40S ribosomal protein S2

Overview
Name40S ribosomal protein S2
Smed IDSMED30003176
Length (bp)844
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 40S ribosomal protein S2 (SMED30003176) t-SNE clustered cells

Violin plots show distribution of expression levels for 40S ribosomal protein S2 (SMED30003176) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 40S ribosomal protein S2 (SMED30003176) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 40S ribosomal protein S2 (SMED30003176) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003176

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30003176h1SMcG0009590 SmedASXL_006664SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30003176h1SMcG0009590 Contig47067newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003176h1SMcG0009590 Contig47067uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30003176h1SMcG0009590 dd_Smed_v4_226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30003176h1SMcG0009590 dd_Smed_v4_226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30003176h1SMcG0009590 dd_Smed_v4_226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30003176h1SMcG0009590 dd_Smed_v4_226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003176h1SMcG0009590 dd_Smed_v4_226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003176h1SMcG0009590 dd_Smed_v4_226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003176h1SMcG0009590 dd_Smed_v4_226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003176h1SMcG0009590 dd_Smed_v4_226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003176h1SMcG0009590 dd_Smed_v4_226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30003176h1SMcG0009590 dd_Smed_v4_226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003176h1SMcG0009590 dd_Smed_v4_226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30003176h1SMcG0009590 dd_Smed_v4_226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30003176h1SMcG0009590 dd_Smed_v4_226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30003176h1SMcG0009590 dd_Smed_v6_226_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003176h1SMcG0009590 dd_Smed_v6_226_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 40S ribosomal protein S2 vs. Ensembl Human
Match: RPS2 (ribosomal protein S2 [Source:HGNC Symbol;Acc:HGNC:10404])

HSP 1 Score: 296.975 bits (759), Expect = 1.910e-100
Identity = 159/218 (72.94%), Postives = 176/218 (80.73%), Query Frame = 2
Query:  149 DSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            + KEW P TKLG LVK  K+KSLE+ Y++SLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS++PVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NFAKAT+ AI KTY YL+P+LW     T+ P+ E    L
Sbjct:   56 EDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHL 273          
BLAST of 40S ribosomal protein S2 vs. Ensembl Human
Match: RPS2 (ribosomal protein S2 [Source:HGNC Symbol;Acc:HGNC:10404])

HSP 1 Score: 236.498 bits (602), Expect = 1.454e-78
Identity = 119/149 (79.87%), Postives = 127/149 (85.23%), Query Frame = 2
Query:  251 EAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAK 694
            E+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS++PVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NF +
Sbjct:    1 ESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFGR 149          
BLAST of 40S ribosomal protein S2 vs. Ensembl Human
Match: RPS2 (ribosomal protein S2 [Source:HGNC Symbol;Acc:HGNC:10404])

HSP 1 Score: 236.498 bits (602), Expect = 6.982e-78
Identity = 119/149 (79.87%), Postives = 127/149 (85.23%), Query Frame = 2
Query:  248 KEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFA 691
            +E+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS++PVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NF 
Sbjct:   59 EESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFG 207          
BLAST of 40S ribosomal protein S2 vs. Ensembl Human
Match: RPS2 (ribosomal protein S2 [Source:HGNC Symbol;Acc:HGNC:10404])

HSP 1 Score: 236.884 bits (603), Expect = 8.513e-78
Identity = 128/163 (78.53%), Postives = 140/163 (85.89%), Query Frame = 2
Query:  149 DSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAG 634
            + KEW P TKLG LVK  K+KSLE+ Y++SLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS++PVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAG
Sbjct:   56 EDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAG 218          
BLAST of 40S ribosomal protein S2 vs. Ensembl Human
Match: RPS2 (ribosomal protein S2 [Source:HGNC Symbol;Acc:HGNC:10404])

HSP 1 Score: 221.476 bits (563), Expect = 4.080e-72
Identity = 109/150 (72.67%), Postives = 120/150 (80.00%), Query Frame = 2
Query:  350 FKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
             KA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS++PVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NFAKAT+ AI KTY YL+P+LW     T+ P+ E    L
Sbjct:   26 IKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHL 175          
BLAST of 40S ribosomal protein S2 vs. Ensembl Celegans
Match: rps-2 (40S ribosomal protein S2 [Source:UniProtKB/Swiss-Prot;Acc:P51403])

HSP 1 Score: 288.115 bits (736), Expect = 1.271e-97
Identity = 150/219 (68.49%), Postives = 175/219 (79.91%), Query Frame = 2
Query:  143 EKDSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFLPDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            EK++ EW P TKLG LVK  K+ +LE+ Y+ SLPIKE EIID    +LKDEVL I PVQKQT AGQRTRFKA VA+GD+ GHVGLGVKC+KEVATAIRGAI+ AKL+V+PVR+GYWGNKIG  HTVP KVTGKC SV VRLIPAPRGTGIV APV KKLL MAGI+D YT+A G TATL NFAKATY A+++TY YL+P+LW      + P+  H ++L
Sbjct:   52 EKET-EWTPVTKLGRLVKEKKITTLEEIYLNSLPIKEFEIIDALCSNLKDEVLKISPVQKQTTAGQRTRFKAFVAIGDHAGHVGLGVKCSKEVATAIRGAIVAAKLAVVPVRRGYWGNKIGLPHTVPCKVTGKCASVMVRLIPAPRGTGIVSAPVPKKLLHMAGIEDCYTAAKGSTATLGNFAKATYAALQRTYSYLTPDLWKEEALEKSPYQRHHEYL 269          
BLAST of 40S ribosomal protein S2 vs. Ensembl Celegans
Match: rps-2 (40S ribosomal protein S2 [Source:UniProtKB/Swiss-Prot;Acc:P51403])

HSP 1 Score: 288.115 bits (736), Expect = 1.271e-97
Identity = 150/219 (68.49%), Postives = 175/219 (79.91%), Query Frame = 2
Query:  143 EKDSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFLPDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            EK++ EW P TKLG LVK  K+ +LE+ Y+ SLPIKE EIID    +LKDEVL I PVQKQT AGQRTRFKA VA+GD+ GHVGLGVKC+KEVATAIRGAI+ AKL+V+PVR+GYWGNKIG  HTVP KVTGKC SV VRLIPAPRGTGIV APV KKLL MAGI+D YT+A G TATL NFAKATY A+++TY YL+P+LW      + P+  H ++L
Sbjct:   52 EKET-EWTPVTKLGRLVKEKKITTLEEIYLNSLPIKEFEIIDALCSNLKDEVLKISPVQKQTTAGQRTRFKAFVAIGDHAGHVGLGVKCSKEVATAIRGAIVAAKLAVVPVRRGYWGNKIGLPHTVPCKVTGKCASVMVRLIPAPRGTGIVSAPVPKKLLHMAGIEDCYTAAKGSTATLGNFAKATYAALQRTYSYLTPDLWKEEALEKSPYQRHHEYL 269          
BLAST of 40S ribosomal protein S2 vs. Ensembl Fly
Match: RpS2 (gene:FBgn0004867 transcript:FBtr0079905)

HSP 1 Score: 311.612 bits (797), Expect = 7.073e-107
Identity = 165/220 (75.00%), Postives = 183/220 (83.18%), Query Frame = 2
Query:  143 EKDSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            ++DSKEW P TKLG LV+ GK+KSLE+ Y+YSLPIKE EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GDNNGH+GLGVKC+KEVATAIRGAII AKLSV+PVR+GYWGNKIG  HTVP KVTGKCGSVSVRLIPAPRGTGIV APV KKLL+MAGI+D YTSA G T TL NFAKATY AI KTY YL+P+LW   P    P+  ++ FL
Sbjct:   37 KEDSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCYTSARGSTGTLGNFAKATYAAIAKTYAYLTPDLWKEMPLGSTPYQAYSDFL 256          
BLAST of 40S ribosomal protein S2 vs. Ensembl Fly
Match: RpS2 (gene:FBgn0004867 transcript:FBtr0330682)

HSP 1 Score: 311.612 bits (797), Expect = 7.073e-107
Identity = 165/220 (75.00%), Postives = 183/220 (83.18%), Query Frame = 2
Query:  143 EKDSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            ++DSKEW P TKLG LV+ GK+KSLE+ Y+YSLPIKE EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GDNNGH+GLGVKC+KEVATAIRGAII AKLSV+PVR+GYWGNKIG  HTVP KVTGKCGSVSVRLIPAPRGTGIV APV KKLL+MAGI+D YTSA G T TL NFAKATY AI KTY YL+P+LW   P    P+  ++ FL
Sbjct:   37 KEDSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCYTSARGSTGTLGNFAKATYAAIAKTYAYLTPDLWKEMPLGSTPYQAYSDFL 256          
BLAST of 40S ribosomal protein S2 vs. Ensembl Fly
Match: RpS2 (gene:FBgn0004867 transcript:FBtr0345436)

HSP 1 Score: 311.612 bits (797), Expect = 7.073e-107
Identity = 165/220 (75.00%), Postives = 183/220 (83.18%), Query Frame = 2
Query:  143 EKDSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            ++DSKEW P TKLG LV+ GK+KSLE+ Y+YSLPIKE EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GDNNGH+GLGVKC+KEVATAIRGAII AKLSV+PVR+GYWGNKIG  HTVP KVTGKCGSVSVRLIPAPRGTGIV APV KKLL+MAGI+D YTSA G T TL NFAKATY AI KTY YL+P+LW   P    P+  ++ FL
Sbjct:   37 KEDSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCYTSARGSTGTLGNFAKATYAAIAKTYAYLTPDLWKEMPLGSTPYQAYSDFL 256          
BLAST of 40S ribosomal protein S2 vs. Ensembl Fly
Match: mRpS5 (gene:FBgn0044510 transcript:FBtr0111147)

HSP 1 Score: 51.6026 bits (122), Expect = 3.686e-7
Identity = 37/169 (21.89%), Postives = 77/169 (45.56%), Query Frame = 2
Query:  242 PIKEAEIIDHFLPDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAI--RKTYEYLSPE 742
            P+ + E +      L+++++ I     +   G++ R+  +   G+ NG  G     A EV TA+R +  +A   +I +        + +  T+        G   +     P G G+V     + +  + GI+D+Y    G T  ++N AKA ++ +  +++Y+Y++ E
Sbjct:  162 PVGDEEFVSFDTRVLENKIVFIM----KGNMGRKRRYSVLSVTGNGNGLAGFATAKAPEVRTALRKSKNRAGQKLINI-------SLCENRTIFHDFRTDFGKTKIFCFQKPDGYGLVCHRAIQTICKVIGIKDLYAKIEGST-NIQNIAKAFFIGLMTQRSYQYIANE 318          
BLAST of 40S ribosomal protein S2 vs. Ensembl Fly
Match: mRpS5 (gene:FBgn0044510 transcript:FBtr0111146)

HSP 1 Score: 51.6026 bits (122), Expect = 3.686e-7
Identity = 37/169 (21.89%), Postives = 77/169 (45.56%), Query Frame = 2
Query:  242 PIKEAEIIDHFLPDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAI--RKTYEYLSPE 742
            P+ + E +      L+++++ I     +   G++ R+  +   G+ NG  G     A EV TA+R +  +A   +I +        + +  T+        G   +     P G G+V     + +  + GI+D+Y    G T  ++N AKA ++ +  +++Y+Y++ E
Sbjct:  162 PVGDEEFVSFDTRVLENKIVFIM----KGNMGRKRRYSVLSVTGNGNGLAGFATAKAPEVRTALRKSKNRAGQKLINI-------SLCENRTIFHDFRTDFGKTKIFCFQKPDGYGLVCHRAIQTICKVIGIKDLYAKIEGST-NIQNIAKAFFIGLMTQRSYQYIANE 318          
BLAST of 40S ribosomal protein S2 vs. Ensembl Zebrafish
Match: rps2 (ribosomal protein S2 [Source:ZFIN;Acc:ZDB-GENE-040426-2454])

HSP 1 Score: 297.745 bits (761), Expect = 3.672e-101
Identity = 161/220 (73.18%), Postives = 177/220 (80.45%), Query Frame = 2
Query:  143 EKDSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFLPD-LKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            + + KEW P TKLG LVK  K+KSLE+ Y+YSLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS+IPVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NFAKAT+ AI KTY YL+P+LW     T+ P+ E    L
Sbjct:   40 KSEDKEWVPVTKLGRLVKDMKIKSLEEIYLYSLPIKESEIIDFFLGSALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIIPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHL 259          
BLAST of 40S ribosomal protein S2 vs. Ensembl Zebrafish
Match: rps2 (ribosomal protein S2 [Source:ZFIN;Acc:ZDB-GENE-040426-2454])

HSP 1 Score: 297.745 bits (761), Expect = 3.672e-101
Identity = 161/220 (73.18%), Postives = 177/220 (80.45%), Query Frame = 2
Query:  143 EKDSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFLPD-LKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            + + KEW P TKLG LVK  K+KSLE+ Y+YSLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS+IPVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NFAKAT+ AI KTY YL+P+LW     T+ P+ E    L
Sbjct:   40 KSEDKEWVPVTKLGRLVKDMKIKSLEEIYLYSLPIKESEIIDFFLGSALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIIPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHL 259          
BLAST of 40S ribosomal protein S2 vs. Ensembl Zebrafish
Match: rps2 (ribosomal protein S2 [Source:ZFIN;Acc:ZDB-GENE-040426-2454])

HSP 1 Score: 80.8777 bits (198), Expect = 7.820e-19
Identity = 52/70 (74.29%), Postives = 57/70 (81.43%), Query Frame = 2
Query:  149 DSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFK 355
            + KEW P TKLG LVK  K+KSLE+ Y+YSLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFK
Sbjct:   42 EDKEWVPVTKLGRLVKDMKIKSLEEIYLYSLPIKESEIIDFFLGSALKDEVLKIMPVQKQTRAGQRTRFK 111          
BLAST of 40S ribosomal protein S2 vs. Ensembl Xenopus
Match: rps2 (ribosomal protein S2 [Source:NCBI gene;Acc:493255])

HSP 1 Score: 298.901 bits (764), Expect = 1.823e-100
Identity = 160/218 (73.39%), Postives = 177/218 (81.19%), Query Frame = 2
Query:  149 DSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            D KEW P TKLG LVK  K+KSLE+ Y++SLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS++PVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NFAKAT+ AI KTY YL+P+LW     T+ P+ E+   L
Sbjct:  108 DDKEWVPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEYTDHL 325          
BLAST of 40S ribosomal protein S2 vs. Ensembl Xenopus
Match: rps2 (ribosomal protein S2 [Source:NCBI gene;Acc:493255])

HSP 1 Score: 181.415 bits (459), Expect = 1.224e-56
Identity = 104/149 (69.80%), Postives = 117/149 (78.52%), Query Frame = 2
Query:  149 DSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGI 592
            D KEW P TKLG LVK  K+KSLE+ Y++SLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS++PVR+GYWGNKIG  HTVP K+          L+P+ R T I
Sbjct:   43 DDKEWVPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKLKPP-------LMPSQRLTAI 184          
BLAST of 40S ribosomal protein S2 vs. Ensembl Mouse
Match: Rps2 (ribosomal protein S2 [Source:MGI Symbol;Acc:MGI:105110])

HSP 1 Score: 296.204 bits (757), Expect = 2.724e-100
Identity = 159/218 (72.94%), Postives = 176/218 (80.73%), Query Frame = 2
Query:  149 DSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            + KEW P TKLG LVK  K+KSLE+ Y++SLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS++PVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NFAKAT+ AI KTY YL+P+LW     T+ P+ E    L
Sbjct:   56 EDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHL 273          
BLAST of 40S ribosomal protein S2 vs. Ensembl Mouse
Match: Rps2 (ribosomal protein S2 [Source:MGI Symbol;Acc:MGI:105110])

HSP 1 Score: 296.204 bits (757), Expect = 2.724e-100
Identity = 159/218 (72.94%), Postives = 176/218 (80.73%), Query Frame = 2
Query:  149 DSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            + KEW P TKLG LVK  K+KSLE+ Y++SLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS++PVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NFAKAT+ AI KTY YL+P+LW     T+ P+ E    L
Sbjct:   56 EDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHL 273          
BLAST of 40S ribosomal protein S2 vs. Ensembl Mouse
Match: Rps2 (ribosomal protein S2 [Source:MGI Symbol;Acc:MGI:105110])

HSP 1 Score: 293.123 bits (749), Expect = 1.754e-99
Identity = 157/211 (74.41%), Postives = 174/211 (82.46%), Query Frame = 2
Query:  149 DSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPF 778
            + KEW P TKLG LVK  K+KSLE+ Y++SLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS++PVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NFAKAT+ AI KTY YL+P+LW     T+ P+
Sbjct:   56 EDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPY 266          
BLAST of 40S ribosomal protein S2 vs. Ensembl Mouse
Match: Rps2 (ribosomal protein S2 [Source:MGI Symbol;Acc:MGI:105110])

HSP 1 Score: 292.352 bits (747), Expect = 1.370e-98
Identity = 157/211 (74.41%), Postives = 174/211 (82.46%), Query Frame = 2
Query:  149 DSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPF 778
            + KEW P TKLG LVK  K+KSLE+ Y++SLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS++PVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NFAKAT+ AI KTY YL+P+LW     T+ P+
Sbjct:   56 EDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPY 266          
BLAST of 40S ribosomal protein S2 vs. UniProt/SwissProt
Match: sp|P31009|RS2_DROME (40S ribosomal protein S2 OS=Drosophila melanogaster OX=7227 GN=RpS2 PE=1 SV=2)

HSP 1 Score: 311.612 bits (797), Expect = 7.090e-106
Identity = 165/220 (75.00%), Postives = 183/220 (83.18%), Query Frame = 2
Query:  143 EKDSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            ++DSKEW P TKLG LV+ GK+KSLE+ Y+YSLPIKE EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GDNNGH+GLGVKC+KEVATAIRGAII AKLSV+PVR+GYWGNKIG  HTVP KVTGKCGSVSVRLIPAPRGTGIV APV KKLL+MAGI+D YTSA G T TL NFAKATY AI KTY YL+P+LW   P    P+  ++ FL
Sbjct:   37 KEDSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCYTSARGSTGTLGNFAKATYAAIAKTYAYLTPDLWKEMPLGSTPYQAYSDFL 256          
BLAST of 40S ribosomal protein S2 vs. UniProt/SwissProt
Match: sp|Q90YS3|RS2_ICTPU (40S ribosomal protein S2 OS=Ictalurus punctatus OX=7998 GN=rps2 PE=2 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 4.374e-100
Identity = 161/218 (73.85%), Postives = 176/218 (80.73%), Query Frame = 2
Query:  149 DSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFLPD-LKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            + KEW P TKLG LVK  K+KSLE+ Y+YSLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS+IPVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NFAKAT+ AI KTY YL+P+LW     T+ P+ E    L
Sbjct:   41 EDKEWVPVTKLGRLVKDMKIKSLEEIYLYSLPIKESEIIDFFLGSALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIIPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHL 258          
BLAST of 40S ribosomal protein S2 vs. UniProt/SwissProt
Match: sp|P15880|RS2_HUMAN (40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2)

HSP 1 Score: 296.975 bits (759), Expect = 9.173e-100
Identity = 159/218 (72.94%), Postives = 176/218 (80.73%), Query Frame = 2
Query:  149 DSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            + KEW P TKLG LVK  K+KSLE+ Y++SLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS++PVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NFAKAT+ AI KTY YL+P+LW     T+ P+ E    L
Sbjct:   56 EDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHL 273          
BLAST of 40S ribosomal protein S2 vs. UniProt/SwissProt
Match: sp|O18789|RS2_BOVIN (40S ribosomal protein S2 OS=Bos taurus OX=9913 GN=RPS2 PE=2 SV=2)

HSP 1 Score: 296.975 bits (759), Expect = 1.141e-99
Identity = 159/218 (72.94%), Postives = 176/218 (80.73%), Query Frame = 2
Query:  149 DSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            + KEW P TKLG LVK  K+KSLE+ Y++SLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS++PVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NFAKAT+ AI KTY YL+P+LW     T+ P+ E    L
Sbjct:   56 EDKEWLPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHL 273          
BLAST of 40S ribosomal protein S2 vs. UniProt/SwissProt
Match: sp|P27952|RS2_RAT (40S ribosomal protein S2 OS=Rattus norvegicus OX=10116 GN=Rps2 PE=1 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 1.905e-99
Identity = 159/218 (72.94%), Postives = 176/218 (80.73%), Query Frame = 2
Query:  149 DSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            + KEW P TKLG LVK  K+KSLE+ Y++SLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS++PVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NFAKAT+ AI KTY YL+P+LW     T+ P+ E    L
Sbjct:   56 EDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHL 273          
BLAST of 40S ribosomal protein S2 vs. TrEMBL
Match: Q56A61 (MGC115171 protein OS=Xenopus laevis OX=8355 GN=MGC115171 PE=2 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 8.272e-109
Identity = 167/217 (76.96%), Postives = 187/217 (86.18%), Query Frame = 2
Query:  152 SKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            +KEW+P T+LG LV   KV +LE+ Y++SLPIKE+EIIDH L   LKDEVL I PVQKQTRAGQRTRFKA+VA+GD+  HVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGN IG  HTVP KVTGKCGSV+VRLIPAPRGTGIVGAPV KKLL MAGI+DVYTSA GQTATL NFAKATY AIR TYEYL+P+LWNVAP T++ + E+  +L
Sbjct:   38 AKEWKPVTQLGRLVADSKVTTLEEIYMFSLPIKESEIIDHLLGSSLKDEVLKIMPVQKQTRAGQRTRFKAIVAMGDHKCHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNLIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVGAPVPKKLLQMAGIEDVYTSARGQTATLGNFAKATYAAIRATYEYLTPDLWNVAPKTKHLYVEYGDYL 254          
BLAST of 40S ribosomal protein S2 vs. TrEMBL
Match: A0A0V0J8X3 (S5 DRBM domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS9484 PE=3 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 1.187e-108
Identity = 172/221 (77.83%), Postives = 190/221 (85.97%), Query Frame = 2
Query:  143 EKDSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFLPD--LKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            +KDS EW+P T LG LVK  K+ SLE+ Y+YSLPIKEAEI+D  L    LKDEVL I PVQKQT AGQRTRFKA+VA+GD NGHVGLGVKCAKEVATAIRGAIIQAKLS+IPVRKGYWGNKIG  HTVP KVTGKCGSV VRLIPAPRGTGIV APV KKLLSMAGI+DVYTSA GQTATL NFAKATY AIRKTYEYL+P+LW+VAP+  +P+ +HA +L
Sbjct:   34 QKDS-EWKPVTHLGRLVKDRKITSLEEIYMYSLPIKEAEIVDTLLGPTVLKDEVLKIMPVQKQTCAGQRTRFKAIVAMGDFNGHVGLGVKCAKEVATAIRGAIIQAKLSIIPVRKGYWGNKIGKPHTVPCKVTGKCGSVLVRLIPAPRGTGIVSAPVPKKLLSMAGIEDVYTSARGQTATLGNFAKATYAAIRKTYEYLTPDLWSVAPTEPHPYIKHADYL 253          
BLAST of 40S ribosomal protein S2 vs. TrEMBL
Match: A0A504Z307 (Small subunit ribosomal protein S2e OS=Fasciola gigantica OX=46835 GN=FGIG_05127 PE=3 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 3.139e-108
Identity = 166/216 (76.85%), Postives = 186/216 (86.11%), Query Frame = 2
Query:  155 KEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            KEW+P T+LG LV   KV +LE+ Y++SLPIKE+EIIDH L   LKDEVL I PVQKQTRAGQRTRFKA+VA+GD+  HVGLGVKCAKEVATAIRGAIIQAKLS+IPVRKGYWGN IG  HTVP KVTGKCGSV+VRLIPAPRGTGIVGAPV KKLL MAGI+DVYTSA GQTATL NFAKATY AIR TYEYL+P+LWNVAP  ++ + E+A +L
Sbjct:   39 KEWKPVTQLGRLVADSKVTTLEEIYMFSLPIKESEIIDHLLGSSLKDEVLKIMPVQKQTRAGQRTRFKAIVAMGDHKCHVGLGVKCAKEVATAIRGAIIQAKLSIIPVRKGYWGNLIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVGAPVPKKLLQMAGIEDVYTSARGQTATLGNFAKATYAAIRATYEYLTPDLWNVAPKAKHLYVEYADYL 254          
BLAST of 40S ribosomal protein S2 vs. TrEMBL
Match: A0A4E0RD65 (Small subunit ribosomal protein S2e OS=Fasciola hepatica OX=6192 GN=D915_004390 PE=3 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 3.139e-108
Identity = 166/216 (76.85%), Postives = 186/216 (86.11%), Query Frame = 2
Query:  155 KEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            KEW+P T+LG LV   KV +LE+ Y++SLPIKE+EIIDH L   LKDEVL I PVQKQTRAGQRTRFKA+VA+GD+  HVGLGVKCAKEVATAIRGAIIQAKLS+IPVRKGYWGN IG  HTVP KVTGKCGSV+VRLIPAPRGTGIVGAPV KKLL MAGI+DVYTSA GQTATL NFAKATY AIR TYEYL+P+LWNVAP  ++ + E+A +L
Sbjct:   39 KEWKPVTQLGRLVADSKVTTLEEIYMFSLPIKESEIIDHLLGSSLKDEVLKIMPVQKQTRAGQRTRFKAIVAMGDHKCHVGLGVKCAKEVATAIRGAIIQAKLSIIPVRKGYWGNLIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVGAPVPKKLLQMAGIEDVYTSARGQTATLGNFAKATYAAIRATYEYLTPDLWNVAPKAKHLYVEYADYL 254          
BLAST of 40S ribosomal protein S2 vs. TrEMBL
Match: A0A5J4ND13 (Small subunit ribosomal protein S2e (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0010644 PE=3 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 4.489e-108
Identity = 166/217 (76.50%), Postives = 186/217 (85.71%), Query Frame = 2
Query:  152 SKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            +KEW+P T LG LV   KV +LE+ Y++SLPIKE+EIID  L   LKDEVL I PVQKQTRAGQRTRFKA+VA+GDNN HVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGN IG  HTVP KVTGKCGSV+VRLIPAPRGTGIVGAPV KKLL MAGI+DVYTS+ GQTATL NFAKATY AIR TYEYL+P+LWNV P+ ++ F E++ +L
Sbjct:   51 TKEWKPVTHLGRLVADKKVTTLEEIYMFSLPIKESEIIDTLLGSTLKDEVLKIMPVQKQTRAGQRTRFKAIVAMGDNNCHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNLIGQPHTVPCKVTGKCGSVTVRLIPAPRGTGIVGAPVPKKLLQMAGIEDVYTSSRGQTATLGNFAKATYAAIRATYEYLTPDLWNVTPNAKHLFVEYSDYL 267          
BLAST of 40S ribosomal protein S2 vs. Ensembl Cavefish
Match: rps2 (ribosomal protein S2 [Source:NCBI gene;Acc:103040619])

HSP 1 Score: 295.434 bits (755), Expect = 2.528e-100
Identity = 160/220 (72.73%), Postives = 175/220 (79.55%), Query Frame = 2
Query:  143 EKDSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFLPD-LKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            + + KEW P TKLG LVK  K+KSLE+ Y+YSLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS+IPVR+GYWGNKIG  HTVP KVTG CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NFAKAT+ AI KTY YL+P+LW      + P+ E    L
Sbjct:   40 KSEDKEWVPVTKLGRLVKDMKIKSLEEIYLYSLPIKESEIIDFFLGSALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIIPVRRGYWGNKIGKPHTVPCKVTGHCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFAKSPYQEFTDHL 259          
BLAST of 40S ribosomal protein S2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005507.1 (pep scaffold:Pmarinus_7.0:GL477092:2171:5823:-1 gene:ENSPMAG00000004935.1 transcript:ENSPMAT00000005507.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 295.434 bits (755), Expect = 4.288e-101
Identity = 157/220 (71.36%), Postives = 178/220 (80.91%), Query Frame = 2
Query:  143 EKDSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            + + KEW P TKLG LVK  K+KSLE+ Y++SLPIKE EIID FL P LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGH+GLGVKC+KEVATAIRGAII AKLS++PVR+GYWGNKI   HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL+MAGI D YTSA G TATL NFAKAT+ AI KTY YL+P+LW      + P+ E++  L
Sbjct:   40 KSEDKEWNPVTKLGRLVKDMKIKSLEEIYLFSLPIKEFEIIDLFLGPALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHIGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKISKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLTMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFIKSPYQEYSDHL 259          
BLAST of 40S ribosomal protein S2 vs. Ensembl Yeast
Match: RPS2 (Protein component of the small (40S) subunit; essential for control of translational accuracy; phosphorylation by C-terminal domain kinase I (CTDK-I) enhances translational accuracy; methylated on one or more arginine residues by Hmt1p; homologous to mammalian ribosomal protein S2 and bacterial S5 [Source:SGD;Acc:S000003091])

HSP 1 Score: 265.003 bits (676), Expect = 1.667e-89
Identity = 133/211 (63.03%), Postives = 167/211 (79.15%), Query Frame = 2
Query:  149 DSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFLPDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFD 781
            + K W P TKLG LVKAGK+ ++E+ +++SLP+KE +IID  LP L+DEV++IKPVQKQTRAGQRTRFKAVV +GD+NGHVGLG+K AKEVA AIR  II AKLSVIP+R+GYWG  +G  H++ +K TGKCGSV+VRLIPAPRG+GIV +P  KKLL +AG++DVYT +NG+T TLEN  KA ++AI  TY +L+P LW   P    P D
Sbjct:   31 EEKGWVPVTKLGRLVKAGKITTIEEIFLHSLPVKEFQIIDTLLPGLQDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTTGKCGSVTVRLIPAPRGSGIVASPAVKKLLQLAGVEDVYTQSNGKTRTLENTLKAAFVAIGNTYGFLTPNLWAEQPLPVSPLD 241          
BLAST of 40S ribosomal protein S2 vs. Ensembl Yeast
Match: YGL123C-A_mRNA (Dubious open reading frame; unlikely to encode a functional protein, based on available experimental and comparative sequence data; overlaps the verified gene RPS2/YGL123W [Source:SGD;Acc:S000028634])

HSP 1 Score: 42.743 bits (99), Expect = 2.390e-6
Identity = 25/50 (50.00%), Postives = 30/50 (60.00%), Query Frame = -2
Query:  148 TSSFKSGKK*SMISASLIGKL*MYVSSKLLTFPAFTKRPNLVQGSHSFES 297
            TSS K G K SMI  SL GK    +SS ++  PA T  P+LV G+H F S
Sbjct:    4 TSSCKPGNKVSMIWNSLTGKECKKISSMVVILPALTNLPSLVTGTHPFSS 53          
BLAST of 40S ribosomal protein S2 vs. Ensembl Yeast
Match: MRPS5 (Mitochondrial ribosomal protein of the small subunit [Source:SGD;Acc:S000000455])

HSP 1 Score: 45.0542 bits (105), Expect = 6.048e-6
Identity = 49/155 (31.61%), Postives = 67/155 (43.23%), Query Frame = 2
Query:  278 PDLKDEVLSIKP-----VQKQTRAGQRTRFKAVVALGDNNGHVGLGV-KCAKEVATAIRGAIIQA--KLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQD----VYTSANGQT---ATLENFAKA 697
            PD     L++KP     V  QT  G+   F A+V +GD NG VGLG  K  +E++ AI  A   A   L  IP           +  T+   +  +   V + L  A  G G+    V  ++   AGI+D    VY S N       T+E F KA
Sbjct:  137 PDYITRKLTMKPLVMKRVSNQTGKGKIASFYALVVVGDKNGMVGLGEGKSREEMSKAIFKAHWDAVRNLKEIPRY---------ENRTIYGDIDFRYHGVKLHLRSAKPGFGLRVNHVIFEICECAGIKDLSGKVYKSRNDMNIAKGTIEAFTKA 282          
BLAST of 40S ribosomal protein S2 vs. Ensembl Nematostella
Match: EDO48389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJJ7])

HSP 1 Score: 297.36 bits (760), Expect = 2.424e-101
Identity = 158/218 (72.48%), Postives = 176/218 (80.73%), Query Frame = 2
Query:  149 DSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            + KEW P TKLG LVK  K+K+LE  Y++SLPIKE EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD+NGHVGLGVKC+KEVATAIRGAII AKLSVIPVR+GYWGNKIG  HTVP KVTGKCGS  VRLIPAPRGTGIV APV KKLL MAGI+D YTS  GQTATL NFAKAT+ AI +TY YL+P++W     T+ P+ E   +L
Sbjct:   40 EDKEWVPVTKLGRLVKDLKIKTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDSNGHVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHTVPCKVTGKCGSTRVRLIPAPRGTGIVSAPVPKKLLQMAGIEDCYTSTRGQTATLGNFAKATFAAISETYAYLTPDMWKETVFTKTPYQEFTDYL 257          
BLAST of 40S ribosomal protein S2 vs. Ensembl Medaka
Match: rps2 (ribosomal protein S2 [Source:NCBI gene;Acc:101163743])

HSP 1 Score: 297.36 bits (760), Expect = 4.479e-101
Identity = 160/220 (72.73%), Postives = 177/220 (80.45%), Query Frame = 2
Query:  143 EKDSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFL-PDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            + + KEW P TKLG LVK  K+KSLE+ Y+YSLPIKE+EIID FL   LKDEVL I PVQKQTRAGQRTRFKA VA+GD NGHVGLGVKC+KEVATAIRGAII AKLS++PVR+GYWGNKIG  HTVP KVTG+CGSV VRLIPAPRGTGIV APV KKLL MAGI D YTSA G TATL NFAKAT+ AI KTY YL+P+LW     T+ P+ E    L
Sbjct:   40 KSEDKEWVPVTKLGRLVKDMKIKSLEEIYLYSLPIKESEIIDFFLGSGLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHL 259          
BLAST of 40S ribosomal protein S2 vs. Planmine SMEST
Match: SMESG000051503.1 (SMESG000051503.1)

HSP 1 Score: 435.261 bits (1118), Expect = 4.816e-156
Identity = 247/247 (100.00%), Postives = 247/247 (100.00%), Query Frame = 2
Query:   59 MSTVPARTSFXXXXXXXXXXXXXXXXXXEKDSKEWEPCTXXXXXXXXXXXXXXEDTYIYSLPIKEAEIIDHFLPDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 799
            MSTVPARTSFGRGRRGRGRGRGRGRGRGEKDSKEWEPCTKLGLLVKAGKVKSLEDTYIYSLPIKEAEIIDHFLPDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL
Sbjct:    1 MSTVPARTSFGRGRRGRGRGRGRGRGRGEKDSKEWEPCTKLGLLVKAGKVKSLEDTYIYSLPIKEAEIIDHFLPDLKDEVLSIKPVQKQTRAGQRTRFKAVVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGDTHTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSANGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL 247          
The following BLAST results are available for this feature:
BLAST of 40S ribosomal protein S2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPS21.910e-10072.94ribosomal protein S2 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPS21.454e-7879.87ribosomal protein S2 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPS26.982e-7879.87ribosomal protein S2 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPS28.513e-7878.53ribosomal protein S2 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPS24.080e-7272.67ribosomal protein S2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of 40S ribosomal protein S2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rps-21.271e-9768.4940S ribosomal protein S2 [Source:UniProtKB/Swiss-... [more]
rps-21.271e-9768.4940S ribosomal protein S2 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of 40S ribosomal protein S2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RpS27.073e-10775.00gene:FBgn0004867 transcript:FBtr0079905[more]
RpS27.073e-10775.00gene:FBgn0004867 transcript:FBtr0330682[more]
RpS27.073e-10775.00gene:FBgn0004867 transcript:FBtr0345436[more]
mRpS53.686e-721.89gene:FBgn0044510 transcript:FBtr0111147[more]
mRpS53.686e-721.89gene:FBgn0044510 transcript:FBtr0111146[more]
back to top
BLAST of 40S ribosomal protein S2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rps23.672e-10173.18ribosomal protein S2 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
rps23.672e-10173.18ribosomal protein S2 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
rps27.820e-1974.29ribosomal protein S2 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of 40S ribosomal protein S2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rps21.823e-10073.39ribosomal protein S2 [Source:NCBI gene;Acc:493255][more]
rps21.224e-5669.80ribosomal protein S2 [Source:NCBI gene;Acc:493255][more]
back to top
BLAST of 40S ribosomal protein S2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rps22.724e-10072.94ribosomal protein S2 [Source:MGI Symbol;Acc:MGI:10... [more]
Rps22.724e-10072.94ribosomal protein S2 [Source:MGI Symbol;Acc:MGI:10... [more]
Rps21.754e-9974.41ribosomal protein S2 [Source:MGI Symbol;Acc:MGI:10... [more]
Rps21.370e-9874.41ribosomal protein S2 [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of 40S ribosomal protein S2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P31009|RS2_DROME7.090e-10675.0040S ribosomal protein S2 OS=Drosophila melanogaste... [more]
sp|Q90YS3|RS2_ICTPU4.374e-10073.8540S ribosomal protein S2 OS=Ictalurus punctatus OX... [more]
sp|P15880|RS2_HUMAN9.173e-10072.9440S ribosomal protein S2 OS=Homo sapiens OX=9606 G... [more]
sp|O18789|RS2_BOVIN1.141e-9972.9440S ribosomal protein S2 OS=Bos taurus OX=9913 GN=... [more]
sp|P27952|RS2_RAT1.905e-9972.9440S ribosomal protein S2 OS=Rattus norvegicus OX=1... [more]
back to top
BLAST of 40S ribosomal protein S2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q56A618.272e-10976.96MGC115171 protein OS=Xenopus laevis OX=8355 GN=MGC... [more]
A0A0V0J8X31.187e-10877.83S5 DRBM domain-containing protein OS=Schistocephal... [more]
A0A504Z3073.139e-10876.85Small subunit ribosomal protein S2e OS=Fasciola gi... [more]
A0A4E0RD653.139e-10876.85Small subunit ribosomal protein S2e OS=Fasciola he... [more]
A0A5J4ND134.489e-10876.50Small subunit ribosomal protein S2e (Fragment) OS=... [more]
back to top
BLAST of 40S ribosomal protein S2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rps22.528e-10072.73ribosomal protein S2 [Source:NCBI gene;Acc:1030406... [more]
back to top
BLAST of 40S ribosomal protein S2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005507.14.288e-10171.36pep scaffold:Pmarinus_7.0:GL477092:2171:5823:-1 ge... [more]
back to top
BLAST of 40S ribosomal protein S2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
RPS21.667e-8963.03Protein component of the small (40S) subunit; esse... [more]
YGL123C-A_mRNA2.390e-650.00Dubious open reading frame; unlikely to encode a f... [more]
MRPS56.048e-631.61Mitochondrial ribosomal protein of the small subun... [more]
back to top
BLAST of 40S ribosomal protein S2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO483892.424e-10172.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 40S ribosomal protein S2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rps24.479e-10172.73ribosomal protein S2 [Source:NCBI gene;Acc:1011637... [more]
back to top
BLAST of 40S ribosomal protein S2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000051503.14.816e-156100.00SMESG000051503.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003176 ID=SMED30003176|Name=40S ribosomal protein S2|organism=Schmidtea mediterranea sexual|type=transcript|length=844bp
TATATGTTATCAAACTTTGTTTAAATTATTGAATTTATGTTAAATATTAA
ATTTTGAAATGTCTACAGTACCAGCAAGAACTAGTTTTGGAAGAGGTCGA
AGAGGGCGTGGTCGAGGTCGTGGACGAGGACGTGGACGAGGAGAAAAAGA
TTCAAAGGAATGGGAACCTTGCACTAAATTGGGTCTTTTGGTAAAGGCTG
GAAAAGTCAAGAGTTTAGAAGATACATACATTTACAGTTTACCGATTAAA
GAAGCTGAAATCATTGATCATTTTTTGCCTGATTTAAAAGATGAAGTTCT
CTCAATTAAGCCAGTTCAAAAACAAACACGTGCAGGTCAAAGAACCCGAT
TTAAGGCTGTTGTAGCTCTCGGTGACAATAACGGTCATGTTGGACTTGGA
GTTAAATGTGCTAAAGAAGTAGCAACCGCTATTAGAGGAGCTATTATTCA
AGCCAAACTTTCAGTTATTCCAGTAAGAAAGGGCTACTGGGGTAACAAAA
TCGGAGACACACACACTGTTCCATCAAAGGTTACAGGTAAATGTGGATCA
GTAAGTGTCCGACTTATTCCTGCCCCAAGAGGTACTGGAATTGTCGGAGC
TCCAGTTACTAAAAAACTTTTAAGTATGGCTGGAATTCAAGATGTTTATA
CTAGTGCTAATGGACAAACCGCAACTTTGGAAAATTTTGCCAAAGCAACC
TATATGGCTATTAGGAAAACATACGAATACTTGTCACCGGAATTGTGGAA
TGTTGCACCAAGCACCCAATACCCATTCGATGAACACGCAAAATTCTTGT
AAATCAATAAAATAATTTGGATTTTTAAAAAAAAAGATCGGAAG
back to top

protein sequence of SMED30003176-orf-1

>SMED30003176-orf-1 ID=SMED30003176-orf-1|Name=SMED30003176-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=248bp
MSTVPARTSFGRGRRGRGRGRGRGRGRGEKDSKEWEPCTKLGLLVKAGKV
KSLEDTYIYSLPIKEAEIIDHFLPDLKDEVLSIKPVQKQTRAGQRTRFKA
VVALGDNNGHVGLGVKCAKEVATAIRGAIIQAKLSVIPVRKGYWGNKIGD
THTVPSKVTGKCGSVSVRLIPAPRGTGIVGAPVTKKLLSMAGIQDVYTSA
NGQTATLENFAKATYMAIRKTYEYLSPELWNVAPSTQYPFDEHAKFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005711Ribosomal_S5_euk/arc
IPR000851Ribosomal_S5
IPR014720dsRBD_dom
IPR013810Ribosomal_S5_N
IPR005324Ribosomal_S5_C
IPR014721Ribosomal_S5_D2-typ_fold_subgr
IPR018192Ribosomal_S5_N_CS
IPR020568Ribosomal_S5_D2-typ_fold
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0000228nuclear chromosome
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0015935small ribosomal subunit
GO:0022626cytosolic ribosome
GO:0022627cytosolic small ribosomal subunit
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0002181cytoplasmic translation
GO:0007275multicellular organism development
GO:0030154cell differentiation
GO:0048477oogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005324Ribosomal protein S5, C-terminalPFAMPF03719Ribosomal_S5_Ccoord: 159..225
e-value: 5.3E-23
score: 80.3
IPR014721Ribosomal protein S5 domain 2-type fold, subgroupGENE3DG3DSA:3.30.230.10coord: 139..232
e-value: 2.3E-47
score: 161.3
IPR005711Ribosomal protein S5, eukaryotic/archaealTIGRFAMTIGR01020TIGR01020coord: 30..232
e-value: 2.8E-92
score: 305.9
IPR013810Ribosomal protein S5, N-terminalPFAMPF00333Ribosomal_S5coord: 76..140
e-value: 5.7E-29
score: 99.9
IPR013810Ribosomal protein S5, N-terminalPROSITEPS50881S5_DSRBDcoord: 76..139
score: 23.083
NoneNo IPR availableGENE3DG3DSA:3.30.160.770coord: 34..138
e-value: 3.7E-50
score: 170.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..33
NoneNo IPR availablePANTHERPTHR13718:SF85coord: 8..245
NoneNo IPR availableSUPERFAMILYSSF54768dsRNA-binding domain-likecoord: 70..140
IPR000851Ribosomal protein S5PANTHERPTHR13718RIBOSOMAL S SUBUNITcoord: 8..245
IPR018192Ribosomal protein S5, N-terminal, conserved sitePROSITEPS00585RIBOSOMAL_S5coord: 93..125
IPR020568Ribosomal protein S5 domain 2-type foldSUPERFAMILYSSF54211Ribosomal protein S5 domain 2-likecoord: 152..230