (36.17%), Postives = 73/141 (51.77%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGV----ISQDYIYELNLKKQNLLMELKTY-ENS----TSISQHPDASYVMAIPTDTSVNFTMQL---VNTQNKVCFISI 1260
            KID R   +GEV+FKD+   S+AG+    +       L+ CS DGEVR Y     T+   +G +    + Q+ + EL+ KKQNLL+ELK Y ENS    + ISQ      +  IP +T +   + +     TQN    +SI
Sbjct:  280 KIDARSDRTGEVIFKDNFCSSVAGVVEGDYRMDGKTQLICCSIDGEVRGY---LPTSQEAAGSLMDTSVEQELVRELSQKKQNLLLELKNYQENSKQAESRISQSETDGQMGVIPANTQLQTALSVSLGSETQNAHVELSI 417          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Xenopus
Match: krt59 (keratin 59 [Source:Xenbase;Acc:XB-GENE-876286])

HSP 1 Score: 318.161 bits (814), Expect = 2.403e-169
Identity = 152/323 (47.06%), Postives = 222/323 (68.73%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKP--TGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIK 2264
            VEL   T+ND ++R V+IFAEGIFEGESHVVHP    LS  + V I PPKDV VDLH+K  VGYK+  QFH+FE+ R LP+FSMY       P   P  + YV F   ERL R +LW+NQNFLL ++ E+++       + F S+R+   L +++ + + ++ + T++++ AG+I+QSL  +L +EDL+   +FP  F+ L  V+ ++D   + HQ++T+D+AD SN+I++ +V+AED RLMR M  M K Y+EL  LNR+LINRY+IRCNNH ELLN LK +N  IQ+ G LRVG+ + QV+ +CR A++ N++N + R+++
Sbjct:  401 VELSISTSNDTIIRAVLIFAEGIFEGESHVVHPSTQHLSGLVRVPISPPKDVPVDLHIKAFVGYKSSVQFHVFELTRQLPRFSMYVL---SNPSSAPETSSYVTFTTSERLQRVVLWLNQNFLLPEDAEIQN---APFQISFTSLRDGGTLLLSMKA-SGEISLRTDDMDLAGDIIQSLASFLAIEDLAVEADFPKYFDQLRKVLVQVDESHSVHQKLTADMADQSNLIRSMLVQAEDARLMRDMKNMKKRYNELYDLNRDLINRYKIRCNNHAELLNNLKCVNQAIQRAGRLRVGKPKVQVITACRDAIRSNNINALFRIMR 716          

HSP 2 Score: 256.914 bits (655), Expect = 2.403e-169
Identity = 129/266 (48.50%), Postives = 173/266 (65.04%), Query Frame = 3
Query:   57 YKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAI-------SKDIPSNILNINQTILSLKTGHFN-KLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            +   L   I P  V++G+++     L AA   GKV + N  S +           S+D   ++LNINQ +  L  G F+ ++ +D   + VGT ++LL YDV NNSD+FYKEI DG +   +G LG     + VIGG+C+L  FD +G+++ W+VTGDNV SLA+ D       EL+VGSEDF+IRVF ED+I+ EM+ETET+T LC + GS FGY L+NGTVGVYDR  R WRIKSK++ + I  FD+N DGV ELITGWSNGK+
Sbjct:    6 FTLKLNHKINPRMVSVGRYDGVHPCLTAATQAGKVFIHNPHSRSQRVSAQRLVQSSQDSDVSLLNINQNVSCLTAGVFDPRVGYDS--LIVGTQTNLLAYDVHNNSDLFYKEIVDGANAVVLGSLGDITSPLAVIGGNCALQGFDCSGNDLFWTVTGDNVRSLALCDFDGDEKKELLVGSEDFDIRVFKEDEIVAEMSETETITALCPMYGSRFGYALSNGTVGVYDRTARYWRIKSKNLAMSIHAFDLNSDGVCELITGWSNGKI 269          

HSP 3 Score: 65.0846 bits (157), Expect = 2.403e-169
Identity = 51/141 (36.17%), Postives = 73/141 (51.77%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGV----ISQDYIYELNLKKQNLLMELKTY-ENS----TSISQHPDASYVMAIPTDTSVNFTMQL---VNTQNKVCFISI 1260
            KID R   +GEV+FKD+   S+AG+    +       L+ CS DGEVR Y     T+   +G +    + Q+ + EL+ KKQNLL+ELK Y ENS    + ISQ      +  IP +T +   + +     TQN    +SI
Sbjct:  268 KIDARSDRTGEVIFKDNFCSSVAGVVEGDYRMDGKTQLICCSIDGEVRGY---LPTSQEAAGSLMDTSVEQELVRELSQKKQNLLLELKNYQENSKQAESRISQSETDGQMGVIPANTQLQTALSVSLGSETQNAHVELSI 405          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Xenopus
Match: krt59 (keratin 59 [Source:Xenbase;Acc:XB-GENE-876286])

HSP 1 Score: 311.612 bits (797), Expect = 3.331e-167
Identity = 154/352 (43.75%), Postives = 222/352 (63.07%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKP--TGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSK--------------------------TNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            VEL   T+ND ++R V+IFAEGIFEGESHVVHP    LS  + V I PPKDV VDLH+K  VGYK+  QFH+FE+ R LP+FSMY       P   P  + YV F   ERL R +LW+NQNFLL ++ E+++       + F S+R+   L +++ +                             Q+ + T++++ AG+I+QSL  +L +EDL+   +FP  F+ L  V+ ++D   + HQ++T+D+AD SN+I++ +V+AED RLMR M  M K Y+EL  LNR+LINRY+IRCNNH ELLN LK +N  IQ+ G LRVG+ + QV+ +CR A++ N++N + R+++ G 
Sbjct:  401 VELSISTSNDTIIRAVLIFAEGIFEGESHVVHPSTQHLSGLVRVPISPPKDVPVDLHIKAFVGYKSSVQFHVFELTRQLPRFSMYVL---SNPSSAPETSSYVTFTTSERLQRVVLWLNQNFLLPEDAEIQN---APFQISFTSLRDGGTLLLSMKASGEVVLLYKIAQLEKQTLCIILFLTLFLLQISLRTDDMDLAGDIIQSLASFLAIEDLAVEADFPKYFDQLRKVLVQVDESHSVHQKLTADMADQSNLIRSMLVQAEDARLMRDMKNMKKRYNELYDLNRDLINRYKIRCNNHAELLNNLKCVNQAIQRAGRLRVGKPKVQVITACRDAIRSNNINALFRIMRVGA 746          

HSP 2 Score: 256.529 bits (654), Expect = 3.331e-167
Identity = 129/266 (48.50%), Postives = 173/266 (65.04%), Query Frame = 3
Query:   57 YKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAI-------SKDIPSNILNINQTILSLKTGHFN-KLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            +   L   I P  V++G+++     L AA   GKV + N  S +           S+D   ++LNINQ +  L  G F+ ++ +D   + VGT ++LL YDV NNSD+FYKEI DG +   +G LG     + VIGG+C+L  FD +G+++ W+VTGDNV SLA+ D       EL+VGSEDF+IRVF ED+I+ EM+ETET+T LC + GS FGY L+NGTVGVYDR  R WRIKSK++ + I  FD+N DGV ELITGWSNGK+
Sbjct:    6 FTLKLNHKINPRMVSVGRYDGVHPCLTAATQAGKVFIHNPHSRSQRVSAQRLVQSSQDSDVSLLNINQNVSCLTAGVFDPRVGYDS--LIVGTQTNLLAYDVHNNSDLFYKEIVDGANAVVLGSLGDITSPLAVIGGNCALQGFDCSGNDLFWTVTGDNVRSLALCDFDGDEKKELLVGSEDFDIRVFKEDEIVAEMSETETITALCPMYGSRFGYALSNGTVGVYDRTARYWRIKSKNLAMSIHAFDLNSDGVCELITGWSNGKI 269          

HSP 3 Score: 65.0846 bits (157), Expect = 3.331e-167
Identity = 51/141 (36.17%), Postives = 73/141 (51.77%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGV----ISQDYIYELNLKKQNLLMELKTY-ENS----TSISQHPDASYVMAIPTDTSVNFTMQL---VNTQNKVCFISI 1260
            KID R   +GEV+FKD+   S+AG+    +       L+ CS DGEVR Y     T+   +G +    + Q+ + EL+ KKQNLL+ELK Y ENS    + ISQ      +  IP +T +   + +     TQN    +SI
Sbjct:  268 KIDARSDRTGEVIFKDNFCSSVAGVVEGDYRMDGKTQLICCSIDGEVRGY---LPTSQEAAGSLMDTSVEQELVRELSQKKQNLLLELKNYQENSKQAESRISQSETDGQMGVIPANTQLQTALSVSLGSETQNAHVELSI 405          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Xenopus
Match: krt59 (keratin 59 [Source:Xenbase;Acc:XB-GENE-876286])

HSP 1 Score: 311.612 bits (797), Expect = 2.613e-166
Identity = 151/325 (46.46%), Postives = 209/325 (64.31%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKP--TGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTG 2270
            VEL   T+ND ++R V+IFAEGIFEGESHVVHP    LS  + V I PPKDV VDLH+K  VGYK+  QFH+FE+ R LP+FSMY       P   P  + YV F   ERL R +LW+NQNFLL ++I              +S+R                   T++++ AG+I+QSL  +L +EDL+   +FP  F+ L  V+ ++D   + HQ++T+D+AD SN+I++ +V+AED RLMR M  M K Y+EL  LNR+LINRY+IRCNNH ELLN LK +N  IQ+ G LRVG+ + QV+ +CR A++ N++N + R+++ G
Sbjct:  398 VELSISTSNDTIIRAVLIFAEGIFEGESHVVHPSTQHLSGLVRVPISPPKDVPVDLHIKAFVGYKSSVQFHVFELTRQLPRFSMY---VLSNPSSAPETSSYVTFTTSERLQRVVLWLNQNFLLPEDI--------------ISLR-------------------TDDMDLAGDIIQSLASFLAIEDLAVEADFPKYFDQLRKVLVQVDESHSVHQKLTADMADQSNLIRSMLVQAEDARLMRDMKNMKKRYNELYDLNRDLINRYKIRCNNHAELLNNLKCVNQAIQRAGRLRVGKPKVQVITACRDAIRSNNINALFRIMRVG 686          

HSP 2 Score: 251.521 bits (641), Expect = 2.613e-166
Identity = 130/270 (48.15%), Postives = 175/270 (64.81%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADN-------AISKDIPSNILNINQTILSLKTGHFN-KLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            L+  +   L   I P  V++G+++     L AA   GKV + N  S +           S+D   ++LNINQ +  L  G F+ ++ +D   + VGT ++LL YDV NNSD+FYKEI DG +   +G LG     + VIGG+C+L  FD +G+++ W+VTGDNV SLA+ D       EL+VGSEDF+IRVF ED+I+ EM+ETET+T LC + GS FGY L+NGTVGVYDR  R WRIKSK++ + I  FD+N DGV ELITGWSNGK+
Sbjct:    2 LVPIFTLKLNHKINPRMVSVGRYDGVHPCLTAATQAGKVFIHNPHSRSQRVSAQRLVQSSQDSDVSLLNINQNVSCLTAGVFDPRVGYDS--LIVGTQTNLLAYDVHNNSDLFYKEIVDGANAVVLGSLGDITSPLAVIGGNCALQGFDCSGNDLFWTVTGDNVRSLALCDFDGDEKKELLVGSEDFDIRVFKEDEIVAEMSETETITALCPMYGSRFGYALSNGTVGVYDRTARYWRIKSKNLAMSIHAFDLNSDGVCELITGWSNGKI 269          

HSP 3 Score: 67.0106 bits (162), Expect = 2.613e-166
Identity = 52/138 (37.68%), Postives = 73/138 (52.90%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGV----ISQDYIYELNLKKQNLLMELKTY-ENSTS-ISQHPDASYVMAIPTDTSVNFTMQL---VNTQNKVCFISI 1260
            KID R   +GEV+FKD+   S+AG+    +       L+ CS DGEVR Y     T+   +G +    + Q+ + EL+ KKQNLL+ELK Y ENS S ISQ      +  IP +T +   + +     TQN    +SI
Sbjct:  268 KIDARSDRTGEVIFKDNFCSSVAGVVEGDYRMDGKTQLICCSIDGEVRGY---LPTSQEAAGSLMDTSVEQELVRELSQKKQNLLLELKNYQENSKSRISQSETDGQMGVIPANTQLQTALSVSLGSETQNAHVELSI 402          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Xenopus
Match: krt59 (keratin 59 [Source:Xenbase;Acc:XB-GENE-876286])

HSP 1 Score: 319.701 bits (818), Expect = 1.879e-164
Identity = 153/326 (46.93%), Postives = 223/326 (68.40%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKP--TGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            VEL   T+ND ++R V+IFAEGIFEGESHVVHP    LS  + V I PPKDV VDLH+K  VGYK+  QFH+FE+ R LP+FSMY       P   P  + YV F   ERL R +LW+NQNFLL ++ E+++       + F S+R+   L +++ + + ++ + T++++ AG+I+QSL  +L +EDL+   +FP  F+ L  V+ ++D   + HQ++T+D+AD SN+I++ +V+AED RLMR M  M K Y+EL  LNR+LINRY+IRCNNH ELLN LK +N  IQ+ G LRVG+ + QV+ +CR A++ N++N + R+++ G 
Sbjct:  378 VELSISTSNDTIIRAVLIFAEGIFEGESHVVHPSTQHLSGLVRVPISPPKDVPVDLHIKAFVGYKSSVQFHVFELTRQLPRFSMYVL---SNPSSAPETSSYVTFTTSERLQRVVLWLNQNFLLPEDAEIQN---APFQISFTSLRDGGTLLLSMKA-SGEISLRTDDMDLAGDIIQSLASFLAIEDLAVEADFPKYFDQLRKVLVQVDESHSVHQKLTADMADQSNLIRSMLVQAEDARLMRDMKNMKKRYNELYDLNRDLINRYKIRCNNHAELLNNLKCVNQAIQRAGRLRVGKPKVQVITACRDAIRSNNINALFRIMRVGA 696          

HSP 2 Score: 241.506 bits (615), Expect = 1.879e-164
Identity = 115/210 (54.76%), Postives = 151/210 (71.90%), Query Frame = 3
Query:  204 KDIPSNILNINQTILSLKTGHFN-KLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            +D   ++LNINQ +  L  G F+ ++ +D   + VGT ++LL YDV NNSD+FYKEI DG +   +G LG     + VIGG+C+L  FD +G+++ W+VTGDNV SLA+ D       EL+VGSEDF+IRVF ED+I+ EM+ETET+T LC + GS FGY L+NGTVGVYDR  R WRIKSK++ + I  FD+N DGV ELITGWSNGK+
Sbjct:   42 QDSDVSLLNINQNVSCLTAGVFDPRVGYDS--LIVGTQTNLLAYDVHNNSDLFYKEIVDGANAVVLGSLGDITSPLAVIGGNCALQGFDCSGNDLFWTVTGDNVRSLALCDFDGDEKKELLVGSEDFDIRVFKEDEIVAEMSETETITALCPMYGSRFGYALSNGTVGVYDRTARYWRIKSKNLAMSIHAFDLNSDGVCELITGWSNGKI 249          

HSP 3 Score: 62.3882 bits (150), Expect = 1.879e-164
Identity = 49/138 (35.51%), Postives = 72/138 (52.17%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGV----ISQDYIYELNLKKQNLLMELKTY-ENSTSISQHPDASYVMA-IPTDTSVNFTMQL---VNTQNKVCFISI 1260
            KID R   +GEV+FKD+   S+AG+    +       L+ CS DGEVR Y     T+   +G +    + Q+ + EL+ KKQNLL+ELK Y ENS + +   +    M  IP +T +   + +     TQN    +SI
Sbjct:  248 KIDARSDRTGEVIFKDNFCSSVAGVVEGDYRMDGKTQLICCSIDGEVRGY---LPTSQEAAGSLMDTSVEQELVRELSQKKQNLLLELKNYQENSKNYTGGSETDGQMGVIPANTQLQTALSVSLGSETQNAHVELSI 382          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Mouse
Match: Bbs2 (Bardet-Biedl syndrome 2 (human) [Source:MGI Symbol;Acc:MGI:2135267])

HSP 1 Score: 314.309 bits (804), Expect = 1.221e-95
Identity = 147/324 (45.37%), Postives = 219/324 (67.59%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
             EL   T+ND ++R V+IFAEGIF GESHVVHP IH LS+ L V I PPKDV VDLH+K  VGY++  QFH+FE+ R LP+F+MY   +      +P  YV F V ER  R + W+NQNFLL ++  +++   +   + F S+R   +L I +  ++ ++ V+T++I+ AG+I+QS+  +  +EDL    +FP  F  L  V+ K+D   + HQ++++D+AD+SN+I++ +VRAED RLMR M  M   Y EL  LN++L+N Y+IRCNNH ELL  LK +N  IQ+ G LRVG+ + QV+++CR A++ N++N + R+++ GT
Sbjct:  400 AELGISTSNDTIIRAVLIFAEGIFVGESHVVHPSIHNLSSSLRVPITPPKDVPVDLHLKTFVGYRSSTQFHVFELTRQLPRFTMYALTSP-DAASEPVSYVNFSVAERTQRMVTWLNQNFLLPEDSNVQN---SPFHVCFTSLRNGGQLYIKMK-QSGEITVNTDDIDLAGDIIQSIASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADNSNLIRSLLVRAEDARLMRDMKTMKSRYMELYDLNKDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVISACRDAIRSNNINTLFRIMRVGT 718          

HSP 2 Score: 261.922 bits (668), Expect = 2.445e-82
Identity = 134/272 (49.26%), Postives = 180/272 (66.18%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWS---------VADNAISKDIPSNILNINQTILSLKTGHFN-KLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            LL  +   L+  I P  VAIG+++ +   L AA   GKV + N  +         V  + +  D+  ++LNINQT+  L +G  N +L +D   + VGT +SLL YD+ NNSD+FY+E++DG +   +G LG     + +IGG+C+L  FD+ G+++ W+VTGDNV SLA+ D    G  EL+VGSEDF+IRVF ED+I+ EMTETE VT+LC + GS FGY L+NGTVGVYD+  R WRIKSK+  + I  FDIN DGV ELITGWSNGKV
Sbjct:    2 LLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQAGKVFIHNPHTRSQHFSASRVFQSPLESDV--SLLNINQTVSCLGSGVLNPELGYDT--LLVGTQTSLLAYDIYNNSDLFYREVSDGANAIVLGTLGDIAPPLAIIGGNCALQGFDHEGNDLFWTVTGDNVHSLALCDFDGDGKTELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTARYWRIKSKNHAMSIHAFDINSDGVCELITGWSNGKV 269          

HSP 3 Score: 65.4698 bits (158), Expect = 2.445e-82
Identity = 38/92 (41.30%), Postives = 53/92 (57.61%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTAT-NNSYSGGVISQDYIYELNLKKQNLLMELKTYENST 1146
            K+D R   +GEV+FKD+   ++AG+    +       L+ CS DGE+R Y   TA    +     + QD I EL+ KKQNLL+EL+ YE ST
Sbjct:  268 KVDARSDRTGEVIFKDNFSSAVAGVVEGDYRMDGHVQLICCSVDGEIRGYLPGTAEMKGNLLDTSVEQDLIRELSQKKQNLLLELRNYEEST 359          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. UniProt/SwissProt
Match: sp|Q98SP7|BBS2_DANRE (Bardet-Biedl syndrome 2 protein homolog OS=Danio rerio OX=7955 GN=bbs2 PE=2 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 2.619e-161
Identity = 146/325 (44.92%), Postives = 214/325 (65.85%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQY-VAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            +EL   T N+ ++R V+IFAEGIFEGESHVVHP    LS  + V I PPKD+ VDLH+K  VG KT  QFH+FE+ R LP+FSMY   V    P  +PTG V F + +R  R ++W+NQNFLL + I+  S D T     F ++R    L I++ + + ++ + T++I+ AG++VQSL  +L +EDL +  +FP  F  L   ++++D   + HQ++T+ +AD SN I+N +V+AED RLM     M K Y EL  LNR+L+N Y+IR NNH  LL  LK +N  IQ+ G LRVG+ ++QV+ +CR A+K+N++N + ++++ GT
Sbjct:  398 IELNISTPNETIIRAVLIFAEGIFEGESHVVHPSAQNLSGCVRVPIIPPKDIPVDLHIKAFVGGKTSTQFHVFEITRQLPRFSMYDLNVDPSAP--EPTGKVTFCINDRPQRVVMWLNQNFLLPEGID--SPDVT-----FSALRGGGLLRISLQT-SGEITLRTDDIDLAGDLVQSLASFLAIEDLQAESDFPVYFKELRATLTEVDEFHSVHQKLTAAMADHSNYIRNMLVQAEDARLMGDWRNMKKRYIELYDLNRDLVNEYKIRSNNHNALLARLKSVNQAIQRAGRLRVGKPKSQVITACRDAIKNNNINALFKIMRAGT 712          

HSP 2 Score: 261.151 bits (666), Expect = 2.619e-161
Identity = 131/269 (48.70%), Postives = 173/269 (64.31%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAIS-------KDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            L+  +   L   I P  VAIGK++     L AA   GKV + N  + A    +       +D   ++LNINQ++  L  G     S   D + VG+ ++LL YDV +N+DVFYKE+ DG +   +GKLG     + +IGG+C+L  FDY G+++ W+VTGDNV SL + D    G NEL+VGSEDF+IRVF ED+++ EM E ETVT+LC + GS FGY LANGTVGVYDR  R WRIKSK+  + I  FD+N DGV+ELITGWSNGK+
Sbjct:    2 LVPIFTLKLNHKINPRMVAIGKYDGIHPCLTAATQAGKVFIHNPHTRAQRPTAHRLSQSTQDSDISLLNINQSVSCLTAGTLGPKS-TGDTLLVGSQTNLLAYDVHDNTDVFYKEVTDGANAIVLGKLGDIQSPLAIIGGNCALQGFDYEGNDLFWTVTGDNVRSLVLCDFTADGKNELLVGSEDFDIRVFKEDELVTEMAENETVTSLCHMHGSRFGYALANGTVGVYDRTARYWRIKSKNHAMSIHAFDLNADGVVELITGWSNGKI 269          

HSP 3 Score: 63.1586 bits (152), Expect = 2.619e-161
Identity = 41/115 (35.65%), Postives = 65/115 (56.52%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSN-DGEVRIYKKVTAT-NNSYSGGVISQDYIYELNLKKQNLLMELKTY-ENSTSISQHPDASYVMA-IPTDTSV 1206
            KID R   +GEV+FKD+   S+AG+      +  GQ+ L+C++ +GEVR Y   +     +     I QD I EL+ +KQNL++EL+ Y EN+ ++    +    M  IP +T +
Sbjct:  268 KIDARSDRTGEVIFKDNFSSSVAGV-VEGDYRMDGQIQLICTSVEGEVRGYLPASKEMKGNLMDSSIEQDLIRELSQRKQNLMLELRNYEENAKALPGLSEGESKMGVIPANTQL 381          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. UniProt/SwissProt
Match: sp|Q9CWF6|BBS2_MOUSE (Bardet-Biedl syndrome 2 protein homolog OS=Mus musculus OX=10090 GN=Bbs2 PE=1 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 8.544e-95
Identity = 147/324 (45.37%), Postives = 219/324 (67.59%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
             EL   T+ND ++R V+IFAEGIF GESHVVHP IH LS+ L V I PPKDV VDLH+K  VGY++  QFH+FE+ R LP+F+MY   +      +P  YV F V ER  R + W+NQNFLL ++  +++   +   + F S+R   +L I +  ++ ++ V+T++I+ AG+I+QS+  +  +EDL    +FP  F  L  V+ K+D   + HQ++++D+AD+SN+I++ +VRAED RLMR M  M   Y EL  LN++L+N Y+IRCNNH ELL  LK +N  IQ+ G LRVG+ + QV+++CR A++ N++N + R+++ GT
Sbjct:  400 AELGISTSNDTIIRAVLIFAEGIFVGESHVVHPSIHNLSSSLRVPITPPKDVPVDLHLKTFVGYRSSTQFHVFELTRQLPRFTMYALTSP-DAASEPVSYVNFSVAERTQRMVTWLNQNFLLPEDSNVQN---SPFHVCFTSLRNGGQLYIKMK-QSGEITVNTDDIDLAGDIIQSIASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADNSNLIRSLLVRAEDARLMRDMKTMKSRYMELYDLNKDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVISACRDAIRSNNINTLFRIMRVGT 718          

HSP 2 Score: 261.922 bits (668), Expect = 1.487e-81
Identity = 134/272 (49.26%), Postives = 180/272 (66.18%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWS---------VADNAISKDIPSNILNINQTILSLKTGHFN-KLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            LL  +   L+  I P  VAIG+++ +   L AA   GKV + N  +         V  + +  D+  ++LNINQT+  L +G  N +L +D   + VGT +SLL YD+ NNSD+FY+E++DG +   +G LG     + +IGG+C+L  FD+ G+++ W+VTGDNV SLA+ D    G  EL+VGSEDF+IRVF ED+I+ EMTETE VT+LC + GS FGY L+NGTVGVYD+  R WRIKSK+  + I  FDIN DGV ELITGWSNGKV
Sbjct:    2 LLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQAGKVFIHNPHTRSQHFSASRVFQSPLESDV--SLLNINQTVSCLGSGVLNPELGYDT--LLVGTQTSLLAYDIYNNSDLFYREVSDGANAIVLGTLGDIAPPLAIIGGNCALQGFDHEGNDLFWTVTGDNVHSLALCDFDGDGKTELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTARYWRIKSKNHAMSIHAFDINSDGVCELITGWSNGKV 269          

HSP 3 Score: 65.4698 bits (158), Expect = 1.487e-81
Identity = 38/92 (41.30%), Postives = 53/92 (57.61%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTAT-NNSYSGGVISQDYIYELNLKKQNLLMELKTYENST 1146
            K+D R   +GEV+FKD+   ++AG+    +       L+ CS DGE+R Y   TA    +     + QD I EL+ KKQNLL+EL+ YE ST
Sbjct:  268 KVDARSDRTGEVIFKDNFSSAVAGVVEGDYRMDGHVQLICCSVDGEIRGYLPGTAEMKGNLLDTSVEQDLIRELSQKKQNLLLELRNYEEST 359          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. UniProt/SwissProt
Match: sp|Q9BXC9|BBS2_HUMAN (Bardet-Biedl syndrome 2 protein OS=Homo sapiens OX=9606 GN=BBS2 PE=1 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 1.415e-92
Identity = 144/324 (44.44%), Postives = 213/324 (65.74%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
             EL   T+ND ++R V+IFAEGIF GESHVVHP IH LS+ + + I PPKDV VDLH+K  VGY++  QFH+FE  R LP+FSMY   +   P  +P  YV F + ER  R ++W+ QNFLL ++  +++       + F S+R    L I I   + ++ ++T++I+ AG+I+QS+  +  +EDL    +FP  F  L  V+ K+D   + HQ++++D+AD SN+I++ +V AED RLMR M  M   Y EL  LNR+L+N Y+IRCNNH ELL  LK +N  IQ+ G LRVG+ + QV+ +CR A++ N++N + ++++ GT
Sbjct:  400 TELRISTSNDTIIRAVLIFAEGIFTGESHVVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSL-DPASEPISYVNFTIAERAQRVVVWLGQNFLLPEDTHIQN---APFQVCFTSLRNGGHLHIKIK-LSGEITINTDDIDLAGDIIQSMASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADHSNLIRSLLVGAEDARLMRDMKTMKSRYMELYDLNRDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVITACRDAIRSNNINTLFKIMRVGT 718          

HSP 2 Score: 256.914 bits (655), Expect = 5.866e-79
Identity = 132/272 (48.53%), Postives = 178/272 (65.44%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWS---------VADNAISKDIPSNILNINQTILSLKTGHFN-KLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            LL  +   L+  I P  VAIG+++ +   L AA   GKV + N  +         V  + +  D+  ++LNINQ +  L  G  N +L +D   + VGT ++LL YDV NNSD+FY+E+ADG +   +G LG     + +IGG+C+L  F++ G ++ W+VTGDNV SLA+ D    G  EL+VGSEDF+IRVF ED+I+ EMTETE VT+LC + GS FGY L+NGTVGVYD+ +R WRIKSK+  + I  FD+N DGV ELITGWSNGKV
Sbjct:    2 LLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDV--SLLNINQAVSCLTAGVLNPELGYDA--LLVGTQTNLLAYDVYNNSDLFYREVADGANAIVLGTLGDISSPLAIIGGNCALQGFNHEGSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKV 269          

HSP 3 Score: 61.6178 bits (148), Expect = 5.866e-79
Identity = 38/92 (41.30%), Postives = 52/92 (56.52%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGVI----SQDYIYELNLKKQNLLMELKTYE 1137
            K+D R   +GEV+FKD+   +IAG+    +       L+ CS DGE+R Y   TA      G ++     QD I EL+ KKQNLL+EL+ YE
Sbjct:  268 KVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDGHIQLICCSVDGEIRGYLPGTA---EMRGNLMDTSAEQDLIRELSQKKQNLLLELRNYE 356          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. UniProt/SwissProt
Match: sp|Q99MH9|BBS2_RAT (Bardet-Biedl syndrome 2 protein homolog OS=Rattus norvegicus OX=10116 GN=Bbs2 PE=2 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 3.285e-92
Identity = 144/324 (44.44%), Postives = 217/324 (66.98%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
             EL   T+ND ++R V+IFAEGIF GESHVVHP  H LS+ + V I PPKDV VDLH+K  VGY++  QFH+FE+IR LP+F+MY   +      +P  +V F V ER  R + W+NQNFLL ++  +++       + F S+R   +L I +   + ++ V+T++I+ AG+I+QS+  +  +EDL    +FP  F  L  V+ K+D   + HQ++++++AD+SN+I++ +VRAED RLMR M  M   Y EL  LN++L+N Y+IRCNNH ELL  LK +N  IQ+ G LRVG+ + QV+++CR A++ N++N + R+++ GT
Sbjct:  400 AELRISTSNDTIIRAVLIFAEGIFAGESHVVHPSTHNLSSSIRVPITPPKDVPVDLHLKTFVGYRSSTQFHVFELIRQLPRFTMYALTSP-DAASEPVSFVNFIVVERAQRMVTWLNQNFLLPEDSNIQN---APFHVCFTSLRNGGQLYIKMK-PSGEITVNTDDIDLAGDIIQSMASFFAIEDLQVEADFPVYFEELRKVLLKVDEYHSVHQKLSANMADNSNLIRSLLVRAEDARLMRDMKTMKTRYMELYDLNKDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVISACRDAIRSNNINTLFRIMRVGT 718          

HSP 2 Score: 263.077 bits (671), Expect = 1.266e-80
Identity = 135/272 (49.63%), Postives = 179/272 (65.81%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTN---------LWSVADNAISKDIPSNILNINQTILSLKTGHFN-KLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            LL  +   L+  I P  VAIG+++ +   L AA   GKV + N            V  + +  D+  ++LNINQT+  L  G  N +L +D   + VGT +SLL YD+ NNSD+FY+E+ADG +   +G LG     + +IGG+C+L  FD+ G+++ W+VTGDNV SLA+ D    G +EL+VGSEDF+IRVF ED+I+ EMTETE VT+LC + GS FGY L+NGTVGVYD+  R WRIKSK+  + I  FDIN DGV ELITGWSNGKV
Sbjct:    2 LLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQAGKVFIHNPHMRSQHFSTSRVFQSPLESDV--SLLNINQTVSCLGAGVLNPELGYDT--LLVGTQTSLLAYDIYNNSDLFYREVADGANALVLGTLGDIAPPLAIIGGNCALQGFDHEGNDLFWTVTGDNVHSLALCDFDGDGKSELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTARYWRIKSKNHAMSIHAFDINSDGVCELITGWSNGKV 269          

HSP 3 Score: 61.2326 bits (147), Expect = 1.266e-80
Identity = 36/92 (39.13%), Postives = 52/92 (56.52%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTAT-NNSYSGGVISQDYIYELNLKKQNLLMELKTYENST 1146
            K+D R   +GEV+FKD+   ++AG+    +       L+ CS DGE+R Y   TA    +     + Q  I EL+ KKQNLL+EL+ YE +T
Sbjct:  268 KVDARSDRTGEVIFKDNFSSAVAGVVEGDYRMDGHVQLICCSVDGEIRGYLPGTAEMKGNLLDTSVEQGLIRELSQKKQNLLLELRNYEENT 359          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. UniProt/SwissProt
Match: sp|Q19640|BBS2_CAEEL (Bardet-Biedl syndrome 2 protein homolog OS=Caenorhabditis elegans OX=6239 GN=bbs-2 PE=2 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 1.320e-86
Identity = 98/334 (29.34%), Postives = 174/334 (52.10%), Query Frame = 3
Query: 1296 QGVELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTR----LPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAE--GQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIE--LEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            Q + L  E ++++ +R V+IFAEG+FEGES++  PP ++  +R    +P+ I   KD   DLH KV +G    N+  + E  R LPKF  +  + E   + F  PT Y+QF +  R  +   WV ++F ++  + ++  D+ E   +F+ +R   E  L   I+       +  + IE  G IVQS   +  ++++ SV +FP  F   ++++ +ID +     R+T+++ +    +K  I+RAED   + ++P   K Y  L   +       ++R NN +  +  L+ +N  I+    LRVG    Q+V SCR A+ D++   I ++++ G 
Sbjct:  383 QLLSLRVEASHNIPIRGVLIFAEGLFEGESYIWIPP-NEYQSRSVIDIPLVID--KDSTNDLHTKVFLGQVDSNKLMVMENTRILPKFCRFTLLREEYSKFFYMPTAYIQFDINSRAAKLSEWVQESFTIDASL-VEMFDEPEGEFKFMGLRPKHEKSLMFKISHSEKTCKIYHDKIETMGAIVQSYASFYQIQNMESVAHFPDVFKEADEILEEIDPMTEVRDRLTAELQERQAAVKEIIIRAEDSIAIDNIPDARKFYIRLKANDAAARQAAQLRWNNQERCVKSLRRLNKIIENCSRLRVGEPGRQIVVSCRSAIADDNKQIITKILQYGA 712          

HSP 2 Score: 155.221 bits (391), Expect = 1.320e-86
Identity = 97/264 (36.74%), Postives = 138/264 (52.27%), Query Frame = 3
Query:   39 MQLLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAISKDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            ++L + + ++L Q I+ G V            + A++     VTN   + D   S       LNI +TI  +    F       D I +GT SS++ YDV NN  VF  ++ DGVSC   GKLG+ D+  +  GG+C +  FD  G    W+VTGD VT++ + D  N G  EL++GS DFEIRVF  D +  E+ ET+ +T L  +    F Y L NGT+G Y    R WRIKSKS    I  F+  ++G+  ++  W  GKV
Sbjct:   26 VELANVFSYSLDQRIMEGCVISAILEPRGLETIVAVS-----VTNKIIIKDKETS-------LNITETIRCIAAAPF---GDGYDCIIIGTDSSVICYDVHNNLTVFRNDVPDGVSCFVYGKLGELDE-AIYCGGNCCIWGFDKTGANTYWTVTGDQVTTMCLSDYDNDGETELVIGSPDFEIRVFKNDLMRTELMETDEITCLAHVANGCFAYSLNNGTIGTYVLKERQWRIKSKSNVSKIFNFE--EEGL--MVVVWKQGKV 269          

HSP 3 Score: 43.1282 bits (100), Expect = 1.320e-86
Identity = 37/122 (30.33%), Postives = 58/122 (47.54%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGVISQDYIYELNLKKQNLLMELKTYENSTSISQ-HPDASYVMAIPTDTSVNFTMQLVNTQ 1236
            K+D+R   +GEVL +D +   +A          S   + V   DG+V+ +K   A N S      +Q  I E   KK NL+MEL  YE    ++    D  + + + T+ +V F   +VNT+
Sbjct:  268 KVDLRFAHNGEVLSRDSVSSHVASASVSKKGDES--FITVVCLDGKVKGFKIQRAQNGSIDK---TQQLIREFGQKKHNLMMELSNYEQEEQLADVEKDRDFRIPVDTEVAVVF---VVNTE 381          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. TrEMBL
Match: A0A3M6UAY8 (Bardet-Biedl syndrome 2 protein homolog OS=Pocillopora damicornis OX=46731 GN=pdam_00003138 PE=4 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 2.738e-168
Identity = 152/330 (46.06%), Postives = 223/330 (67.58%), Query Frame = 3
Query: 1284 QKIQQGVELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            +++Q  V+L   T N+ ++R VMIFAEG+FEGESHVVHP    L + L V + PPKD+ VDLH+K  VG K+ N FH+FE+ R LP+F++Y    +G  + +P     F + ER++R ++W+NQNFLL  EIE K  D   L + F+S+R    L I ++   N V V T++++ AG+I+Q+L  +L +EDL +   FP     L  V+ K+D + A  Q++T+++AD SN+I++ +VRAED RLM  M  M K Y EL  LNR+LIN Y+IRCNNH ELL+ LK +N  IQ+ G LRVG+ ++QV+A CRQA+K+N++N + ++IK G+
Sbjct:  390 EQVQPHVQLSISTTNETIIRTVMIFAEGVFEGESHVVHPSQQNLKSSLQVPVFPPKDIPVDLHIKAFVGQKSSNHFHVFELTRQLPRFTLYIPCPDG--YAEPKSSCCFHINERVNRAVMWLNQNFLLPDEIESKDGD---LDIMFLSLRTGNPLAIKMDQSGN-VSVKTDDMDLAGDIIQALATFLGIEDLQTAAEFPEHLEELRAVLLKVDELHAVRQKLTAEMADHSNLIRSLVVRAEDARLMGDMKNMRKGYMELYDLNRDLINGYKIRCNNHTELLSCLKLVNQAIQRAGKLRVGKAKSQVIAGCRQAIKNNNVNGLFKIIKAGS 713          

HSP 2 Score: 261.151 bits (666), Expect = 2.738e-168
Identity = 131/266 (49.25%), Postives = 175/266 (65.79%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSV---ADNAI-SKDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            L+  +   L   I P   A+G+++     L A  T GKV + N  S       AI S D   +ILNINQ + ++  G  N  +   D + VGT ++ L YDVENNSD+FYK+IADG +    G+LG  ++ + ++GG+CS+  FD+ G++  W+VTGDNV SLA+ D  + G  EL+VGSEDF+IRVF ED+II EMTETE+VT+LC + GS FGY L NGTVGVYD+  R WRIKSK+  + I  FD++ DGV ELITGWSNGK+
Sbjct:    2 LVPIFTLKLGHKIHPRTAALGRYDGRHPCLTAGTTAGKVFIHNPHSGTLQGGRAIASHDTDISILNINQQVSAVAAGPLN--TSGCDTLLVGTPTNFLAYDVENNSDLFYKDIADGANAIVTGRLGSFENPLAIVGGNCSIQGFDFEGNDEFWTVTGDNVCSLAMCDFNSDGLAELLVGSEDFDIRVFKEDEIIAEMTETESVTSLCPIRGSRFGYALGNGTVGVYDKTARYWRIKSKNQAITIHSFDLDSDGVPELITGWSNGKI 265          

HSP 3 Score: 66.2402 bits (160), Expect = 2.738e-168
Identity = 46/125 (36.80%), Postives = 65/125 (52.00%), Query Frame = 1
Query:  871 SKIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGV-ISQDYIYELNLKKQNLLMELKTYENSTSI----SQHPDASYVMAIPTDTSVNFTMQLVN 1230
             KID R   +GEV+FKD+   +IAGI    +       L+ CS +GEVR Y   +A        V + QD + +L  +KQNLL+ELK YE +  +     Q  D S +  IP  T +  ++ LVN
Sbjct:  263 GKIDARSDRTGEVVFKDNFSAAIAGILEGDYRMDGKVELICCSAEGEVRGYLPASAEMKGNLMDVNVEQDALRDLAQRKQNLLLELKNYEENAKVGKVGGQEVDQSQMGVIPASTQLQTSL-LVN 386          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. TrEMBL
Match: A7S9V7 (Bardet-Biedl syndrome 2 protein homolog OS=Nematostella vectensis OX=45351 GN=v1g235159 PE=4 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 4.620e-168
Identity = 150/330 (45.45%), Postives = 225/330 (68.18%), Query Frame = 3
Query: 1284 QKIQQGVELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            +++Q  VEL   T ND ++R  MIFAEG+FEGESHVVHP    + T L V I PPKD+ VDLH+K  VG+K+ +QFH+FE+ R LP+F+MY    EG  + +P   V F + ER++R ++WVNQNFLL +EIE  +KD   L + F+S+R    +   ++   N V++ T++++ AG+++Q++  +L +EDL +   FP     L  ++ K+D + A  Q++T+++AD SN+I++ +VRAED RLM  M  M K Y EL  LNR+L+N Y+IRCNNH ELL+ LK +N  IQ+ G LRVG+ + +VV++CRQA+K N++N + ++IK G 
Sbjct:  377 EQVQPHVELNISTTNDTIIRTAMIFAEGVFEGESHVVHPSSQNVKTSLRVPIYPPKDIQVDLHIKAFVGHKSSSQFHVFELTRQLPRFTMYIPCPEG--YAEPKSAVSFHINERVNRALMWVNQNFLLMEEIE--AKDGC-LDVMFLSLRTGNPVLFRMDQSGN-VVIKTDDMDLAGDLIQAMAGFLGIEDLQTTAEFPAAMEELRAILVKVDELHAIRQKLTAEMADHSNLIRSLVVRAEDARLMGDMKNMRKGYMELYDLNRDLVNGYKIRCNNHSELLSCLKIVNQAIQRAGKLRVGKPKAEVVSACRQAIKTNNVNGLFKIIKAGA 700          

HSP 2 Score: 270.396 bits (690), Expect = 4.620e-168
Identity = 137/266 (51.50%), Postives = 178/266 (66.92%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVA----DNAISKDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            L+  +   L   I P   A+G+++     L  A T GKV + N  + +      + S D   +ILNINQ + ++ TG     S D  ++FVGT +++L YDVENNSD+FYK++ADGV+   VGKLG  D  + + GG+CS+  FD  G++  W+VTGDNV SLA+ D    G+NEL+VGSEDF+IRVF ED+II EMTETE VT+LC L GS FGY L+NGTVGVYDR  R WRIKSK+  + I  FDI+ DGV ELITGWSNGK+
Sbjct:    2 LVPIFTLKLNHKIHPRTAALGRYDGQHPCLTGATTAGKVFIHNPHTTSLKGGRASASTDNDISILNINQQVTAVATGPLTMTSCD--ILFVGTPTNMLAYDVENNSDLFYKDVADGVNAILVGKLGGYDLPLALAGGNCSIQGFDCDGNDEFWTVTGDNVCSLALCDFNGDGHNELLVGSEDFDIRVFKEDEIIAEMTETEAVTSLCPLRGSKFGYALSNGTVGVYDRTARYWRIKSKNHAIAINSFDIDSDGVPELITGWSNGKI 265          

HSP 3 Score: 59.6918 bits (143), Expect = 4.620e-168
Identity = 36/99 (36.36%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  871 SKIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTAT-NNSYSGGVISQDYIYELNLKKQNLLMELKTYENSTSISQHP 1164
             KID R   SGEV+FKD+   +IAG+    +       L+ CS DGEVR Y         +     + QD + +L  +KQNLL+EL+ YE +  +   P
Sbjct:  263 GKIDARSDRSGEVVFKDNFSSAIAGVIEGDYRMDGKMELICCSVDGEVRGYLPAPPEMKGNLMDTNVEQDALRDLAQRKQNLLLELRNYEENAKMGVIP 361          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. TrEMBL
Match: A0A1L8GEJ7 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18024790mg PE=1 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 2.619e-167
Identity = 149/324 (45.99%), Postives = 224/324 (69.14%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            VEL   T+ND ++R V+IFAEGIFEGESHVVHP    LS  + V+I PPKDV VDLH+K  VGYK+  QFH+FE+ R LP+FSMY  ++      +P  +V F   ER+ R +LW+NQNFLL ++ E+++       + F S+R+   L +++ + + ++ + T++++ AG+I+QSL  +L +EDL+   +FP  F+ L  V+ ++D   + HQ++T+D+AD SN+I++ +V+AED RLMR M  M   YSEL  LNR++INRY+IRCNNH ELLN LK +N  IQ+ G LRVG+ + QV+ +CR A++ N++N + R+++ G 
Sbjct:  440 VELSISTSNDTIIRAVLIFAEGIFEGESHVVHPNTPHLSGLVRVSICPPKDVPVDLHIKAFVGYKSSVQFHVFELTRQLPRFSMY-VLSNPSSAPEPASHVTFTTSERVQRVVLWLNQNFLLPEDAEIQN---APFQISFTSLRDGGTLLLSMKA-SGEISLRTDDMDLAGDIIQSLASFLAIEDLAVEADFPKYFDQLRKVLVQVDESHSVHQKLTADMADQSNLIRSMLVQAEDARLMRDMKNMKTHYSELYDLNRDIINRYKIRCNNHTELLNNLKCVNQAIQRAGRLRVGKPKVQVITACRDAIRSNNINALFRIMRVGA 758          

HSP 2 Score: 258.84 bits (660), Expect = 2.619e-167
Identity = 131/271 (48.34%), Postives = 176/271 (64.94%), Query Frame = 3
Query:   39 MQLLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAI-------SKDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            + L+  +   L   I P  V++G+++     L AA   GKV + N  S +  A        S+D   ++LNINQ +  L  G  +  +    LI VGT ++LL YDV NNSD+F+KEI DG +   +G+LG     + +IGG+C+L  FD  G+++ W+VTGDNV SLA+ D    G NEL+VGSEDF+IRVF ED+I+ EM+ETET+T LC + GS FGY L+NGTVGVYDR  R WRIKSK++ + I  FD+N DGV ELITGWSNGK+
Sbjct:   39 IMLVPIFTLKLNHKINPRMVSVGRYDGVHPCLTAATQAGKVFIHNPHSRSQRASTQRLVQSSQDSDVSLLNINQNVSCLTAGVLDPCAGYDSLI-VGTQTNLLAYDVHNNSDLFFKEIVDGANAVVLGRLGDITSPLTLIGGNCALQGFDCNGNDLFWTVTGDNVRSLALCDFDGDGKNELLVGSEDFDIRVFKEDEIVAEMSETETITALCPMYGSRFGYALSNGTVGVYDRTARYWRIKSKNLAMSIHAFDLNSDGVCELITGWSNGKI 308          

HSP 3 Score: 67.781 bits (164), Expect = 2.619e-167
Identity = 51/141 (36.17%), Postives = 74/141 (52.48%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGV----ISQDYIYELNLKKQNLLMELKTY-ENS----TSISQHPDASYVMAIPTDTSVNFTMQL---VNTQNKVCFISI 1260
            KID R   +GEV+FKD+   S+AG+    +       L+ CS DGEVR Y     ++   +GG+    + Q+ + EL+ KKQNLL+ELK Y ENS    + ISQ      +  IP +T +   + +     TQN    +SI
Sbjct:  307 KIDARSDRTGEVIFKDNFSSSVAGVVEGDYRMDGKTQLICCSIDGEVRGY---LPSSQEAAGGLMDTSVEQEMVRELSQKKQNLLLELKNYQENSKQTESRISQGEPDGQMGVIPANTQLQTALSVSLGSETQNAHVELSI 444          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. TrEMBL
Match: A0A5G3L6X2 (Bardet-Biedl syndrome 2 protein homolog OS=Xenopus tropicalis OX=8364 GN=krt59 PE=4 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 5.623e-167
Identity = 153/326 (46.93%), Postives = 223/326 (68.40%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKP--TGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            VEL   T+ND ++R V+IFAEGIFEGESHVVHP    LS  + V I PPKDV VDLH+K  VGYK+  QFH+FE+ R LP+FSMY       P   P  + YV F   ERL R +LW+NQNFLL ++ E+++       + F S+R+   L +++ + + ++ + T++++ AG+I+QSL  +L +EDL+   +FP  F+ L  V+ ++D   + HQ++T+D+AD SN+I++ +V+AED RLMR M  M K Y+EL  LNR+LINRY+IRCNNH ELLN LK +N  IQ+ G LRVG+ + QV+ +CR A++ N++N + R+++ G 
Sbjct:  413 VELSISTSNDTIIRAVLIFAEGIFEGESHVVHPSTQHLSGLVRVPISPPKDVPVDLHIKAFVGYKSSVQFHVFELTRQLPRFSMYVL---SNPSSAPETSSYVTFTTSERLQRVVLWLNQNFLLPEDAEIQN---APFQISFTSLRDGGTLLLSMKA-SGEISLRTDDMDLAGDIIQSLASFLAIEDLAVEADFPKYFDQLRKVLVQVDESHSVHQKLTADMADQSNLIRSMLVQAEDARLMRDMKNMKKRYNELYDLNRDLINRYKIRCNNHAELLNNLKCVNQAIQRAGRLRVGKPKVQVITACRDAIRSNNINALFRIMRVGA 731          

HSP 2 Score: 256.529 bits (654), Expect = 5.623e-167
Identity = 130/272 (47.79%), Postives = 176/272 (64.71%), Query Frame = 3
Query:   39 MQLLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAI-------SKDIPSNILNINQTILSLKTGHFN-KLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            + L+  +   L   I P  V++G+++     L AA   GKV + N  S +           S+D   ++LNINQ +  L  G F+ ++ +D   + VGT ++LL YDV NNSD+FYKEI DG +   +G LG     + VIGG+C+L  FD +G+++ W+VTGDNV SLA+ D       EL+VGSEDF+IRVF ED+I+ EM+ETET+T LC + GS FGY L+NGTVGVYDR  R WRIKSK++ + I  FD+N DGV ELITGWSNGK+
Sbjct:   12 IMLVPIFTLKLNHKINPRMVSVGRYDGVHPCLTAATQAGKVFIHNPHSRSQRVSAQRLVQSSQDSDVSLLNINQNVSCLTAGVFDPRVGYDS--LIVGTQTNLLAYDVHNNSDLFYKEIVDGANAVVLGSLGDITSPLAVIGGNCALQGFDCSGNDLFWTVTGDNVRSLALCDFDGDEKKELLVGSEDFDIRVFKEDEIVAEMSETETITALCPMYGSRFGYALSNGTVGVYDRTARYWRIKSKNLAMSIHAFDLNSDGVCELITGWSNGKI 281          

HSP 3 Score: 65.0846 bits (157), Expect = 5.623e-167
Identity = 51/141 (36.17%), Postives = 73/141 (51.77%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGV----ISQDYIYELNLKKQNLLMELKTY-ENS----TSISQHPDASYVMAIPTDTSVNFTMQL---VNTQNKVCFISI 1260
            KID R   +GEV+FKD+   S+AG+    +       L+ CS DGEVR Y     T+   +G +    + Q+ + EL+ KKQNLL+ELK Y ENS    + ISQ      +  IP +T +   + +     TQN    +SI
Sbjct:  280 KIDARSDRTGEVIFKDNFCSSVAGVVEGDYRMDGKTQLICCSIDGEVRGY---LPTSQEAAGSLMDTSVEQELVRELSQKKQNLLLELKNYQENSKQAESRISQSETDGQMGVIPANTQLQTALSVSLGSETQNAHVELSI 417          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. TrEMBL
Match: A0A2B4RD87 (Bardet-Biedl syndrome 2 protein homolog OS=Stylophora pistillata OX=50429 GN=Bbs2 PE=4 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 9.648e-167
Identity = 148/330 (44.85%), Postives = 222/330 (67.27%), Query Frame = 3
Query: 1284 QKIQQGVELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            +++Q  V+L   T N+ ++R VMIFAEG+FEGESHVVHP    L + L V + PP+D+ VDLH+K  VG K+ N F +FE+ R LP+F++Y    +G  + +P     F + ER++R ++W+NQNFLL  EIE +  D   L + F+S+R    L I ++   N V + T++++ AG+I+Q+L  +L +EDL +   FP     L  V+ K+D + A  Q++T+++AD SN+I++ +VRAED RLM  M  M K Y EL  LNR+LIN Y+IRCNNH ELL+ LK +N  IQ+ G LRVG+ ++QV+A CRQA+K+N++N + ++IK G+
Sbjct:  390 EQVQPHVQLSISTTNETVIRTVMIFAEGVFEGESHVVHPSQQSLKSSLQVPVFPPRDIPVDLHIKAFVGQKSSNHFQVFELTRQLPRFTLYISCPDG--YAEPKSSCSFHINERVNRAVMWLNQNFLLPDEIESRDGD---LDIMFLSLRTGNPLAIKMDQSGN-VSIKTDDMDLAGDIIQALATFLGIEDLQTTAEFPDHLEELRGVLLKVDELHAVRQKLTAEMADHSNLIRSLVVRAEDARLMGDMKNMRKGYMELYDLNRDLINGYKIRCNNHTELLSCLKLVNQAIQRAGKLRVGKAKSQVIAGCRQAIKNNNVNGLFKIIKAGS 713          

HSP 2 Score: 261.151 bits (666), Expect = 9.648e-167
Identity = 133/266 (50.00%), Postives = 175/266 (65.79%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVA---DNAI-SKDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            L+  +   L   I P   A+G+++     L A  T GKV + N  S A     AI S D   +ILNINQ + ++  G  N  S   D + VGT ++ L YDVENNSD+FYK+IADG +    G+LG  ++ + ++GG+CS+  FD+ G++  W+VTGDNV SLA+ D    G  EL+VGSEDF+IRVF ED+II EMTETE+VT+LC + GS FGY L NGTVGVYD+  R WRIKSK+  + I  FD++ DGV ELITGWSNGK+
Sbjct:    2 LVPIFTLKLGHKIHPRTAALGRYDGRHPCLTAGTTAGKVFIHNPHSSALQGGRAIASHDNDISILNINQQVSAVAAGPLN--STGCDTLLVGTPTNFLAYDVENNSDLFYKDIADGANVIVTGRLGSFENPLAIVGGNCSIQGFDFEGNDEFWTVTGDNVCSLAMCDFNGDGLAELLVGSEDFDIRVFKEDEIIAEMTETESVTSLCPIRGSRFGYALGNGTVGVYDKTARYWRIKSKNQAITIHSFDLDSDGVPELITGWSNGKI 265          

HSP 3 Score: 65.0846 bits (157), Expect = 9.648e-167
Identity = 45/125 (36.00%), Postives = 65/125 (52.00%), Query Frame = 1
Query:  871 SKIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGV-ISQDYIYELNLKKQNLLMELKTYENSTSI----SQHPDASYVMAIPTDTSVNFTMQLVN 1230
             KID R   +GEV+FKD+   +I GI    +       L+ CS +GEVR Y   +A        V + QD + +L  +KQNLL+ELK YE +  +     Q  D S +  IP +T +  ++ LVN
Sbjct:  263 GKIDARSDRTGEVVFKDNFSAAIGGILEGDYRMDGKVELICCSVEGEVRGYLPASAEMKGNLMDVNVEQDALRDLAQRKQNLLLELKNYEENAKVGKVGGQEVDQSQMGVIPANTQLQTSL-LVN 386          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Cavefish
Match: bbs2 (Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:103030563])

HSP 1 Score: 294.664 bits (753), Expect = 3.514e-162
Identity = 148/324 (45.68%), Postives = 214/324 (66.05%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            +EL   T N+ ++R V+IFAEGIFEGESHVVHP    LS  + V I PPKD+ VDLH+K  VG +T  QFH+FE+ R LP+FSMY    E     +PTG V F + +R  R ++W+NQNFLL + I   S D T     F S+R    L I++ S   +++++T++I+ AG++VQSL  +L +EDL +  NFP+ F  L   ++++D   + HQ++T+ +AD SN I+N +V+AED RLM  +  M K Y EL  LNR+LIN Y+IR NNH  LL  LK +N  IQ+ G LRVG+ + QV+ +CR A+K+N++N + ++++ GT
Sbjct:  398 IELSISTPNETIIRAVLIFAEGIFEGESHVVHPSSQNLSGCVCVPIIPPKDIPVDLHIKAFVGGRTSTQFHVFEITRQLPRFSMYDLHVEPSA-SQPTGRVTFSINDRPQRVVMWLNQNFLLPEGI--NSPDVT-----FTSLRGGGLLTISMRSN-GEIMLNTDDIDLAGDLVQSLASFLAIEDLQAEANFPSYFEELRVTLTEVDEFHSVHQKLTAAMADHSNHIRNMLVQAEDARLMGDLKNMKKRYIELYDLNRDLINEYKIRSNNHNALLACLKAVNQAIQRTGRLRVGKPKNQVITACRDAIKNNNINALFKIMRAGT 712          

HSP 2 Score: 254.218 bits (648), Expect = 3.514e-162
Identity = 127/269 (47.21%), Postives = 171/269 (63.57%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAIS-------KDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            L+  +   L   I P  V +GKF+     L AA   GKV + N  +      S       +D   ++LNINQ +  L  G     +  + L+ VG+ ++LL YDV +N+D+FYKE+ DG +   +G+LG     + +IGG+C+L  FDY G++  W+VTGDNV SL + D    G NEL+VGSEDF+IRVF ED++++EM E ETVT+LC + GS FGY LANGTVGVYDR  R WRIKSK+  + I  FD+N DGV+ELITGWSNGK+
Sbjct:    2 LVPIFTLKLNHKINPRMVTMGKFDGIHPCLTAATQAGKVFIHNPHTRGQRQTSHRLSQSTQDSDISLLNINQAVSCLTAGTLGPNTTGETLL-VGSQTNLLAYDVHDNADIFYKEVTDGANAIVLGRLGDIQSPLAIIGGNCALQGFDYEGNDQFWTVTGDNVRSLVLCDFTGDGKNELLVGSEDFDIRVFREDELLSEMAENETVTSLCYMHGSRFGYALANGTVGVYDRTARYWRIKSKNHAMSIHAFDLNADGVVELITGWSNGKI 269          

HSP 3 Score: 66.6254 bits (161), Expect = 3.514e-162
Identity = 45/119 (37.82%), Postives = 68/119 (57.14%), Query Frame = 1
Query:  871 SKIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSN-DGEVRIYKKVTAT-NNSYSGGVISQDYIYELNLKKQNLLMELKTY-ENSTSISQHPDASYVMA----IPTDTSV 1206
             KID R   +GEV+FKD+   S+AG+      +  GQ+ L+C++ +GEVR Y   +     +     + QD I EL+ +KQNLL+EL+ Y EN+ ++   P AS V A    IP +T +
Sbjct:  267 GKIDARSDRTGEVIFKDNFSSSVAGV-VEGDYRMDGQIQLICTSVEGEVRGYLPASKEMKGNLMDASVEQDLIRELSQRKQNLLLELRNYEENAKAV---PGASEVEAQMGVIPANTQL 381          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Cavefish
Match: bbs2 (Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:103030563])

HSP 1 Score: 251.521 bits (641), Expect = 6.734e-145
Identity = 127/269 (47.21%), Postives = 171/269 (63.57%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAIS-------KDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            L+  +   L   I P  V +GKF+     L AA   GKV + N  +      S       +D   ++LNINQ +  L  G     +  + L+ VG+ ++LL YDV +N+D+FYKE+ DG +   +G+LG     + +IGG+C+L  FDY G++  W+VTGDNV SL + D    G NEL+VGSEDF+IRVF ED++++EM E ETVT+LC + GS FGY LANGTVGVYDR  R WRIKSK+  + I  FD+N DGV+ELITGWSNGK+
Sbjct:    2 LVPIFTLKLNHKINPRMVTMGKFDGIHPCLTAATQAGKVFIHNPHTRGQRQTSHRLSQSTQDSDISLLNINQAVSCLTAGTLGPNTTGETLL-VGSQTNLLAYDVHDNADIFYKEVTDGANAIVLGRLGDIQSPLAIIGGNCALQGFDYEGNDQFWTVTGDNVRSLVLCDFTGDGKNELLVGSEDFDIRVFREDELLSEMAENETVTSLCYMHGSRFGYALANGTVGVYDRTARYWRIKSKNHAMSIHAFDLNADGVVELITGWSNGKI 269          

HSP 2 Score: 239.965 bits (611), Expect = 6.734e-145
Identity = 131/324 (40.43%), Postives = 181/324 (55.86%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            +EL   T N+ ++R V+IFAEGIFEGESHVVHP    LS  + V I PPKD+ VDLH+K  VG +T  QFH+FE+ R LP+FSMY    E     +PTG V F + +R  R ++W+NQNFLL + I   S D T     F S+R    L I++ S                                                 ++D   + HQ++T+ +AD SN I+N +V+AED RLM  +  M K Y EL  LNR+LIN Y+IR NNH  LL  LK +N  IQ+ G LRVG+ + QV+ +CR A+K+N++N + ++++ GT
Sbjct:  398 IELSISTPNETIIRAVLIFAEGIFEGESHVVHPSSQNLSGCVCVPIIPPKDIPVDLHIKAFVGGRTSTQFHVFEITRQLPRFSMYDLHVEPSA-SQPTGRVTFSINDRPQRVVMWLNQNFLLPEGI--NSPDVT-----FTSLRGGGLLTISMRSN-----------------------------------------------GEVDEFHSVHQKLTAAMADHSNHIRNMLVQAEDARLMGDLKNMKKRYIELYDLNRDLINEYKIRSNNHNALLACLKAVNQAIQRTGRLRVGKPKNQVITACRDAIKNNNINALFKIMRAGT 666          

HSP 3 Score: 66.6254 bits (161), Expect = 6.734e-145
Identity = 45/119 (37.82%), Postives = 68/119 (57.14%), Query Frame = 1
Query:  871 SKIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSN-DGEVRIYKKVTAT-NNSYSGGVISQDYIYELNLKKQNLLMELKTY-ENSTSISQHPDASYVMA----IPTDTSV 1206
             KID R   +GEV+FKD+   S+AG+      +  GQ+ L+C++ +GEVR Y   +     +     + QD I EL+ +KQNLL+EL+ Y EN+ ++   P AS V A    IP +T +
Sbjct:  267 GKIDARSDRTGEVIFKDNFSSSVAGV-VEGDYRMDGQIQLICTSVEGEVRGYLPASKEMKGNLMDASVEQDLIRELSQRKQNLLLELRNYEENAKAV---PGASEVEAQMGVIPANTQL 381          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Sea Lamprey
Match: bbs2 (Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:259187])

HSP 1 Score: 306.99 bits (785), Expect = 8.308e-168
Identity = 148/324 (45.68%), Postives = 221/324 (68.21%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            VEL   T+N+ ++R V+IFAEGIFEGESHVVHP ++ LS+ + V + PPKDV VDLH+K +VG+KT  QFH+FE+ R LP+FSMY   +  +    P  YV F V +R+ R ILW+NQNFLL +E E +S   + L + F S R N  L I +   + +V++ T++++ AG+IVQSL  +L +EDL    +FP E   L   + K+D   + HQ++T+++AD SN++++ +V AED RLM  +  M K Y++L  LN++LIN Y+IRCNNH ELL  L+ +N  IQ+ G LR G+ +  V+++CR+A+K N++N + ++I+ GT
Sbjct:  399 VELAISTSNNTVIRAVLIFAEGIFEGESHVVHPSVNSLSSHMRVPMIPPKDVPVDLHIKALVGHKTSMQFHVFELTRQLPRFSMYAMCSPDK-VPDPQSYVSFSVNDRIQRVILWLNQNFLLTEECECES---SFLHVAFESQRGNGPLVITMK-PSGEVLIYTDDMDLAGDIVQSLVAFLAIEDLQVEAHFPAEMEELRLTLIKVDEFHSVHQKLTAEMADHSNMVRSMLVSAEDSRLMGDLKNMKKGYTQLFNLNKDLINGYKIRCNNHNELLGCLRTVNQTIQKAGRLRAGKPKMLVISACREAIKTNNVNALFKIIRAGT 717          

HSP 2 Score: 260.381 bits (664), Expect = 8.308e-168
Identity = 133/268 (49.63%), Postives = 174/268 (64.93%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTN--LWSVADNAISKDIPS----NILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            L+  +   L   I P  V +G ++     L AA   GKV + N    SV     +  + S     +LN+NQ +  +  G  +  S   D++ VGT SSLL YDV NNSD+FYK++ADG +   +G+LG     +V+IGG+C++  FD  G ++ W+VTGDNV SLA+ D    G NEL+VGSEDF+IRVF +D+I+ EMTETET+T+LC L GS FGY LANGTVGVYDR  R WRIKSK+ PV I  FD++ DGV ELITGWSNGK+
Sbjct:    2 LVPIFTLKLGHKINPRMVTLGCYDGKHPCLTAATQAGKVFIHNPHTRSVVSGPRASQVSSESDITLLNVNQAVSCVAAGRLDP-SLSWDVLAVGTHSSLLAYDVHNNSDLFYKDVADGANAVVIGELGSIAAPMVIIGGTCAIQGFDCKGTDLFWTVTGDNVRSLALCDFSGDGKNELLVGSEDFDIRVFKDDEIVAEMTETETITSLCHLQGSRFGYSLANGTVGVYDRTTRYWRIKSKNQPVSIHAFDLDLDGVNELITGWSNGKI 268          

HSP 3 Score: 64.6994 bits (156), Expect = 8.308e-168
Identity = 44/120 (36.67%), Postives = 62/120 (51.67%), Query Frame = 1
Query:  874 KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIY-KKVTATNNSYSGGVISQDYIYELNLKKQNLLMELKTYENSTSISQHPDA----SYVMAIPTDTSVNFTM 1218
            KID R   +GEV+FKD+   S+AGI    +       L+ CS DGEVR Y         S       QD + EL+ +KQNLL+ELK Y  ++  S + +A    S   AIP +T +  ++
Sbjct:  267 KIDARSDRTGEVVFKDNFSSSVAGIVEGDYRMDGKMQLICCSVDGEVRGYLPSSREVRGSLMDSNTEQDLLRELSQRKQNLLLELKNYSENSKASLNVNAGDVESQAGAIPANTQLQTSL 386          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Nematostella
Match: EDO39492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9V7])

HSP 1 Score: 315.464 bits (807), Expect = 9.402e-172
Identity = 150/330 (45.45%), Postives = 225/330 (68.18%), Query Frame = 3
Query: 1284 QKIQQGVELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            +++Q  VEL   T ND ++R  MIFAEG+FEGESHVVHP    + T L V I PPKD+ VDLH+K  VG+K+ +QFH+FE+ R LP+F+MY    EG  + +P   V F + ER++R ++WVNQNFLL +EIE  +KD   L + F+S+R    +   ++   N V++ T++++ AG+++Q++  +L +EDL +   FP     L  ++ K+D + A  Q++T+++AD SN+I++ +VRAED RLM  M  M K Y EL  LNR+L+N Y+IRCNNH ELL+ LK +N  IQ+ G LRVG+ + +VV++CRQA+K N++N + ++IK G 
Sbjct:  377 EQVQPHVELNISTTNDTIIRTAMIFAEGVFEGESHVVHPSSQNVKTSLRVPIYPPKDIQVDLHIKAFVGHKSSSQFHVFELTRQLPRFTMYIPCPEG--YAEPKSAVSFHINERVNRALMWVNQNFLLMEEIE--AKDGC-LDVMFLSLRTGNPVLFRMDQSGN-VVIKTDDMDLAGDLIQAMAGFLGIEDLQTTAEFPAAMEELRAILVKVDELHAIRQKLTAEMADHSNLIRSLVVRAEDARLMGDMKNMRKGYMELYDLNRDLVNGYKIRCNNHSELLSCLKIVNQAIQRAGKLRVGKPKAEVVSACRQAIKTNNVNGLFKIIKAGA 700          

HSP 2 Score: 270.396 bits (690), Expect = 9.402e-172
Identity = 137/266 (51.50%), Postives = 178/266 (66.92%), Query Frame = 3
Query:   45 LLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVA----DNAISKDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            L+  +   L   I P   A+G+++     L  A T GKV + N  + +      + S D   +ILNINQ + ++ TG     S D  ++FVGT +++L YDVENNSD+FYK++ADGV+   VGKLG  D  + + GG+CS+  FD  G++  W+VTGDNV SLA+ D    G+NEL+VGSEDF+IRVF ED+II EMTETE VT+LC L GS FGY L+NGTVGVYDR  R WRIKSK+  + I  FDI+ DGV ELITGWSNGK+
Sbjct:    2 LVPIFTLKLNHKIHPRTAALGRYDGQHPCLTGATTAGKVFIHNPHTTSLKGGRASASTDNDISILNINQQVTAVATGPLTMTSCD--ILFVGTPTNMLAYDVENNSDLFYKDVADGVNAILVGKLGGYDLPLALAGGNCSIQGFDCDGNDEFWTVTGDNVCSLALCDFNGDGHNELLVGSEDFDIRVFKEDEIIAEMTETEAVTSLCPLRGSKFGYALSNGTVGVYDRTARYWRIKSKNHAIAINSFDIDSDGVPELITGWSNGKI 265          

HSP 3 Score: 59.6918 bits (143), Expect = 9.402e-172
Identity = 36/99 (36.36%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  871 SKIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTAT-NNSYSGGVISQDYIYELNLKKQNLLMELKTYENSTSISQHP 1164
             KID R   SGEV+FKD+   +IAG+    +       L+ CS DGEVR Y         +     + QD + +L  +KQNLL+EL+ YE +  +   P
Sbjct:  263 GKIDARSDRSGEVVFKDNFSSAIAGVIEGDYRMDGKMELICCSVDGEVRGYLPAPPEMKGNLMDTNVEQDALRDLAQRKQNLLLELRNYEENAKMGVIP 361          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Medaka
Match: bbs2 (Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:101166472])

HSP 1 Score: 300.056 bits (767), Expect = 1.226e-164
Identity = 148/324 (45.68%), Postives = 212/324 (65.43%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            VEL   T N+ ++R V+IFAEGIFEGESHVVHP    LS  + V I PPKD+ VDLH+K  VG K   QFH+FE+ R LP+FSMYQ +A+      P G V F V ER  R ++W+NQNFLL + +E  +       + F S+R    L  N+ S   Q+ + T++I+ AG++VQSL  +L +EDLS+  +FPT F  L   ++++D   A HQ++T+D+A+ SN I++ +V+AED RLM  M  M K + +L  LNR+LIN Y+IR NNH  L+  LK +N  IQ+ G LRVG+ +  V+++CR A+K N++N + R+++ GT
Sbjct:  395 VELSISTPNETIIRAVLIFAEGIFEGESHVVHPSAQNLSGCVRVPIVPPKDIPVDLHIKAFVGGKCSTQFHVFEITRQLPRFSMYQILADPSA-APPGGRVSFSVNERPQRVVMWLNQNFLLPEGVETPN-------VTFASLRGRGLLSFNMASN-GQITLRTDDIDLAGDVVQSLASFLAMEDLSAEADFPTYFEELRTTLTEVDEFHAVHQKLTADMAEHSNYIRSVLVQAEDARLMGDMTAMKKRHRQLYDLNRDLINEYKIRSNNHNALVACLKSVNQAIQRAGRLRVGKPKNHVISACRDAIKSNNVNALFRIMRGGT 709          

HSP 2 Score: 259.61 bits (662), Expect = 1.226e-164
Identity = 132/269 (49.07%), Postives = 173/269 (64.31%), Query Frame = 3
Query:   57 YKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTN---------LWSVADNAISKDIPSNILNINQTILSLKTGHFNKLSHDK--DLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            +   L   I P  V IGKF+     L AA   GKV + N            +  + +  DI  ++LNINQ +  L  G   KL  D   D +FVG+ ++LL YDV +N+D+FY+E+ DG +   +GKLG     + +IGG+C+L  FD+ G++  W+VTGDNV SL + D    G NEL+VGSEDF+IRVF ED++++EMTE ETVT+LC + GS FGY LANGTVGVYDR  R WRIKSK+  + I  FD+N DGV+ELITGWSNGKV
Sbjct:    6 FTLKLNHKINPRMVTIGKFDGVHPCLTAATQAGKVFIHNPHVRGQKPAAHRLTQSTLDSDI--SLLNINQAVTCLAAG---KLGPDTVGDTLFVGSQTNLLAYDVHDNADIFYREVTDGANAIVLGKLGNIRSPLAIIGGNCALQGFDHDGNDQFWTVTGDNVRSLVLCDFTGDGKNELLVGSEDFDIRVFKEDELVSEMTENETVTSLCHMHGSRFGYALANGTVGVYDRTARYWRIKSKNHAMSIHAFDLNGDGVVELITGWSNGKV 269          

HSP 3 Score: 63.929 bits (154), Expect = 1.226e-164
Identity = 44/115 (38.26%), Postives = 63/115 (54.78%), Query Frame = 1
Query:  871 SKIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVC-SNDGEVRIYKKVTA-TNNSYSGGVISQDYIYELNLKKQNLLMELKTY-ENSTSISQHPDASYVMAIPTDTSV 1206
             K+D R   +GEV+FKD+   ++AG+      +  GQ  L+C S DGEVR Y   +     S       Q+ I EL+ +KQNLL+EL+ Y EN+  +SQ    S V  IP +T +
Sbjct:  267 GKVDARSDRTGEVIFKDNFSSAVAGV-VEGDYRLDGQKELICASTDGEVRGYLPASKDQKGSLMDSSSEQELIRELSQRKQNLLLELRNYEENAKGVSQ--TNSEVGVIPANTQL 378          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Medaka
Match: bbs2 (Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:101166472])

HSP 1 Score: 256.144 bits (653), Expect = 2.055e-146
Identity = 132/269 (49.07%), Postives = 173/269 (64.31%), Query Frame = 3
Query:   57 YKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTN---------LWSVADNAISKDIPSNILNINQTILSLKTGHFNKLSHDK--DLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            +   L   I P  V IGKF+     L AA   GKV + N            +  + +  DI  ++LNINQ +  L  G   KL  D   D +FVG+ ++LL YDV +N+D+FY+E+ DG +   +GKLG     + +IGG+C+L  FD+ G++  W+VTGDNV SL + D    G NEL+VGSEDF+IRVF ED++++EMTE ETVT+LC + GS FGY LANGTVGVYDR  R WRIKSK+  + I  FD+N DGV+ELITGWSNGKV
Sbjct:    6 FTLKLNHKINPRMVTIGKFDGVHPCLTAATQAGKVFIHNPHVRGQKPAAHRLTQSTLDSDI--SLLNINQAVTCLAAG---KLGPDTVGDTLFVGSQTNLLAYDVHDNADIFYREVTDGANAIVLGKLGNIRSPLAIIGGNCALQGFDHDGNDQFWTVTGDNVRSLVLCDFTGDGKNELLVGSEDFDIRVFKEDELVSEMTENETVTSLCHMHGSRFGYALANGTVGVYDRTARYWRIKSKNHAMSIHAFDLNGDGVVELITGWSNGKV 269          

HSP 2 Score: 242.662 bits (618), Expect = 2.055e-146
Identity = 129/324 (39.81%), Postives = 180/324 (55.56%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            VEL   T N+ ++R V+IFAEGIFEGESHVVHP    LS  + V I PPKD+ VDLH+K  VG K   QFH+FE+ R LP+FSMYQ +A+      P G V F V ER  R ++W+NQNFLL + +E  +       + F S+R    L  N+ S                                                 ++D   A HQ++T+D+A+ SN I++ +V+AED RLM  M  M K + +L  LNR+LIN Y+IR NNH  L+  LK +N  IQ+ G LRVG+ +  V+++CR A+K N++N + R+++ GT
Sbjct:  395 VELSISTPNETIIRAVLIFAEGIFEGESHVVHPSAQNLSGCVRVPIVPPKDIPVDLHIKAFVGGKCSTQFHVFEITRQLPRFSMYQILADPSA-APPGGRVSFSVNERPQRVVMWLNQNFLLPEGVETPN-------VTFASLRGRGLLSFNMASN-----------------------------------------------GQVDEFHAVHQKLTADMAEHSNYIRSVLVQAEDARLMGDMTAMKKRHRQLYDLNRDLINEYKIRSNNHNALVACLKSVNQAIQRAGRLRVGKPKNHVISACRDAIKSNNVNALFRIMRGGT 663          

HSP 3 Score: 63.929 bits (154), Expect = 2.055e-146
Identity = 44/115 (38.26%), Postives = 63/115 (54.78%), Query Frame = 1
Query:  871 SKIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVC-SNDGEVRIYKKVTA-TNNSYSGGVISQDYIYELNLKKQNLLMELKTY-ENSTSISQHPDASYVMAIPTDTSV 1206
             K+D R   +GEV+FKD+   ++AG+      +  GQ  L+C S DGEVR Y   +     S       Q+ I EL+ +KQNLL+EL+ Y EN+  +SQ    S V  IP +T +
Sbjct:  267 GKVDARSDRTGEVIFKDNFSSAVAGV-VEGDYRLDGQKELICASTDGEVRGYLPASKDQKGSLMDSSSEQELIRELSQRKQNLLLELRNYEENAKGVSQ--TNSEVGVIPANTQL 378          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Medaka
Match: bbs2 (Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:101166472])

HSP 1 Score: 300.056 bits (767), Expect = 9.082e-91
Identity = 148/324 (45.68%), Postives = 212/324 (65.43%), Query Frame = 3
Query: 1302 VELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGT 2273
            VEL   T N+ ++R V+IFAEGIFEGESHVVHP    LS  + V I PPKD+ VDLH+K  VG K   QFH+FE+ R LP+FSMYQ +A+      P G V F V ER  R ++W+NQNFLL + +E  +       + F S+R    L  N+ S   Q+ + T++I+ AG++VQSL  +L +EDLS+  +FPT F  L   ++++D   A HQ++T+D+A+ SN I++ +V+AED RLM  M  M K + +L  LNR+LIN Y+IR NNH  L+  LK +N  IQ+ G LRVG+ +  V+++CR A+K N++N + R+++ GT
Sbjct:  361 VELSISTPNETIIRAVLIFAEGIFEGESHVVHPSAQNLSGCVRVPIVPPKDIPVDLHIKAFVGGKCSTQFHVFEITRQLPRFSMYQILADPSA-APPGGRVSFSVNERPQRVVMWLNQNFLLPEGVETPN-------VTFASLRGRGLLSFNMASN-GQITLRTDDIDLAGDVVQSLASFLAMEDLSAEADFPTYFEELRTTLTEVDEFHAVHQKLTADMAEHSNYIRSVLVQAEDARLMGDMTAMKKRHRQLYDLNRDLINEYKIRSNNHNALVACLKSVNQAIQRAGRLRVGKPKNHVISACRDAIKSNNVNALFRIMRGGT 675          

HSP 2 Score: 259.996 bits (663), Expect = 6.669e-76
Identity = 132/269 (49.07%), Postives = 173/269 (64.31%), Query Frame = 3
Query:   57 YKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTN---------LWSVADNAISKDIPSNILNINQTILSLKTGHFNKLSHDK--DLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            +   L   I P  V IGKF+     L AA   GKV + N            +  + +  DI  ++LNINQ +  L  G   KL  D   D +FVG+ ++LL YDV +N+D+FY+E+ DG +   +GKLG     + +IGG+C+L  FD+ G++  W+VTGDNV SL + D    G NEL+VGSEDF+IRVF ED++++EMTE ETVT+LC + GS FGY LANGTVGVYDR  R WRIKSK+  + I  FD+N DGV+ELITGWSNGKV
Sbjct:    6 FTLKLNHKINPRMVTIGKFDGVHPCLTAATQAGKVFIHNPHVRGQKPAAHRLTQSTLDSDI--SLLNINQAVTCLAAG---KLGPDTVGDTLFVGSQTNLLAYDVHDNADIFYREVTDGANAIVLGKLGNIRSPLAIIGGNCALQGFDHDGNDQFWTVTGDNVRSLVLCDFTGDGKNELLVGSEDFDIRVFKEDELVSEMTENETVTSLCHMHGSRFGYALANGTVGVYDRTARYWRIKSKNHAMSIHAFDLNGDGVVELITGWSNGKV 269          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Planmine SMEST
Match: SMESG000075151.1 (SMESG000075151.1)

HSP 1 Score: 658.292 bits (1697), Expect = 0.000e+0
Identity = 321/338 (94.97%), Postives = 323/338 (95.56%), Query Frame = 3
Query: 1263 VRFIDFVQKIQQGVELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGTD 2276
            V+FI F  +I     L      DVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTI PPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGTD
Sbjct:  415 VKFISFSLRIYHSYFL------DVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIVPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGTD 746          

HSP 2 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 263/264 (99.62%), Postives = 264/264 (100.00%), Query Frame = 3
Query:   39 MQLLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAISKDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            MQLLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAISKDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGK+
Sbjct:    1 MQLLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAISKDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKI 264          

HSP 3 Score: 314.309 bits (804), Expect = 0.000e+0
Identity = 152/154 (98.70%), Postives = 153/154 (99.35%), Query Frame = 1
Query:  871 SKIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGVISQDYIYELNLKKQNLLMELKTYENSTSISQHPDASYVMAIPTDTSVNFTMQLVNTQNKVCFISIGYASLILSKKFSRVLNFYLKQIMM 1332
             KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGVISQDYIYELNLKKQNLLMELKTYENSTSISQHPDASYVMAIPTDTSVNFTMQLVNTQNKVCFISIGYASLILSKKFSRVLNFYLKQIM+
Sbjct:  262 GKIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGVISQDYIYELNLKKQNLLMELKTYENSTSISQHPDASYVMAIPTDTSVNFTMQLVNTQNKVCFISIGYASLILSKKFSRVLNFYLKQIMV 415          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Planmine SMEST
Match: SMESG000075151.1 (SMESG000075151.1)

HSP 1 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 321/338 (94.97%), Postives = 323/338 (95.56%), Query Frame = 3
Query: 1263 VRFIDFVQKIQQGVELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGTD 2276
            V+FI F  +I     L      DVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTI PPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGTD
Sbjct:  309 VKFISFSLRIYHSYFL------DVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIVPPKDVAVDLHMKVIVGYKTGNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGTD 640          

HSP 2 Score: 328.561 bits (841), Expect = 5.618e-177
Identity = 153/155 (98.71%), Postives = 155/155 (100.00%), Query Frame = 3
Query:  366 EIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            +IADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGK+
Sbjct:    4 KIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKI 158          

HSP 3 Score: 313.538 bits (802), Expect = 5.618e-177
Identity = 152/154 (98.70%), Postives = 153/154 (99.35%), Query Frame = 1
Query:  871 SKIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGVISQDYIYELNLKKQNLLMELKTYENSTSISQHPDASYVMAIPTDTSVNFTMQLVNTQNKVCFISIGYASLILSKKFSRVLNFYLKQIMM 1332
             KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGVISQDYIYELNLKKQNLLMELKTYENSTSISQHPDASYVMAIPTDTSVNFTMQLVNTQNKVCFISIGYASLILSKKFSRVLNFYLKQIM+
Sbjct:  156 GKIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGVISQDYIYELNLKKQNLLMELKTYENSTSISQHPDASYVMAIPTDTSVNFTMQLVNTQNKVCFISIGYASLILSKKFSRVLNFYLKQIMV 309          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Planmine SMEST
Match: SMESG000074964.1 (SMESG000074964.1)

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 263/264 (99.62%), Postives = 264/264 (100.00%), Query Frame = 3
Query:   39 MQLLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAISKDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKV 830
            MQLLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAISKDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGK+
Sbjct:    1 MQLLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVADNAISKDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDVENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVLWSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETETVTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDDGVIELITGWSNGKI 264          

HSP 2 Score: 314.309 bits (804), Expect = 0.000e+0
Identity = 152/154 (98.70%), Postives = 153/154 (99.35%), Query Frame = 1
Query:  871 SKIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGVISQDYIYELNLKKQNLLMELKTYENSTSISQHPDASYVMAIPTDTSVNFTMQLVNTQNKVCFISIGYASLILSKKFSRVLNFYLKQIMM 1332
             KIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGVISQDYIYELNLKKQNLLMELKTYENSTSISQHPDASYVMAIPTDTSVNFTMQLVNTQNKVCFISIGYASLILSKKFSRVLNFYLKQIM+
Sbjct:  262 GKIDVRRIDSGEVLFKDHMKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGVISQDYIYELNLKKQNLLMELKTYENSTSISQHPDASYVMAIPTDTSVNFTMQLVNTQNKVCFISIGYASLILSKKFSRVLNFYLKQIMV 415          

HSP 3 Score: 130.568 bits (327), Expect = 8.954e-32
Identity = 64/80 (80.00%), Postives = 66/80 (82.50%), Query Frame = 3
Query: 1263 VRFIDFVQKIQQGVELLFETNNDVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTG 1502
            V+FI F  +I     L      DVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTG
Sbjct:  415 VKFISFSLRIYHSYFL------DVLVRCVMIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKTG 488          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Planmine SMEST
Match: SMESG000074953.1 (SMESG000074953.1)

HSP 1 Score: 401.749 bits (1031), Expect = 2.497e-136
Identity = 203/251 (80.88%), Postives = 203/251 (80.88%), Query Frame = 3
Query: 1524 MIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGTD 2276
            MIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHR                                                VIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGTD
Sbjct:    1 MIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHR------------------------------------------------VIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGTD 203          
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Planmine SMEST
Match: SMESG000074953.1 (SMESG000074953.1)

HSP 1 Score: 383.259 bits (983), Expect = 2.457e-129
Identity = 194/242 (80.17%), Postives = 194/242 (80.17%), Query Frame = 3
Query: 1551 MYQYVAEGQPFKKPTGYVQFQVQERLHRFILWVNQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGTD 2276
            MYQYVAEGQPFKKPTGYVQFQVQERLHR                                                VIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGTD
Sbjct:    1 MYQYVAEGQPFKKPTGYVQFQVQERLHR------------------------------------------------VIVSTENIEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRMTSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRIRCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKIDRLIKTGTD 194          
The following BLAST results are available for this feature:
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BBS23.203e-9344.44Bardet-Biedl syndrome 2 [Source:HGNC Symbol;Acc:HG... [more]
BBS26.704e-7848.16Bardet-Biedl syndrome 2 [Source:HGNC Symbol;Acc:HG... [more]
BBS21.883e-3745.93Bardet-Biedl syndrome 2 [Source:HGNC Symbol;Acc:HG... [more]
BBS23.885e-2767.11Bardet-Biedl syndrome 2 [Source:HGNC Symbol;Acc:HG... [more]
BBS23.264e-1948.10Bardet-Biedl syndrome 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bbs-21.261e-8729.34Bardet-Biedl syndrome 2 protein homolog [Source:U... [more]
back to top
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
bbs24.248e-16244.92Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:2591... [more]
bbs24.248e-16244.92Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:2591... [more]
bbs24.248e-16244.92Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:2591... [more]
back to top
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
krt596.259e-17046.93keratin 59 [Source:Xenbase;Acc:XB-GENE-876286][more]
krt592.403e-16947.06keratin 59 [Source:Xenbase;Acc:XB-GENE-876286][more]
krt593.331e-16743.75keratin 59 [Source:Xenbase;Acc:XB-GENE-876286][more]
krt592.613e-16646.46keratin 59 [Source:Xenbase;Acc:XB-GENE-876286][more]
krt591.879e-16446.93keratin 59 [Source:Xenbase;Acc:XB-GENE-876286][more]
back to top
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Bbs21.221e-9545.37Bardet-Biedl syndrome 2 (human) [Source:MGI Symbol... [more]
back to top
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q98SP7|BBS2_DANRE2.619e-16144.92Bardet-Biedl syndrome 2 protein homolog OS=Danio r... [more]
sp|Q9CWF6|BBS2_MOUSE8.544e-9545.37Bardet-Biedl syndrome 2 protein homolog OS=Mus mus... [more]
sp|Q9BXC9|BBS2_HUMAN1.415e-9244.44Bardet-Biedl syndrome 2 protein OS=Homo sapiens OX... [more]
sp|Q99MH9|BBS2_RAT3.285e-9244.44Bardet-Biedl syndrome 2 protein homolog OS=Rattus ... [more]
sp|Q19640|BBS2_CAEEL1.320e-8629.34Bardet-Biedl syndrome 2 protein homolog OS=Caenorh... [more]
back to top
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M6UAY82.738e-16846.06Bardet-Biedl syndrome 2 protein homolog OS=Pocillo... [more]
A7S9V74.620e-16845.45Bardet-Biedl syndrome 2 protein homolog OS=Nematos... [more]
A0A1L8GEJ72.619e-16745.99Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A5G3L6X25.623e-16746.93Bardet-Biedl syndrome 2 protein homolog OS=Xenopus... [more]
A0A2B4RD879.648e-16744.85Bardet-Biedl syndrome 2 protein homolog OS=Styloph... [more]
back to top
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bbs23.514e-16245.68Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:1030... [more]
bbs26.734e-14547.21Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bbs28.308e-16845.68Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:2591... [more]
back to top
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO394929.402e-17245.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
bbs21.226e-16445.68Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:1011... [more]
bbs22.055e-14649.07Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:1011... [more]
bbs29.082e-9145.68Bardet-Biedl syndrome 2 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Bardet-Biedl syndrome 2 protein homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075151.10.000e+094.97SMESG000075151.1[more]
SMESG000075151.15.618e-17794.97SMESG000075151.1[more]
SMESG000074964.18.954e-3299.62SMESG000074964.1[more]
SMESG000074953.12.497e-13680.88SMESG000074953.1[more]
SMESG000074953.12.457e-12980.17SMESG000074953.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003177 ID=SMED30003177|Name=Bardet-Biedl syndrome 2 protein homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=2326bp
CTGTTTCATTTTTCGAAATATAAATTTTAAATTAAATTATGCAATTATTG
TCTGAATATAAATTTAATTTAAAACAAAATATTTTACCTGGAAGAGTTGC
GATCGGAAAATTTAATTCTTCTTCAACATACTTAGTCGCTGCTCTAACGG
GAGGAAAAGTTCTTGTTACAAACCTTTGGAGTGTAGCTGATAATGCAATT
TCCAAAGACATCCCTTCCAATATACTGAATATTAATCAAACTATATTATC
GCTAAAAACTGGACATTTTAATAAATTATCTCATGATAAAGATTTAATTT
TTGTCGGAACTAGTTCAAGTCTTCTAGTTTATGATGTTGAAAATAACTCT
GATGTGTTTTATAAAGAAATAGCTGATGGCGTCTCATGTTGTGAAGTAGG
TAAATTGGGTAAATGCGATGATAATGTCGTTGTGATTGGTGGCAGTTGCT
CATTAGCCGCATTTGATTATGCTGGAGATGAGGTGTTGTGGTCTGTAACT
GGAGATAATGTCACTTCACTGGCAATTGTTGATGTCCAAAATAAAGGCTA
TAATGAATTGATAGTCGGATCTGAGGATTTTGAAATTCGAGTTTTCCACG
AAGATGATATTATTAATGAAATGACTGAAACTGAGACAGTTACAAACCTT
TGCGCCTTAGGAGGGTCAATGTTTGGATACGGGCTAGCTAATGGCACCGT
CGGTGTTTATGATAGATACAATCGATTGTGGCGGATTAAGTCGAAAAGTA
TTCCAGTCGTCATTTTAGGATTTGACATAAATGATGATGGAGTGATAGAG
TTAATTACTGGCTGGAGCAATGGCAAAGTGGGATATTTTCATGCTTTGGT
CTTATTTATTTTAAGCCATCTCAAAGATTGATGTGCGCAGAATCGATTCG
GGAGAAGTCCTATTCAAGGATCACATGAAATGTTCAATAGCTGGAATTGA
TTGCGTTTCTCATCCGCAATATTCCGGTCAATTATTGCTGGTCTGTTCGA
ATGATGGAGAAGTGCGAATATACAAAAAGGTAACCGCAACTAACAACTCA
TATTCTGGTGGTGTCATTAGCCAGGATTATATTTATGAGCTGAATTTAAA
AAAGCAAAATTTACTAATGGAACTAAAGACATATGAAAATTCCACTTCAA
TTTCTCAACATCCCGATGCTTCGTACGTTATGGCGATCCCAACAGATACT
TCCGTCAATTTCACAATGCAATTGGTAAATACCCAAAATAAGGTTTGCTT
CATTTCAATTGGGTACGCTTCATTGATTTTGTCCAAAAAATTCAGCAGGG
TGTTGAACTTTTATTTGAAACAAATAATGATGTTCTCGTGAGATGCGTCA
TGATTTTTGCCGAAGGCATCTTTGAAGGAGAAAGTCATGTTGTTCACCCA
CCAATCCATAAACTATCAACCAGGCTTCCTGTTACCATTGGTCCTCCAAA
GGATGTCGCAGTTGATCTTCATATGAAAGTCATTGTTGGTTACAAAACTG
GAAACCAATTCCATATATTTGAGATGATTCGATCGTTGCCTAAATTTTCT
ATGTATCAATACGTTGCGGAAGGTCAGCCATTCAAGAAACCAACGGGCTA
TGTTCAATTTCAAGTACAAGAAAGACTGCATAGATTCATCTTGTGGGTTA
ATCAAAATTTCCTTTTGGAAAAAGAAATTGAACTGAAATCCAAAGATCAA
ACTGAATTGTTACTAAGATTTGTGTCAGTGCGAGAGAACATAGAATTAGA
AATAAATATCAATAGCAAGACAAATCAGGTGATAGTATCAACGGAAAACA
TAGAATTTGCTGGAAATATCGTCCAAAGTCTATGCGAATACCTGAATGTG
GAAGATCTGTCAAGTGTCTGCAATTTCCCGACTGAATTCAATCACCTGAA
TGATGTCATCTCGAAAATTGATGGTATTCAAGCCAGCCATCAACGAATGA
CCAGTGACATTGCTGACAGCTCAAATATTATTAAAAATTTCATTGTCAGA
GCTGAGGATTGTCGGCTTATGCGTCACATGCCAGGAATGAACAAATGCTA
CTCGGAGTTGCTTACTCTAAATCGGGAGCTAATCAACAGATACCGAATAC
GATGCAACAATCACCAAGAACTTCTCAATTACTTGAAATTCATAAATTCC
TTTATTCAACAAGGAGGTAATCTCAGAGTTGGAAGATATCGTACGCAAGT
CGTAGCAAGTTGTCGTCAAGCGGTAAAAGATAACCATCTGAATAAGATCG
ATAGACTTATAAAAACTGGCACTGACTAAATCATGGATTCCGGGACCTGC
CGCATTTAGACTTATTTCTTATGTTC
back to top

protein sequence of SMED30003177-orf-1

>SMED30003177-orf-1 ID=SMED30003177-orf-1|Name=SMED30003177-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=310bp
MIFAEGIFEGESHVVHPPIHKLSTRLPVTIGPPKDVAVDLHMKVIVGYKT
GNQFHIFEMIRSLPKFSMYQYVAEGQPFKKPTGYVQFQVQERLHRFILWV
NQNFLLEKEIELKSKDQTELLLRFVSVRENIELEININSKTNQVIVSTEN
IEFAGNIVQSLCEYLNVEDLSSVCNFPTEFNHLNDVISKIDGIQASHQRM
TSDIADSSNIIKNFIVRAEDCRLMRHMPGMNKCYSELLTLNRELINRYRI
RCNNHQELLNYLKFINSFIQQGGNLRVGRYRTQVVASCRQAVKDNHLNKI
DRLIKTGTD*
back to top

protein sequence of SMED30003177-orf-2

>SMED30003177-orf-2 ID=SMED30003177-orf-2|Name=SMED30003177-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=281bp
MQLLSEYKFNLKQNILPGRVAIGKFNSSSTYLVAALTGGKVLVTNLWSVA
DNAISKDIPSNILNINQTILSLKTGHFNKLSHDKDLIFVGTSSSLLVYDV
ENNSDVFYKEIADGVSCCEVGKLGKCDDNVVVIGGSCSLAAFDYAGDEVL
WSVTGDNVTSLAIVDVQNKGYNELIVGSEDFEIRVFHEDDIINEMTETET
VTNLCALGGSMFGYGLANGTVGVYDRYNRLWRIKSKSIPVVILGFDINDD
GVIELITGWSNGKVGYFHALVLFILSHLKD*
back to top

protein sequence of SMED30003177-orf-3

>SMED30003177-orf-3 ID=SMED30003177-orf-3|Name=SMED30003177-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=139bp
MKCSIAGIDCVSHPQYSGQLLLVCSNDGEVRIYKKVTATNNSYSGGVISQ
DYIYELNLKKQNLLMELKTYENSTSISQHPDASYVMAIPTDTSVNFTMQL
VNTQNKVCFISIGYASLILSKKFSRVLNFYLKQIMMFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR016616Bardet-Biedl_syndrome_2_prot
IPR029333BBS2_C
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR011047Quinoprotein_ADH-like_supfam
IPR029430BBS2_N
IPR029429BBS2_Mid
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0001103RNA polymerase II repressing transcription factor binding
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0032420stereocilium
GO:0034464BBSome
GO:0036064ciliary basal body
GO:0042995cell projection
GO:0060170ciliary membrane
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005902microvillus
GO:0005929cilium
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0033210leptin-mediated signaling pathway
GO:0033365protein localization to organelle
GO:0038108negative regulation of appetite by leptin-mediated signaling pathway
GO:0040015negative regulation of multicellular organism growth
GO:0040018positive regulation of multicellular organism growth
GO:0042311vasodilation
GO:0043001Golgi to plasma membrane protein transport
GO:0044321response to leptin
GO:0045444fat cell differentiation
GO:0045494photoreceptor cell maintenance
GO:0048854brain morphogenesis
GO:0051216cartilage development
GO:0060271cilium morphogenesis
GO:0060296regulation of cilium beat frequency involved in ciliary motility
GO:1903441protein localization to ciliary membrane
GO:1905515non-motile cilium assembly
GO:0006810transport
GO:0007288sperm axoneme assembly
GO:0007601visual perception
GO:0008104protein localization
GO:0010629negative regulation of gene expression
GO:0014824artery smooth muscle contraction
GO:0015031protein transport
GO:0021756striatum development
GO:0021766hippocampus development
GO:0021987cerebral cortex development
GO:0030030cell projection organization
GO:0030534adult behavior
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029333Ciliary BBSome complex subunit 2, C-terminal domainPFAMPF14782BBS2_Ccoord: 1..305
e-value: 4.0E-116
score: 388.3
IPR016616Bardet-Biedl syndrome 2 proteinPANTHERPTHR32465FAMILY NOT NAMEDcoord: 1..308