Potassium voltage-gated channel subfamily A member 2

Overview
NamePotassium voltage-gated channel subfamily A member 2
Smed IDSMED30003169
Length (bp)1867
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium voltage-gated channel subfamily A member 2 (SMED30003169) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium voltage-gated channel subfamily A member 2 (SMED30003169) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003169

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003169SMESG000069004.1 dd_Smed_v4_13717_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003169SMESG000069004.1 dd_Smed_v4_13717_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30003169SMESG000069004.1 dd_Smed_v4_13717_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 504.212 bits (1297), Expect = 1.578e-172
Identity = 278/437 (63.62%), Postives = 338/437 (77.35%), Query Frame = 3
Query:  357 SERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEEND-----IPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDS---FSSYASDEKTLLSESCFNSQKSNTLVSEKNN 1643
             ER+VIN+SGLRFET+LKTL QFP TLLG+P +R +Y+D LRNEYFFDRNRPSFD ILY+YQSGG +RRP NV +++F EEI FY+LGEEA+EK+R++EGF++EE + LP    Q+++WLL EYPESS  A+ +AI+SVLVI++SIVIFC+ETLP FR  +  P  ST  ++ E              SF++PFF++ET+CIIWFSFELL+RF + P K  F++NIMN+ID V+I+PYFITLGT L +   +  QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD  T+ F SIPD FWWA+VTMTTVGYGDM PVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+HV S    SS A + +   S S  +  KS  +V E+  
Sbjct:  103 GERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPA-STSQDSFEAAGNSTSGSRAGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLS--KSEYMVIEEGG 536          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 498.434 bits (1282), Expect = 2.094e-171
Identity = 278/455 (61.10%), Postives = 335/455 (73.63%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDI------PSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQ---NQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKT 1685
            ++  ER+VIN+SGLRFET+LKTL QFP TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEA+E +R++EG++KEE + LP N+ Q+++WLL EYPESS  A+ +AI+SV+VI++SIV FC+ETLP FR            + + +H   N         SFT+PFFI+ET+CIIWFSFE L+RF + P K  F  NIMNIID V+I+PYFITLGT L + P+      QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+ V S     S      S S     KS+ +  ++  N   E  +E N KT
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDEN----EDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKT 479          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 498.434 bits (1282), Expect = 2.094e-171
Identity = 278/455 (61.10%), Postives = 335/455 (73.63%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDI------PSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQ---NQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKT 1685
            ++  ER+VIN+SGLRFET+LKTL QFP TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEA+E +R++EG++KEE + LP N+ Q+++WLL EYPESS  A+ +AI+SV+VI++SIV FC+ETLP FR            + + +H   N         SFT+PFFI+ET+CIIWFSFE L+RF + P K  F  NIMNIID V+I+PYFITLGT L + P+      QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+ V S     S      S S     KS+ +  ++  N   E  +E N KT
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDEN----EDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKT 479          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 498.434 bits (1282), Expect = 2.094e-171
Identity = 278/455 (61.10%), Postives = 335/455 (73.63%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDI------PSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQ---NQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKT 1685
            ++  ER+VIN+SGLRFET+LKTL QFP TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEA+E +R++EG++KEE + LP N+ Q+++WLL EYPESS  A+ +AI+SV+VI++SIV FC+ETLP FR            + + +H   N         SFT+PFFI+ET+CIIWFSFE L+RF + P K  F  NIMNIID V+I+PYFITLGT L + P+      QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+ V S     S      S S     KS+ +  ++  N   E  +E N KT
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDEN----EDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKT 479          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 498.434 bits (1282), Expect = 2.094e-171
Identity = 278/455 (61.10%), Postives = 335/455 (73.63%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDI------PSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQ---NQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKT 1685
            ++  ER+VIN+SGLRFET+LKTL QFP TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEA+E +R++EG++KEE + LP N+ Q+++WLL EYPESS  A+ +AI+SV+VI++SIV FC+ETLP FR            + + +H   N         SFT+PFFI+ET+CIIWFSFE L+RF + P K  F  NIMNIID V+I+PYFITLGT L + P+      QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+ V S     S      S S     KS+ +  ++  N   E  +E N KT
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDEN----EDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKT 479          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 343.199 bits (879), Expect = 3.903e-112
Identity = 186/391 (47.57%), Postives = 283/391 (72.38%), Query Frame = 3
Query:  339 SHGYQNSERIV-INVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE 1508
            + G+  +++IV INVSG+RF+T   TL+++PN+LLG+  KR  ++ +  NE+FFDR+R +F+ ILY YQSGG ++RP  V +++F++E+ F+++G++ +E++   EG+ K +  ++P N+ Q++IW L+EYP+SS+ A+ +A IS+ VI LSI+ FC ET+P+      KP+N++ +  +   ++E        PFF IE MCI+WF+ EL+LRF S P K+ FA +++NIIDFV+I P+F+       D  KS N + S A+LR++RLVRVFR+FKLSRHS GLQILG+T ++S++E  +L FF+ I ++LF+S  YF E     + F SIP  FW+ LVTMTTVGYGD+ P++ +GK+VG +CA+ GVLT+ALPVP+IV+NF +FY +E
Sbjct:   36 TQGHPYTDQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPS--DIEEKPINNSATAELLDEMDEKHY----SPFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFVNF--FFADTSKS-NSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHFYRQE 417          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 343.199 bits (879), Expect = 3.903e-112
Identity = 186/391 (47.57%), Postives = 283/391 (72.38%), Query Frame = 3
Query:  339 SHGYQNSERIV-INVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE 1508
            + G+  +++IV INVSG+RF+T   TL+++PN+LLG+  KR  ++ +  NE+FFDR+R +F+ ILY YQSGG ++RP  V +++F++E+ F+++G++ +E++   EG+ K +  ++P N+ Q++IW L+EYP+SS+ A+ +A IS+ VI LSI+ FC ET+P+      KP+N++ +  +   ++E        PFF IE MCI+WF+ EL+LRF S P K+ FA +++NIIDFV+I P+F+       D  KS N + S A+LR++RLVRVFR+FKLSRHS GLQILG+T ++S++E  +L FF+ I ++LF+S  YF E     + F SIP  FW+ LVTMTTVGYGD+ P++ +GK+VG +CA+ GVLT+ALPVP+IV+NF +FY +E
Sbjct:   36 TQGHPYTDQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPS--DIEEKPINNSATAELLDEMDEKHY----SPFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFVNF--FFADTSKS-NSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHFYRQE 417          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 343.199 bits (879), Expect = 6.682e-112
Identity = 190/391 (48.59%), Postives = 286/391 (73.15%), Query Frame = 3
Query:  339 SHGYQNSERIV-INVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE 1508
            + G+  +++IV INVSG+RF+T   TL+++PN+LLG+  KR  ++ +  NE+FFDR+R +F+ ILY YQSGG ++RP  V +++F++E+ F+++G++ +E++   EG+ K +  ++P N+ Q++IW L+EYP+SS+ A+ +A IS+ VI LSI+ FC ET+P+      KP+N  +S T E  ++E D   ++ PFF IE MCI+WF+ EL+LRF S P K+ FA +++NIIDFV+I P+F+       D  KS N + S A+LR++RLVRVFR+FKLSRHS GLQILG+T ++S++E  +L FF+ I ++LF+S  YF E     + F SIP  FW+ LVTMTTVGYGD+ P++ +GK+VG +CA+ GVLT+ALPVP+IV+NF +FY +E
Sbjct:   49 TQGHPYTDQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPS--DIEEKPIN--NSATAEL-LDEMDEKHYS-PFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFVNF--FFADTSKS-NSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHFYRQE 430          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 343.584 bits (880), Expect = 1.247e-111
Identity = 187/391 (47.83%), Postives = 286/391 (73.15%), Query Frame = 3
Query:  339 SHGYQNSERIV-INVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE 1508
            + G+  +++IV INVSG+RF+T   TL+++PN+LLG+  KR  ++ +  NE+FFDR+R +F+ ILY YQSGG ++RP  V +++F++E+ F+++G++ +E++   EG+ K +  ++P N+ Q++IW L+EYP+SS+ A+ +A IS+ VI LSI+ FC ET+P+      KP+N++ +  +   ++E D   ++ PFF IE MCI+WF+ EL+LRF S P K+ FA +++NIIDFV+I P+F+       D  KS N + S A+LR++RLVRVFR+FKLSRHS GLQILG+T ++S++E  +L FF+ I ++LF+S  YF E     + F SIP  FW+ LVTMTTVGYGD+ P++ +GK+VG +CA+ GVLT+ALPVP+IV+NF +FY +E
Sbjct:   82 TQGHPYTDQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPS--DIEEKPINNSATAEL---LDEMDEKHYS-PFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFVNF--FFADTSKS-NSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHFYRQE 463          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 343.199 bits (879), Expect = 6.010e-111
Identity = 188/400 (47.00%), Postives = 287/400 (71.75%), Query Frame = 3
Query:  309 KNTNSENLTFSHGYQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE 1508
            + T   + T  H Y + + + INVSG+RF+T   TL+++PN+LLG+  KR  ++ +  NE+FFDR+R +F+ ILY YQSGG ++RP  V +++F++E+ F+++G++ +E++   EG+ K +  ++P N+ Q++IW L+EYP+SS+ A+ +A IS+ VI LSI+ FC ET+P+      KP+N++ +  +   ++E D   ++ PFF IE MCI+WF+ EL+LRF S P K+ FA +++NIIDFV+I P+F+       D  KS N + S A+LR++RLVRVFR+FKLSRHS GLQILG+T ++S++E  +L FF+ I ++LF+S  YF E     + F SIP  FW+ LVTMTTVGYGD+ P++ +GK+VG +CA+ GVLT+ALPVP+IV+NF +FY +E
Sbjct:  117 RGTPDTSSTQGHPYTD-QIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPS--DIEEKPINNSATAEL---LDEMDEKHYS-PFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFVNF--FFADTSKS-NSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHFYRQE 506          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0346706)

HSP 1 Score: 513.842 bits (1322), Expect = 1.688e-175
Identity = 270/410 (65.85%), Postives = 334/410 (81.46%), Query Frame = 3
Query:  342 HGYQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMD--------------NPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQ 1529
            H +   ER+VINVSGLRFET+L+TLNQFP+TLLG+P +R +Y+D LRNEYFFDR+RPSFD ILY+YQSGG LRRP NV ++VF EEI FYELG++AI K+R++EGF+KEE + LP N+ Q+++WLL EYPESS  A+ VAIISV VI+LSIVIFC+ETLP F+ Y+V   N+T + T    IEE+++P  T+PFF+IET+CIIWF+FEL +RF + P KL F +++MN+ID ++I+PYFITL T++ +                KS NQA SLAILR+IRLVRVFRIFKLSRHSKGLQILG+TLKAS+ EL +L FFL I V+LFSSA YF EA  ++++F+SIPDGFWWA+VTMTTVGYGDMRPV +WGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE + +E Q
Sbjct:   91 HDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKV--FNTTTNGT---KIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSDSSFFKSIPDGFWWAVVTMTTVGYGDMRPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQEEMQ 495          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0089660)

HSP 1 Score: 506.523 bits (1303), Expect = 7.640e-174
Identity = 272/421 (64.61%), Postives = 334/421 (79.33%), Query Frame = 3
Query:  342 HGYQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMD--------------NPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQV--YIHVDSFS 1556
            H +   ER+VINVSGLRFET+L+TLNQFP+TLLG+P +R +Y+D LRNEYFFDR+RPSFD ILY+YQSGG LRRP NV ++VF EEI FYELG++AI K+R++EGF+KEE + LP N+ Q+++WLL EYPESS  A+ VAIISV VI+LSIVIFC+ETLP F+ Y+V   N+T + T    IEE+++P  T+PFF+IET+CIIWF+FEL +RF + P KL F +++MN+ID ++I+PYFITL T++ +                KS NQA SLAILR+IRLVRVFRIFKLSRHSKGLQILG+TLKAS+ EL +L FFL I V+LFSSA YF EA  E ++F+SIPD FWWA+VTMTTVGYGDM PV  WGKIVGSLC IAGVLTIALPVPVIVSNFNYFYHRE + +E Q   + HV S S
Sbjct:   46 HDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKV--FNTTTNGT---KIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGFWGKIVGSLCVIAGVLTIALPVPVIVSNFNYFYHRETDQEEMQSQNFNHVTSCS 461          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0089657)

HSP 1 Score: 508.834 bits (1309), Expect = 1.451e-173
Identity = 269/410 (65.61%), Postives = 331/410 (80.73%), Query Frame = 3
Query:  342 HGYQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMD--------------NPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQ 1529
            H +   ER+VINVSGLRFET+L+TLNQFP+TLLG+P +R +Y+D LRNEYFFDR+RPSFD ILY+YQSGG LRRP NV ++VF EEI FYELG++AI K+R++EGF+KEE + LP N+ Q+++WLL EYPESS  A+ VAIISV VI+LSIVIFC+ETLP F+ Y+V   N+T + T    IEE+++P  T+PFF+IET+CIIWF+FEL +RF + P KL F +++MN+ID ++I+PYFITL T++ +                KS NQA SLAILR+IRLVRVFRIFKLSRHSKGLQILG+TLKAS+ EL +L FFL I V+LFSSA YF EA  E ++F+SIPD FWWA+VTMTTVGYGDM PV +WGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE + +E Q
Sbjct:   91 HDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKV--FNTTTNGT---KIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQEEMQ 495          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0302903)

HSP 1 Score: 508.064 bits (1307), Expect = 2.276e-173
Identity = 269/410 (65.61%), Postives = 331/410 (80.73%), Query Frame = 3
Query:  342 HGYQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMD--------------NPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQ 1529
            H +   ER+VINVSGLRFET+L+TLNQFP+TLLG+P +R +Y+D LRNEYFFDR+RPSFD ILY+YQSGG LRRP NV ++VF EEI FYELG++AI K+R++EGF+KEE + LP N+ Q+++WLL EYPESS  A+ VAIISV VI+LSIVIFC+ETLP F+ Y+V   N+T + T    IEE+++P  T+PFF+IET+CIIWF+FEL +RF + P KL F +++MN+ID ++I+PYFITL T++ +                KS NQA SLAILR+IRLVRVFRIFKLSRHSKGLQILG+TLKAS+ EL +L FFL I V+LFSSA YF EA  E ++F+SIPD FWWA+VTMTTVGYGDM PV +WGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE + +E Q
Sbjct:   79 HDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKV--FNTTTNGT---KIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQEEMQ 483          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0089661)

HSP 1 Score: 508.064 bits (1307), Expect = 2.276e-173
Identity = 269/410 (65.61%), Postives = 331/410 (80.73%), Query Frame = 3
Query:  342 HGYQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMD--------------NPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQ 1529
            H +   ER+VINVSGLRFET+L+TLNQFP+TLLG+P +R +Y+D LRNEYFFDR+RPSFD ILY+YQSGG LRRP NV ++VF EEI FYELG++AI K+R++EGF+KEE + LP N+ Q+++WLL EYPESS  A+ VAIISV VI+LSIVIFC+ETLP F+ Y+V   N+T + T    IEE+++P  T+PFF+IET+CIIWF+FEL +RF + P KL F +++MN+ID ++I+PYFITL T++ +                KS NQA SLAILR+IRLVRVFRIFKLSRHSKGLQILG+TLKAS+ EL +L FFL I V+LFSSA YF EA  E ++F+SIPD FWWA+VTMTTVGYGDM PV +WGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE + +E Q
Sbjct:   79 HDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKV--FNTTTNGT---KIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQEEMQ 483          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna2b (potassium voltage-gated channel, shaker-related subfamily, member 2b [Source:ZFIN;Acc:ZDB-GENE-080204-89])

HSP 1 Score: 502.671 bits (1293), Expect = 2.764e-173
Identity = 286/452 (63.27%), Postives = 342/452 (75.66%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFR--QYRVKPVNSTDSN-TIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTIL---MDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKT 1685
            ++  ER+VIN+SGLRFET+LKTL+QFP TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEAIE +R++EGF+KEE K+LP N+ Q+++WLL EYPESS  A+ +AIISV+VI++SIV FC+ETLP FR  +  +     TDSN TI Y         FT+PFFI+ET+CIIWFSFE L+RF + P K  F  NIMNIID V+I+PYFITLGT L    ++ +   QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y++V S     S E    S S     KS+ +  ++  N   E  +E N KT
Sbjct:   29 HECCERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAIEMFREDEGFIKEEEKLLPENEFQRQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPVFRNEETDMHKAYRTDSNSTISYTST-----YFTDPFFILETLCIIWFSFEFLVRFFACPSKAGFFVNIMNIIDIVAIIPYFITLGTELAEKAEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPDSQFVSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLNVTSVPKIDSSEDLKKSRSGSTMSKSDYMEIQEAVNNSNEDFREENIKT 475          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 489.96 bits (1260), Expect = 3.055e-168
Identity = 275/437 (62.93%), Postives = 337/437 (77.12%), Query Frame = 3
Query:  306 GKNTNSENLTFSHGYQNS-------ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPS-FTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQN-------QATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASD 1571
            G N +  + T     Q+S       ER+VIN+SGLRFET+LKTL QFPNTLLGNP KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEA+EK+R++EGF++EE + LP N+ Q++IWLL E+PESS  A+ +AI+SV+VI++SIVIFC+ETLP  ++     +    ++T  Y       P+  T+PFF++ET+CIIWFSFEL++RF + P K  F KN+MN ID VSI+PYFITLGT + ++P+          QATSLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EA+ + ++F SIPD FWWA+V+MTTVGYGDM PVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E DE+   + V S  + ASD
Sbjct:    7 GDNMDETSSTLQGQPQDSQYSPECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIREEERPLPDNEFQRQIWLLFEHPESSGPARGIAIVSVMVILISIVIFCLETLPELKEDPQGRLQVIGNSTFYYK------PNILTDPFFVVETLCIIWFSFELIVRFFACPSKPAFFKNMMNTIDVVSIIPYFITLGTEMAEDPEGGKEAKGGGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEKDSFFTSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGDEQAQLLTV-SNPNIASD 436          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 489.96 bits (1260), Expect = 3.055e-168
Identity = 275/437 (62.93%), Postives = 337/437 (77.12%), Query Frame = 3
Query:  306 GKNTNSENLTFSHGYQNS-------ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPS-FTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQN-------QATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASD 1571
            G N +  + T     Q+S       ER+VIN+SGLRFET+LKTL QFPNTLLGNP KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEA+EK+R++EGF++EE + LP N+ Q++IWLL E+PESS  A+ +AI+SV+VI++SIVIFC+ETLP  ++     +    ++T  Y       P+  T+PFF++ET+CIIWFSFEL++RF + P K  F KN+MN ID VSI+PYFITLGT + ++P+          QATSLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EA+ + ++F SIPD FWWA+V+MTTVGYGDM PVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E DE+   + V S  + ASD
Sbjct:    7 GDNMDETSSTLQGQPQDSQYSPECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIREEERPLPDNEFQRQIWLLFEHPESSGPARGIAIVSVMVILISIVIFCLETLPELKEDPQGRLQVIGNSTFYYK------PNILTDPFFVVETLCIIWFSFELIVRFFACPSKPAFFKNMMNTIDVVSIIPYFITLGTEMAEDPEGGKEAKGGGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEKDSFFTSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGDEQAQLLTV-SNPNIASD 436          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna2a (potassium voltage-gated channel, shaker-related subfamily, member 2a [Source:ZFIN;Acc:ZDB-GENE-131113-1])

HSP 1 Score: 486.493 bits (1251), Expect = 7.053e-167
Identity = 285/469 (60.77%), Postives = 343/469 (73.13%), Query Frame = 3
Query:  360 ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFR----QYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTIL---MDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKTKS---------SLRSPLTDV 1718
            ER+VIN+SGLRFET+LKTL+QFP TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV ++VF EEI FYELG+EAIE +R++EGF+KEE + LP N+ QK++WLL EYPESS  A+ +AIISV+VI++SIV FC+ETLP FR    +    PVN  +S T        D      PFFI+ET+CIIWFSFE L+RF + P K  F  NIMN+ID V+I+PYFITLGT L    ++ +   QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+ V+      S E+   S S     KS+ +  ++  N   E  +E N KT +         +++  LTDV
Sbjct:   32 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDVFSEEIRFYELGDEAIEIFREDEGFIKEEERPLPDNEFQKQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRSDEEEMHKVPVNVNNSTTSYTSTYFTD------PFFILETLCIIWFSFEFLVRFFACPSKASFFVNIMNMIDVVAIIPYFITLGTELAEKAEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFYSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVN-VPKADSQEELKGSRSGSTISKSDYMEIQEGVNNSNEDFQEENLKTANCTLANTNYVNIKKMLTDV 493          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna2a (potassium voltage-gated channel, shaker-related subfamily, member 2a [Source:ZFIN;Acc:ZDB-GENE-131113-1])

HSP 1 Score: 486.493 bits (1251), Expect = 7.053e-167
Identity = 285/469 (60.77%), Postives = 343/469 (73.13%), Query Frame = 3
Query:  360 ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFR----QYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTIL---MDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKTKS---------SLRSPLTDV 1718
            ER+VIN+SGLRFET+LKTL+QFP TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV ++VF EEI FYELG+EAIE +R++EGF+KEE + LP N+ QK++WLL EYPESS  A+ +AIISV+VI++SIV FC+ETLP FR    +    PVN  +S T        D      PFFI+ET+CIIWFSFE L+RF + P K  F  NIMN+ID V+I+PYFITLGT L    ++ +   QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+ V+      S E+   S S     KS+ +  ++  N   E  +E N KT +         +++  LTDV
Sbjct:   32 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDVFSEEIRFYELGDEAIEIFREDEGFIKEEERPLPDNEFQKQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRSDEEEMHKVPVNVNNSTTSYTSTYFTD------PFFILETLCIIWFSFEFLVRFFACPSKASFFVNIMNMIDVVAIIPYFITLGTELAEKAEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFYSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVN-VPKADSQEELKGSRSGSTISKSDYMEIQEGVNNSNEDFQEENLKTANCTLANTNYVNIKKMLTDV 493          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 511.916 bits (1317), Expect = 5.534e-177
Identity = 281/437 (64.30%), Postives = 341/437 (78.03%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYR------VKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKN 1640
            ++  ER+VIN+SGLRFET+LKTL QFP+TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG +RRP NV +++F EEI FYELGEEA+EK+R++EGF++EE + LP N+ Q+++WLL EYPESS  A+ +AI+SVLVI++SIVIFC+ETLP FR  +      + P N T       +I      SFT+PFF++ET+CIIWFSFELL+RF + P K  F KNIMNIID V+I+PYFITLGT L +   +  QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD  ++ F SIPD FWWA+VTMTTVGYGDM PVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+HV S    +S+E    + S  +  KS  +V E+ 
Sbjct:   18 HECCERVVINISGLRFETQLKTLAQFPDTLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYELGEEAMEKFREDEGFIREEERPLPPNEFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDDKEYSGTALPPGNGTGP-----YISS----SFTDPFFVVETLCIIWFSFELLVRFFACPSKATFCKNIMNIIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLHVGSCQHLSSNEDLKKARSNSSLSKSEYMVIEEG 445          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: KCNA1 (potassium channel, voltage gated shaker related subfamily A, member 1 [Source:NCBI gene;Acc:100492822])

HSP 1 Score: 496.508 bits (1277), Expect = 1.029e-170
Identity = 269/405 (66.42%), Postives = 334/405 (82.47%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRV--KPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTIL--MDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDS 1550
            ++  ER+VINV+GLRFET+LKTL+QFPNTLLGNP KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEA+EK+R++EGF++EE + LP  + Q+++WLL EYPESS  A+ +AI+SV+VI++SIVIFC+ETLP  +  R+  + VN++   T+ Y   +++I  FT+PFF++ET+CIIWFSFEL++RF + P K  F KNIMN ID V+I+PYFITLGT +   + P+   QATSLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EA+ + ++F SIPD FWWA+V+MTTVGYGDM PVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+   +HV +
Sbjct:   30 HECCERVVINVAGLRFETQLKTLSQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIREEERPLPEKEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVIFCLETLPELKDERIFSRRVNNS---TVFY---KSNI--FTDPFFVVETLCIIWFSFELVVRFFACPSKPEFFKNIMNFIDIVAIIPYFITLGTEMAEQEGPQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEDESHFASIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVST 426          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: KCNA2 (potassium channel, voltage gated shaker related subfamily A, member 3 [Source:NCBI gene;Acc:100496794])

HSP 1 Score: 495.738 bits (1275), Expect = 2.439e-170
Identity = 279/452 (61.73%), Postives = 338/452 (74.78%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYH---IEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILM---DNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKT 1685
            ++  ER+VIN+SGLRFET+LKTL+QFP TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEA+E +R++EGF+KEE + LP N+ QK++WLL EYPESS  A+ +AIISV+VI++SIV FC+ETLP FR    + ++ +  N   Y    +      +FT+PFFI+ET+CIIWFSFE L+RF + P K  F  NIMNIID V+I+PYFITLGT L    ++ +   QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+ V S     S      S S     KS+ +  ++  N   E  +E N KT
Sbjct:   29 HECCERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEIFREDEGFIKEEERPLPDNEYQKQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPVFRDEN-EDMHGSGVNYYPYSNSTVRYQKSNTFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKTEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPDLQKSRSASTLSKSDYMEIQEGVNHSNEDFREKNLKT 479          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: KCNA5 (potassium channel, voltage gated shaker related subfamily A, member 5 [Source:NCBI gene;Acc:496997])

HSP 1 Score: 499.204 bits (1284), Expect = 8.157e-170
Identity = 277/451 (61.42%), Postives = 348/451 (77.16%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFR-QYRVKPVNSTDSNTIEYHIEENDIPS-FTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQN-QATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKTKS 1691
            +++++R++IN++GLRFET+L TLNQFP+TLLG+P KR +++D LRNEYFFDRNRPSFDGILYFYQSGG +RRP NV+++VF +EI FYELGEEA+E++R++EGF+K+E K LP N+ Q+++WL+ EYPESS  A+ +AI+SVLVI++SI+ FC+ETLP FR +  + P  S   N  + H      PS  T+PFFIIET C+IWF+FELL+RF + P K  F+KNIMNIID V+I+PYFITLGT L  +  +   QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   ++F SIPD FWWA+VTMTTVGYGDMRPVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE + +E QV +  +S S            SC    K +   +  + ++ LE ++ +N  T S
Sbjct:  165 HESNQRVIINIAGLRFETQLSTLNQFPDTLLGDPEKRMRFFDPLRNEYFFDRNRPSFDGILYFYQSGGKIRRPVNVSIDVFADEIRFYELGEEAMERFREDEGFIKDEEKPLPCNEFQRQVWLIFEYPESSSSARGIAIVSVLVILISIITFCLETLPEFRDENELPPALSKVLNDTQEHPSP---PSGLTDPFFIIETTCVIWFTFELLVRFFACPSKSDFSKNIMNIIDIVAIIPYFITLGTELAQHQTNNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPESHFSSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEE-QVMLKEESSSRQG---------SCAGDLKRSPSRASLSKSVHLENIEGINNGTGS 602          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: ENSXETT00000049277.1 (potassium channel, voltage gated shaker related subfamily A, member 6 [Source:NCBI gene;Acc:100492986])

HSP 1 Score: 486.108 bits (1250), Expect = 3.912e-167
Identity = 274/435 (62.99%), Postives = 336/435 (77.24%), Query Frame = 3
Query:  360 ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQN-QATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHV---DSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLK 1652
            ER+VIN+SGLRFET+L+TL+QFP TLLG+P KR +++D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F+EEI FYELGEE IE +RD+EGF+KEE + LP N  Q+++WLL EYPESS  A+ +AI+SVL+I++SIVIFC+ETLP FR+   +       N    H   N    FT+PFF+ ET+CIIWFSFELL+RF + P K  F KN+MN+ID V+I+PYFITLGT L +   S   QA SLAILR+IRLVRVFRIFKLSRHSKGLQILG+TL+AS+ EL +L FFL I VILFSSA YF E D   + F SIPD FWWA+V+MTTVGYGDM P+T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE + +E+  Y HV      SSY  D K   S+  FN  +S+ + SE+ ++++
Sbjct:   14 ERVVINISGLRFETQLRTLSQFPQTLLGDPRKRMRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPVDIFLEEIKFYELGEEVIEIFRDDEGFIKEEERPLPENDFQRQVWLLFEYPESSGPARGIAIVSVLIILISIVIFCLETLPEFREEARQSGGQPAVNGT--HTFTNS--PFTDPFFLTETLCIIWFSFELLVRFFACPSKPAFFKNMMNVIDIVAIIPYFITLGTELAEQQGSNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAETDDPESLFTSIPDAFWWAVVSMTTVGYGDMYPMTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQSQYTHVTCGQQPSSYG-DLKKSESKQSFN--RSDYMESEELDDMR 441          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna3 (potassium voltage-gated channel, shaker-related subfamily, member 3 [Source:MGI Symbol;Acc:MGI:96660])

HSP 1 Score: 501.901 bits (1291), Expect = 2.304e-172
Identity = 275/436 (63.07%), Postives = 338/436 (77.52%), Query Frame = 3
Query:  357 SERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPS----FTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDS---FSSYASDEKTLLSESCFNSQKSNTLVSEKNN 1643
             ER+VIN+SGLRFET+LKTL QFP TLLG+P +R +Y+D LRNEYFFDRNRPSFD ILY+YQSGG +RRP NV +++F EEI FY+LGEEA+EK+R++EGF++EE + LP    Q+++WLL EYPESS  A+ +AI+SVLVI++SIVIFC+ETLP FR  +  P + +       +   +  PS    F++PFF++ET+CIIWFSFELL+RF + P K  F++NIMN+ID V+I+PYFITLGT L +   +  QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD  ++ F SIPD FWWA+VTMTTVGYGDM PVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+HV S    SS A + +   S S  +  KS  +V E+  
Sbjct:   56 GERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASPSQDVFEAANNSTSGAPSGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYMHVGSCQHLSSSAEELRKARSNSTLS--KSEYMVIEEGG 489          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna2 (potassium voltage-gated channel, shaker-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96659])

HSP 1 Score: 499.204 bits (1284), Expect = 9.511e-172
Identity = 278/455 (61.10%), Postives = 334/455 (73.41%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDI------PSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQ---NQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKT 1685
            ++  ER+VIN+SGLRFET+LKTL QFP TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEA+E +R++EG++KEE + LP N+ Q+++WLL EYPESS  A+ +AI+SV+VI++SIV FC+ETLP FR              + +H   N         SFT+PFFI+ET+CIIWFSFE L+RF + P K  F  NIMNIID V+I+PYFITLGT L + P+      QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+ V S     S      S S     KS+ +  ++  N   E  +E N KT
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDEN----EDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKT 479          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna2 (potassium voltage-gated channel, shaker-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96659])

HSP 1 Score: 499.204 bits (1284), Expect = 9.511e-172
Identity = 278/455 (61.10%), Postives = 334/455 (73.41%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDI------PSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQ---NQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKT 1685
            ++  ER+VIN+SGLRFET+LKTL QFP TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEA+E +R++EG++KEE + LP N+ Q+++WLL EYPESS  A+ +AI+SV+VI++SIV FC+ETLP FR              + +H   N         SFT+PFFI+ET+CIIWFSFE L+RF + P K  F  NIMNIID V+I+PYFITLGT L + P+      QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+ V S     S      S S     KS+ +  ++  N   E  +E N KT
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDEN----EDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKT 479          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna2 (potassium voltage-gated channel, shaker-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96659])

HSP 1 Score: 499.204 bits (1284), Expect = 9.511e-172
Identity = 278/455 (61.10%), Postives = 334/455 (73.41%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDI------PSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQ---NQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKT 1685
            ++  ER+VIN+SGLRFET+LKTL QFP TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEA+E +R++EG++KEE + LP N+ Q+++WLL EYPESS  A+ +AI+SV+VI++SIV FC+ETLP FR              + +H   N         SFT+PFFI+ET+CIIWFSFE L+RF + P K  F  NIMNIID V+I+PYFITLGT L + P+      QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+ V S     S      S S     KS+ +  ++  N   E  +E N KT
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDEN----EDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKT 479          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna1 (potassium voltage-gated channel, shaker-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96654])

HSP 1 Score: 496.893 bits (1278), Expect = 6.685e-171
Identity = 270/405 (66.67%), Postives = 329/405 (81.23%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYR--VKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQN--QATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDS 1550
            ++  ER+VIN+SGLRFET+LKTL QFPNTLLGNP KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEA+EK+R++EGF+KEE + LP  + Q+++WLL EYPESS  A+ +AI+SV+VI++SIVIFC+ETLP  +  +     ++  D+ T+ Y    ++I  FT+PFFI+ET+CIIWFSFEL++RF + P K  F KNIMN ID V+I+PYFITLGT + +   +Q   QATSLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EA+   ++F SIPD FWWA+V+MTTVGYGDM PVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+   +HV S
Sbjct:   33 HECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKDDKDFTGTIHRIDNTTVIY---TSNI--FTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVSS 432          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P08510|KCNAS_DROME (Potassium voltage-gated channel protein Shaker OS=Drosophila melanogaster OX=7227 GN=Sh PE=1 SV=3)

HSP 1 Score: 508.834 bits (1309), Expect = 1.454e-172
Identity = 269/410 (65.61%), Postives = 331/410 (80.73%), Query Frame = 3
Query:  342 HGYQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMD--------------NPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQ 1529
            H +   ER+VINVSGLRFET+L+TLNQFP+TLLG+P +R +Y+D LRNEYFFDR+RPSFD ILY+YQSGG LRRP NV ++VF EEI FYELG++AI K+R++EGF+KEE + LP N+ Q+++WLL EYPESS  A+ VAIISV VI+LSIVIFC+ETLP F+ Y+V   N+T + T    IEE+++P  T+PFF+IET+CIIWF+FEL +RF + P KL F +++MN+ID ++I+PYFITL T++ +                KS NQA SLAILR+IRLVRVFRIFKLSRHSKGLQILG+TLKAS+ EL +L FFL I V+LFSSA YF EA  E ++F+SIPD FWWA+VTMTTVGYGDM PV +WGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE + +E Q
Sbjct:   91 HDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKV--FNTTTNGT---KIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQEEMQ 495          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P22001|KCNA3_HUMAN (Potassium voltage-gated channel subfamily A member 3 OS=Homo sapiens OX=9606 GN=KCNA3 PE=1 SV=3)

HSP 1 Score: 504.212 bits (1297), Expect = 7.580e-172
Identity = 278/437 (63.62%), Postives = 338/437 (77.35%), Query Frame = 3
Query:  357 SERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEEND-----IPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDS---FSSYASDEKTLLSESCFNSQKSNTLVSEKNN 1643
             ER+VIN+SGLRFET+LKTL QFP TLLG+P +R +Y+D LRNEYFFDRNRPSFD ILY+YQSGG +RRP NV +++F EEI FY+LGEEA+EK+R++EGF++EE + LP    Q+++WLL EYPESS  A+ +AI+SVLVI++SIVIFC+ETLP FR  +  P  ST  ++ E              SF++PFF++ET+CIIWFSFELL+RF + P K  F++NIMN+ID V+I+PYFITLGT L +   +  QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD  T+ F SIPD FWWA+VTMTTVGYGDM PVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+HV S    SS A + +   S S  +  KS  +V E+  
Sbjct:  103 GERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPA-STSQDSFEAAGNSTSGSRAGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLS--KSEYMVIEEGG 536          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P16390|KCNA3_MOUSE (Potassium voltage-gated channel subfamily A member 3 OS=Mus musculus OX=10090 GN=Kcna3 PE=1 SV=3)

HSP 1 Score: 501.901 bits (1291), Expect = 1.612e-171
Identity = 275/436 (63.07%), Postives = 338/436 (77.52%), Query Frame = 3
Query:  357 SERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPS----FTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDS---FSSYASDEKTLLSESCFNSQKSNTLVSEKNN 1643
             ER+VIN+SGLRFET+LKTL QFP TLLG+P +R +Y+D LRNEYFFDRNRPSFD ILY+YQSGG +RRP NV +++F EEI FY+LGEEA+EK+R++EGF++EE + LP    Q+++WLL EYPESS  A+ +AI+SVLVI++SIVIFC+ETLP FR  +  P + +       +   +  PS    F++PFF++ET+CIIWFSFELL+RF + P K  F++NIMN+ID V+I+PYFITLGT L +   +  QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD  ++ F SIPD FWWA+VTMTTVGYGDM PVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+HV S    SS A + +   S S  +  KS  +V E+  
Sbjct:   56 GERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASPSQDVFEAANNSTSGAPSGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYMHVGSCQHLSSSAEELRKARSNSTLS--KSEYMVIEEGG 489          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P63142|KCNA2_RAT (Potassium voltage-gated channel subfamily A member 2 OS=Rattus norvegicus OX=10116 GN=Kcna2 PE=1 SV=1)

HSP 1 Score: 499.204 bits (1284), Expect = 6.653e-171
Identity = 278/455 (61.10%), Postives = 334/455 (73.41%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDI------PSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQ---NQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKT 1685
            ++  ER+VIN+SGLRFET+LKTL QFP TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEA+E +R++EG++KEE + LP N+ Q+++WLL EYPESS  A+ +AI+SV+VI++SIV FC+ETLP FR              + +H   N         SFT+PFFI+ET+CIIWFSFE L+RF + P K  F  NIMNIID V+I+PYFITLGT L + P+      QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+ V S     S      S S     KS+ +  ++  N   E  +E N KT
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDEN----EDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKT 479          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P63141|KCNA2_MOUSE (Potassium voltage-gated channel subfamily A member 2 OS=Mus musculus OX=10090 GN=Kcna2 PE=1 SV=1)

HSP 1 Score: 499.204 bits (1284), Expect = 6.653e-171
Identity = 278/455 (61.10%), Postives = 334/455 (73.41%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDI------PSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQ---NQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKT 1685
            ++  ER+VIN+SGLRFET+LKTL QFP TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEA+E +R++EG++KEE + LP N+ Q+++WLL EYPESS  A+ +AI+SV+VI++SIV FC+ETLP FR              + +H   N         SFT+PFFI+ET+CIIWFSFE L+RF + P K  F  NIMNIID V+I+PYFITLGT L + P+      QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+ V S     S      S S     KS+ +  ++  N   E  +E N KT
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDEN----EDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKT 479          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A267G5V4 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003232g2 PE=3 SV=1)

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 301/419 (71.84%), Postives = 355/419 (84.73%), Query Frame = 3
Query:  354 NSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVE-TTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNS 1607
            + ER+VINVSGLRFET+LKTL QFP +LLG+P+KRN+YYD LRNEYFFDRNRPSFD ILYFYQSGG LRRP NV ++VF EEI FYELGEEAIEKYRD+EGF+KEEVKVLP ++ Q+++WLL EYPESSM A+ +AIISV VI+LSIVIFC+ETLP+FR Y+V  VN T  N   + IEE+DIP F EPFF+IET+CIIWF+FELL+RFASSP+KL F KN+MN ID V+I+PYFITLGT++ D+ +S NQA SLAILR+IRLVRVFRIFKLSRH KGLQILGQTL+AS+ EL +L FFLLI VILFSSA YF EAD    ++F SIP  FWWA+VTMTTVGYGDMRPVT+WGK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E+++KQ Y+H+ S  +Y+ D    + +S   S
Sbjct:  101 DCERVVINVSGLRFETQLKTLAQFPESLLGDPLKRNRYYDPLRNEYFFDRNRPSFDAILYFYQSGGRLRRPVNVPIDVFTEEIRFYELGEEAIEKYRDDEGFIKEEVKVLPEDEFQRKVWLLFEYPESSMAARVIAIISVCVILLSIVIFCMETLPHFRHYKV--VNDTFGNVTSHAIEEDDIPQFDEPFFVIETICIIWFTFELLVRFASSPEKLAFFKNMMNSIDIVAIIPYFITLGTVIADDSRS-NQAMSLAILRVIRLVRVFRIFKLSRHFKGLQILGQTLRASVRELGLLVFFLLISVILFSSAVYFAEADSALKSHFDSIPSAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYVHIQSCPAYSRDSNAAVQKSSLAS 516          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A267G5S4 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000768g3 PE=3 SV=1)

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 311/432 (71.99%), Postives = 361/432 (83.56%), Query Frame = 3
Query:  354 NSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYH-IEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEK--TLLSESCFNSQKSNTLVSEKN 1640
            + ER+VINVSGLRFET+LKTLNQFP+TLLGN  KRN+YYD LRNEYFFDRNRPSFD ILYFYQSGG LRRP NV ++VF EEI FYELGEEAIEKYRD+EGF+KEEVKVLP N+ Q+++WLL EYPESSM A+ +AIISV VI+LSIVIFCVETLP+FR+Y+V  VNS+  NT     IEE+DIP F EPFFIIET+CI+WF+FEL++RFASSP+KL F KNIMN ID V+I+PYFITLGT++ D+ +S NQA SLAILR+IRLVRVFRIFKLSRH KGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   ++F SIP  FWWA+VTMTTVGYGDMRPVT+WGK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E+++KQ Y+HV S  SY    K  +L+S S  +      L +E +
Sbjct:   27 DCERVVINVSGLRFETQLKTLNQFPDTLLGNSQKRNRYYDPLRNEYFFDRNRPSFDAILYFYQSGGRLRRPVNVPIDVFSEEIRFYELGEEAIEKYRDDEGFIKEEVKVLPENEFQRKVWLLFEYPESSMAARVIAIISVCVILLSIVIFCVETLPHFRRYKV--VNSSFGNTTYGQVIEEDDIPQFGEPFFIIETICIVWFTFELMVRFASSPEKLGFFKNIMNSIDIVAIIPYFITLGTVIADDSRS-NQAMSLAILRVIRLVRVFRIFKLSRHFKGLQILGQTLKASVRELGLLVFFLFISVILFSSAVYFAEADSTKSHFDSIPSAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYVHVQSCPSYRDGGKKNSLVSASRVSEASEVDLATEGH 455          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A448XC64 (BTB domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS26795 PE=3 SV=1)

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 303/433 (69.98%), Postives = 360/433 (83.14%), Query Frame = 3
Query:  354 NSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYH---IEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNN 1643
              +R+V NVSGLR+ET++ T++QFPNTLLGNP KRN+YYD LR+EYFFDRNRPSFDGILYFYQSGG LRRP NV +++F EEI FYELGEE +EKYR+EEGF+KE+ KVLPLN+ QKR+WLL EYPESSM A+FVAI SV++I+LSI+IFCVETLPNFR Y+V  VNSTD  +   +   IEE+DIP+  +PFFIIET+CIIWF+FELL+RFASSP K+ F K IMN+ID VSI+PYFITLGT ++D+P+SQNQATSLAILR+IRLVRVFRIFKLSRHSKGLQILGQTL+AS+ EL +L FFLLI VILFSSA YF EAD   T+F+SIPDGFWWA+VTMTTVGYGDMRPVT+WGK+VGSLCAIAGVLTIALPVPVIVSNFNYFYH E E +EK   IH     S  + +    SE   ++ +   +  ++N 
Sbjct:   25 TGQRVVFNVSGLRYETQIHTVSQFPNTLLGNPQKRNRYYDPLRDEYFFDRNRPSFDGILYFYQSGGRLRRPVNVPIDIFTEEIKFYELGEEVLEKYREEEGFIKEDTKVLPLNEFQKRVWLLFEYPESSMPARFVAITSVVIILLSIIIFCVETLPNFRHYKV--VNSTDPLSGVPNMPTIEEDDIPTLDQPFFIIETICIIWFTFELLVRFASSPGKVAFFKEIMNVIDIVSIIPYFITLGTAIVDDPRSQNQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASVRELGLLVFFLLISVILFSSAVYFAEADANNTFFKSIPDGFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHHETETEEK---IHPLLSGSVVASDLEYGSEHSLDTSREGCMDDDENG 452          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A1I8JAN4 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 311/432 (71.99%), Postives = 361/432 (83.56%), Query Frame = 3
Query:  354 NSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYH-IEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEK--TLLSESCFNSQKSNTLVSEKN 1640
            + ER+VINVSGLRFET+LKTLNQFP+TLLGN  KRN+YYD LRNEYFFDRNRPSFD ILYFYQSGG LRRP NV ++VF EEI FYELGEEAIEKYRD+EGF+KEEVKVLP N+ Q+++WLL EYPESSM A+ +AIISV VI+LSIVIFCVETLP+FR+Y+V  VNS+  NT     IEE+DIP F EPFFIIET+CI+WF+FEL++RFASSP+KL F KNIMN ID V+I+PYFITLGT++ D+ +S NQA SLAILR+IRLVRVFRIFKLSRH KGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   ++F SIP  FWWA+VTMTTVGYGDMRPVT+WGK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E+++KQ Y+HV S  SY    K  +L+S S  +      L +E +
Sbjct:   72 DCERVVINVSGLRFETQLKTLNQFPDTLLGNSQKRNRYYDPLRNEYFFDRNRPSFDAILYFYQSGGRLRRPVNVPIDVFSEEIRFYELGEEAIEKYRDDEGFIKEEVKVLPENEFQRKVWLLFEYPESSMAARVIAIISVCVILLSIVIFCVETLPHFRRYKV--VNSSFGNTTYGQVIEEDDIPQFGEPFFIIETICIVWFTFELMVRFASSPEKLGFFKNIMNSIDIVAIIPYFITLGTVIADDSRS-NQAMSLAILRVIRLVRVFRIFKLSRHFKGLQILGQTLKASVRELGLLVFFLFISVILFSSAVYFAEADSTKSHFDSIPSAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYVHVQSCPSYRDGGKKNSLVSASRVSEASEVDLATEGH 500          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A5J4NW91 (Potassium voltage-gated channel Shaker-related subfamily A member 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0000765 PE=3 SV=1)

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 298/427 (69.79%), Postives = 359/427 (84.07%), Query Frame = 3
Query:  273 LSISQETGKEFGKNTNSENLTFSHGYQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIE--YHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVD 1547
            L+ ++E G+E     +  ++T       +ER+VINVSGLRFET+L+T+NQFP+TLLGNP KR++YYD LRNEYFFDRNR SFDGILYFYQSGG LRRP NV ++VF EEI FYELGEEA+ KYR+EEGF+KEE K LP N+ Q+++WLL EYPESS  A+ +AI SVLVIVLSI+IFC+ETLP+FRQYRV  +N  +   +E  + IEE+D+P+  +PFFI+ET CI+WFS ELL+RFAS+P+KL F K +MN+ID VSI+PYFIT+G +++D+PK QNQ TSLA+LR+IRLVRVFRIFKLSRHSKGLQILGQTL+AS+ EL +L FFLLICVILFSSA YF EAD +T+ FRSIPDGFWWA+VTMTTVGYGDMRPVT+WGK++GSLCAIAGVLTIALPVPVIVSNFNYFYHRE E DEK V I  D
Sbjct:   29 LADTREVGEEEIDQISGSSIT--ESLPGAERLVINVSGLRFETQLRTVNQFPDTLLGNPKKRDQYYDPLRNEYFFDRNRSSFDGILYFYQSGGRLRRPVNVPIDVFTEEIKFYELGEEALTKYREEEGFIKEEPKSLPKNKFQRKVWLLFEYPESSFAARLLAIGSVLVIVLSIIIFCIETLPHFRQYRV--INEANHTELEKQFTIEEDDLPTVDQPFFIVETFCIVWFSCELLVRFASAPKKLAFFKVMMNVIDVVSILPYFITVGAVIIDDPKRQNQTTSLAVLRVIRLVRVFRIFKLSRHSKGLQILGQTLRASVRELGLLVFFLLICVILFSSAVYFAEADADTSLFRSIPDGFWWAVVTMTTVGYGDMRPVTLWGKLIGSLCAIAGVLTIALPVPVIVSNFNYFYHREAETDEKVVPIPTD 451          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: kcna2b (potassium voltage-gated channel subfamily A member 2 [Source:NCBI gene;Acc:103039676])

HSP 1 Score: 498.049 bits (1281), Expect = 1.392e-171
Identity = 281/449 (62.58%), Postives = 339/449 (75.50%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNP---KSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKT 1685
            ++  ER+VIN+SGLRFET+LKTL+QFP+TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEAIE +R++EGF+KEE K LP N+ Q+++WLL EYPESS  A+ +AIISV+VI++SIV FC+ETLP FR   +    +   N+       +    FT+PFFI+ET+CIIWFSFE L+RF + P K  F  NIMNIID V+I+PYFITLGT L ++P   +   QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y++V S     S E    S S     KS+ +  ++  N   E  +E N KT
Sbjct:   28 HECCERVVINISGLRFETQLKTLSQFPDTLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAIEIFREDEGFIKEEEKPLPENEFQRQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRNDDIDMRKTYPGNSNSTTSYTST--YFTDPFFILETLCIIWFSFEFLVRFFACPSKAGFFVNIMNIIDIVAIIPYFITLGTELAESPEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEADSQFVSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLNVTSVPKIDSTEDLKKSRSGSTMSKSDYMEIQEAVNNSHEDFREENLKT 474          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:NCBI gene;Acc:103031324])

HSP 1 Score: 496.508 bits (1277), Expect = 1.711e-170
Identity = 276/461 (59.87%), Postives = 341/461 (73.97%), Query Frame = 3
Query:  360 ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIP----SFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLL----SESCFNSQKSNTLVSEKNNNLKLEILKEMNEKTKSSLRSPLTDV 1718
            ER+VIN+SGLRFET+LKT +QFP+TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG +RRP NV ++VF EEI FY+LGEEA+EK+R++EGF+KEE + LP  + Q+++WLL EYPESS  A+ +AI+SVLVI++SIVIFC+ETLP FR  R +   +  +      +     P    +FT+PFF+IET+CI+WFSFELL+RF + P K  F+KNIMNIID V+I+PYFITLGT L +   +  QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+VTMTTVGYGDM PVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE + +E    ++  S     S +  LL    S S  +  +   +    +   +  +    N +   S++   TDV
Sbjct:   68 ERVVINISGLRFETQLKTFSQFPDTLLGDPRKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDVFSEEIRFYQLGEEAMEKFREDEGFIKEEERPLPSREFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDDR-EAAAAAAAAAAAVPLNNGTAPYGPGAFTDPFFVIETLCIVWFSFELLVRFFACPSKATFSKNIMNIIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPASSFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDGEEHAQCLNAGSSERVDSAQGELLERAHSTSSLSKPEYVAIEEALHGTFRQPVYPNQNSQNCVSVKKIFTDV 527          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: ENSAMXT00000027012.2 (potassium voltage-gated channel subfamily A member 2-like [Source:NCBI gene;Acc:103027793])

HSP 1 Score: 493.426 bits (1269), Expect = 5.007e-169
Identity = 272/422 (64.45%), Postives = 326/422 (77.25%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFR---------QYRVKPVNSTDSNTIEYHIEEN---DIPS------FTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQ---ATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDS 1550
            ++  ER+VIN+SGLRFET+LKTL QFP TLLG+P KR  Y+D LRNEYFFDRNRPSFD ILY+YQSGG +RRP NV ++VF EEI FYELGEEA+EK+R++EGF+KEE + LP  + Q+++WLL EYPESS  A+ +AI+SVLVI++SIVIFC+ETLP FR         +    P++  +    E H   N    +P       F++PFF++ET+CI+WFSFELL+RF + P K  F+KNIMNIID V+I+PYFITLGT L +  +       A SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+VTMTTVGYGDM PVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+HV S
Sbjct:   72 HECCERVVINISGLRFETQLKTLAQFPETLLGDPRKRTAYFDPLRNEYFFDRNRPSFDAILYYYQSGGRVRRPVNVPIDVFTEEIRFYELGEEAMEKFREDEGFIKEEERALPAGEFQRQVWLLFEYPESSGPARGIAIVSVLVILVSIVIFCLETLPEFRDDDSDVTRDRVGTTPLHMLNHYPNEMHGHGNLTGGLPPILSGTPFSDPFFVVETLCIVWFSFELLVRFFACPSKATFSKNIMNIIDIVAIIPYFITLGTELAERQQGNGGGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPDSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLHVAS 493          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: kcna2a (potassium voltage-gated channel subfamily A member 2 [Source:NCBI gene;Acc:103030675])

HSP 1 Score: 488.804 bits (1257), Expect = 5.419e-168
Identity = 285/470 (60.64%), Postives = 348/470 (74.04%), Query Frame = 3
Query:  360 ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQ-----YRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTIL---MDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTL-----VSEKNNNLKLEILKEMNEKTKSS----LRSPLTDV 1718
            ER+VIN+SGLRFET+LKTL+QFP TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEAIE +R++EGF+KEE + LP N+ QK++WLL EYPESS  A+ +AIISV+VI++SIV FC+ETLP FR      ++V+  NS  + +            FT+PFFI+ET+CIIWFSFE L+RF + P K  F  NIMN+ID V+I+PYFITLGT L    ++ +   QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+ V+      S E+   S S     KS+ +     V+  N +L+ E LK+ N    ++    ++  LTDV
Sbjct:   32 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAIEMFREDEGFIKEEERPLPDNEFQKQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRSDEEEMHKVRTYNSNSTTSYTST-------YFTDPFFILETLCIIWFSFEFLVRFFACPSKASFFVNIMNMIDVVAIIPYFITLGTELAEKAEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFYSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVN-VPKADSQEELKRSRSGSTISKSDYMEIQEGVNNSNEDLQEEDLKKGNCTLANTNYVNIKKMLTDV 493          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: kcna1a (potassium voltage-gated channel subfamily A member 1 [Source:NCBI gene;Acc:103039047])

HSP 1 Score: 477.633 bits (1228), Expect = 1.298e-163
Identity = 259/404 (64.11%), Postives = 321/404 (79.46%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSF-TEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQN----QATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHV 1544
            +   ER+VIN++GLRFET LKTL QFP TLLGNP KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP +V +++F EEI FYELG EA+EK+R++EGF++E+ + LP  + Q++IWLL E+PESS  A+ +AI+SV VI++SIVIFC+ETLP  ++     +    ++T  Y       PS  T+PFFI+ET+CIIWFSFEL++RF + P K  F K++MN ID V+I+PYFITLGT L ++P +++    QATSLAILR+IRLVRVFRIFKLSRHSKGLQILG TLKAS+ EL +L FFL I VILFSSA YF EA+   +YF SIPD FWWA+V+MTTVGYGDM PVT+ GK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+   ++V
Sbjct:   30 HDCCERVVINIAGLRFETELKTLAQFPETLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPASVPLDMFSEEIKFYELGYEAMEKFREDEGFIREKERPLPEAEFQRQIWLLFEHPESSGPARGIAIVSVTVILVSIVIFCLETLPQLKENPEGHIQIIGNSTFYYK------PSLLTDPFFIVETLCIIWFSFELIVRFLACPSKAAFFKDMMNTIDVVAIIPYFITLGTELAEDPNNKDGKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGLTLKASMRELGLLVFFLFIGVILFSSAVYFAEAEEADSYFGSIPDAFWWAVVSMTTVGYGDMVPVTIGGKVVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAKLLNV 427          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 509.605 bits (1311), Expect = 7.218e-177
Identity = 278/412 (67.48%), Postives = 334/412 (81.07%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYR-VKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKT 1580
            ++  ERIVINVSGLRFET+LK+L+QFP+TLLGNP KR++Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV+++VF EEI FYELG EA+ K++++EGF+KEE K LP ++ Q+++WLL EYPESS  A+ +AI+SVLVI++SI+IFC+ETLP FR  +  K + + D N  +  I      SFT+PFFI+ET+CIIWFSFELL+RF + P K  F K+IMNIID V+I+PYFITLGT +  +  S  QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD + + FRSIPD FWWA+VTMTTVGYGDMRPVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE + +E   Y+HV S S      K+
Sbjct:   24 HEYCERIVINVSGLRFETQLKSLDQFPDTLLGNPSKRSRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVSIDVFSEEIKFYELGNEAMAKFQEDEGFIKEEEKPLPSDEFQRQVWLLFEYPESSNPARGIAIVSVLVILISIIIFCLETLPEFRDEKEQKFLPAKDINGTQVKIMHGS--SFTDPFFIVETICIIWFSFELLVRFFACPSKPGFFKSIMNIIDIVAILPYFITLGTEMAKHQGSGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADHQNSEFRSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDNEEHANYLHVSSCSHQEESRKS 433          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 479.945 bits (1234), Expect = 5.637e-165
Identity = 262/408 (64.22%), Postives = 319/408 (78.19%), Query Frame = 3
Query:  345 GYQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQ----YRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQN--QATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDS 1550
            G+   ER+VINVSGLRFET+L+TL QFP+TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP +V  ++F EE+ FY+LGEE + +YR++EG+VKE  K LP N+ Q+++WLL EYPESS  A+ +AI+SVLVI++SI+IFC+ETLP FR     Y+V     T+     YH        F +PFFI+ET+CIIWFSFEL++RF + P K+ F KN+MNIID V+I+PYFITLGT + +   S N  Q  SLAILR+IRLVRVFRIFKLSRHSKGLQILG TL AS+ EL +L FFL I VILFSSA +F E D + T F+SIPD FWW+LVTMTTVGYGDM P T+ GKIVGSLCAIAGVLT++LPVPVIVSNFNYFY RE E +++ VY HV S
Sbjct:   33 GHDFCERVVINVSGLRFETQLRTLAQFPDTLLGDPQKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVSVPYDIFTEEVRFYDLGEETMLRYREDEGYVKEPEKPLPENEFQRQVWLLFEYPESSSPARAIAIVSVLVILISIIIFCLETLPEFRDDADLYKVS--YYTNGTHYFYH------NVFADPFFIMETICIIWFSFELMVRFCACPSKVEFGKNLMNIIDIVAIVPYFITLGTEMAEQTGSANGQQTMSLAILRVIRLVRVFRIFKLSRHSKGLQILGHTLHASMRELGLLIFFLFIGVILFSSAVFFAEVDSKKTEFQSIPDAFWWSLVTMTTVGYGDMSPKTVGGKIVGSLCAIAGVLTVSLPVPVIVSNFNYFYQRETEGEDQTVYSHVHS 432          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 433.721 bits (1114), Expect = 4.302e-148
Identity = 251/406 (61.82%), Postives = 297/406 (73.15%), Query Frame = 3
Query:  402 RLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPS-----------------FTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQN---QATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSS 1559
            +L+TL  FP+TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQS G LRRP NV  ++F EE+ FYELGEE + +YR++EG+VKEE K LP N +Q+++WLL EYPESS  A+ +AI+SVLVIV+SIVIF  ETLP FR       +  D ++   H       +                   +PFFI+ET+CI+WFSFELL+RF + P K  F KNIMN ID V+IMPYFITLGT L       N   Q  SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTL+AS+ EL +L FFL I VILFSSA YF E D   T+F SIP+ FWW+LVTMTTVGYGDM PVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHR  EA+E+ + +  DS  S
Sbjct:    1 QLRTLAHFPDTLLGDPQKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSRGKLRRPTNVPYDIFAEEVRFYELGEETMARYREDEGYVKEEEKPLPENALQRQVWLLFEYPESSNPARVIAIVSVLVIVISIVIFVAETLPEFR-------DDKDLHSGTRHDVGAGDAAVAAAGNSSGGSSGGGSGHADPFFIVETVCIVWFSFELLVRFCACPSKPGFFKNIMNTIDIVAIMPYFITLGTELAAQDTGANNGQQTMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVILFSSAIYFAEVDDPNTHFHSIPEAFWWSLVTMTTVGYGDMFPVTLGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRGSEAEEQTLSVQEDSGGS 399          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 370.933 bits (951), Expect = 3.982e-124
Identity = 206/381 (54.07%), Postives = 270/381 (70.87%), Query Frame = 3
Query:  360 ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYH 1502
            +R+VINVSG RFET+LKTL+QFP++LLG+P KR +Y+D L+NEYFFDR+  +FD IL++YQSGG L +P +V  +VF EE+ FYELGEEA+ KY +      EE  V      Q+ +W L E  + S+ AK ++++S +  +LSI + C+ETLP FR+      N   +N  E+ I  +      +PFF++ET C++WF FEL +RF + P K  F K+ MN ID ++IMPYFIT+   +M     Q   T   +L+IIRLVRV RIFKLSRH + LQILG TLKAS+ EL ML+FFL + V++FS A Y+VEAD    +F SIPD FWWA+VTMT VGYGDM P+T+ GKIVG+LCAI GVLTI+LPVPVIVSNF YFY+
Sbjct:    1 QRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVAKYGENTLDTPEEENVHG-KDFQQHVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKD-----NQVHANRTEFSIRTSIYN--LDPFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITVVLEIM----QQQDQTRQPLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVEADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYN 369          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 370.548 bits (950), Expect = 4.678e-124
Identity = 208/393 (52.93%), Postives = 277/393 (70.48%), Query Frame = 3
Query:  360 ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYI 1538
            +R+VINVSG RFET+LKTL+QFP++LLG+P KR +Y+D L+NEYFFDR+  +FD IL++YQSGG L +P +V  +VF EE+ FYELGEEA+ KY +      EE  V      Q+ +W L E  + S+ AK ++++S +  +LSI + C+ETLP FR+      N   +N  E+ I  +      +PFF++ET C++WF FEL +RF + P K  F K+ MN ID ++IMPYFIT+   +M     Q   T   +L+IIRLVRV RIFKLSRH + LQILG TLKAS+ EL ML+FFL + V++FS A Y+VEAD    +F SIPD FWWA+VTMT VGYGDM P+T+ GKIVG+LCAI GVLTI+LPVPVIVSNF YFY+  ++  + ++YI
Sbjct:    5 QRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVAKYGENTLDTPEEENVHG-KDFQQHVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKD-----NQVHANRTEFSIRTSIYN--LDPFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITVVLEIM----QQQDQTRQPLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVEADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYN--LKNKDIKIYI 383          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK4 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHB6])

HSP 1 Score: 416.387 bits (1069), Expect = 8.040e-141
Identity = 237/388 (61.08%), Postives = 304/388 (78.35%), Query Frame = 3
Query:  351 QNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIE 1514
            + ++RI+INVSGL+FET ++TL   P+TLLGN +KR KYYD++RNEYFFDRNRP+FD IL++YQSGG L RP NV M+VF +EI FYELG++ + K   EEG+++EE  +LP N++Q++IW L E+P++SM A+FVAI SV VI LSIV FC+ETLP F++       S +   +     +N    F +P+F +ET CIIWF+FE ++R  SSPQKL+F ++ +N+ID V+I+PY+ITL       P    +A+SL +LR+IRLVRVFRIFKLSRHS+GLQILG TL+AS+ EL +L FFLLI VILFSSA Y+ E   + T+F+SIPD FWWA+VTMTTVGYGDMRP+T+WGKIVGSLCAI+GVLTIALPVPVIVSNFNYFYHRE E
Sbjct:   55 EATDRILINVSGLKFETHVQTLESNPDTLLGNAVKRAKYYDSVRNEYFFDRNRPAFDAILFYYQSGGKLLRPANVPMDVFADEIRFYELGDDVLHKVEQEEGYIEEEKPILPENKLQRQIWQLFEFPDTSMPARFVAIFSVFVITLSIVTFCIETLPQFQKKEEDLYVSVNGTLVPV---DN---RFDQPWFSMETACIIWFTFEYIMRLISSPQKLIFIRSFLNMIDIVAILPYYITL-------PMQDTKASSLGVLRVIRLVRVFRIFKLSRHSRGLQILGHTLRASLRELGLLIFFLLIGVILFSSAVYYAEGGEKGTHFKSIPDAFWWAVVTMTTVGYGDMRPITVWGKIVGSLCAISGVLTIALPVPVIVSNFNYFYHRENE 429          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK45])

HSP 1 Score: 380.178 bits (975), Expect = 2.241e-127
Identity = 218/390 (55.90%), Postives = 284/390 (72.82%), Query Frame = 3
Query:  360 ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIE-ENDIPSFTEP------FFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE 1508
            +RI+INVSGLRFET   TL QFPNTLLG+  KR +Y+D+  +EYFFDRNR +F+ IL+FYQS G L RP  V   +F +E+ F++LG++ +++  +EEG+++E  +VLP + +Q+RIW L EYP+SSM A+ +A+ SV VI++SIV+FC+ETLP FR        S D N     +   N      EP      +  +E +CI WF+ E ++R  SSPQKL+F ++ +N+ID ++I+PY+ITL       P    + TSLA+LR+IRLVRVFRIFKLSRHS+GLQ+LG TL+AS  EL ML FFLLI V+LFSSA Y+ E +   + F SIPD FWWA+VTMTTVGYGDM PVT WGK+VGS+CAI+GVLTIALPVPVIVSNFNYFY RE
Sbjct:    1 KRIIINVSGLRFETYEATLAQFPNTLLGSESKREEYFDSDADEYFFDRNRSTFEAILFFYQSNGKLVRPSGVPFLLFKDEVIFFKLGKDNLKRLEEEEGYIEETTRVLPRHHLQRRIWELFEYPDSSMGARVLAVWSVSVILISIVVFCIETLPTFRCK-----TSPDGNGCPKLLPGTNSTADHPEPVEKSSAWLALEILCIAWFTLEYVVRLLSSPQKLLFVRSFLNVIDLMAILPYYITL-------PMKDLRITSLAVLRVIRLVRVFRIFKLSRHSRGLQVLGHTLRASSRELAMLIFFLLISVVLFSSAVYYAEEEEAASKFSSIPDAFWWAVVTMTTVGYGDMYPVTPWGKLVGSICAISGVLTIALPVPVIVSNFNYFYKRE 378          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK44])

HSP 1 Score: 352.443 bits (903), Expect = 7.740e-117
Identity = 207/386 (53.63%), Postives = 277/386 (71.76%), Query Frame = 3
Query:  360 ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKE-EVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRV-KPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREI 1511
            E IVINVSG RFET  +TL +FP+TLLG P +R K+ +  + EYFFDR+R +FD ILY+YQ+GG+L RP +V   VF+ E+ FY+L EEA++  + + G   E E KVLP NQ  + +W  LEYPE S LAKF+AI SV+VIVLS++IFCVETLP F    V KP N+T     ++   ++    + E +F + T  I+WF+ E +LR   SP+KL F    +NIID +SI+PY++ L           + ++S+++LR++R+VRVFR+FKLSRHS+GLQILG TL+AS+ EL ML FFL I V++F+S  Y+ E  +++  FRSIP  FWWA+VTMTTVGYGD+ P + WGKIVG+LCAI+GVLTIALPVPVIVSNF  FY++EI
Sbjct:    1 EPIVINVSGKRFETYEETLARFPDTLLGCPARRAKFLNNKKGEYFFDRHRSAFDAILYYYQAGGSLIRPEHVPPHVFINEVIFYDLPEEALQSVQLDAGIADEPEEKVLPKNQYLRYVWETLEYPEYSKLAKFLAIFSVVVIVLSLIIFCVETLPEFMPQEVTKPKNATA----DWKPPKD---PYEETWFQLNTFVIVWFTAEYILRLICSPEKLKFLLAALNIIDLLSILPYYVQLAL--------DSGSSSISVLRVVRVVRVFRVFKLSRHSRGLQILGNTLRASMNELMMLMFFLFIGVMIFASCVYYAEGGIDSP-FRSIPHSFWWAVVTMTTVGYGDISPESFWGKIVGALCAISGVLTIALPVPVIVSNFENFYNKEI 370          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK6 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFM4])

HSP 1 Score: 343.584 bits (880), Expect = 2.175e-113
Identity = 202/384 (52.60%), Postives = 270/384 (70.31%), Query Frame = 3
Query:  360 ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADV-ETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE 1508
            +RI IN+SGLR+ET  KTL +FP +LLG   +R+ +YD++ +EYFFDRNR  F+ IL +YQ+ G L RP N+  +VFV +I +++LGE+A+ +  D+      E++ +P N+ Q+ +W L E+P++S  A+ +AI SV VIVLSIV+FCVETLP F++   +P     +N  E  + +N   S    FF IE+ CI WF+ E  +RF  SP K  F  +++N+ID V+I+P+FITL    M  P S    +SLAILR +RLVRVFRIFKLSR+S+GLQILG TLKAS+ EL +L FFL + VILFSSA Y+ E +    T F SIP  FWW+++TMTTVGYGDM P T+ GK+VG  CAI+GVL IALPVPVIVSNF Y+Y RE
Sbjct:    1 KRITINISGLRYETFDKTLERFPESLLGCKSRRDDFYDSVNDEYFFDRNRLCFESILAYYQTCGVLIRPPNIPRKVFVSDIKYFDLGEQALRQAGDDLEITDREIRPMPKNKFQRTVWSLFEHPDTSNGARAIAIFSVAVIVLSIVLFCVETLPQFQR---RPKEVLRNNITETIMIDNPKKSV---FFAIESFCIAWFTLEYFIRFLCSPDKCKFVVSVLNLIDLVAILPFFITLP---MTEPTS---VSSLAILRCVRLVRVFRIFKLSRYSRGLQILGHTLKASLRELGLLFFFLCVGVILFSSAVYYAEYNYNRDTEFLSIPHSFWWSIITMTTVGYGDMAPKTLGGKLVGCFCAISGVLAIALPVPVIVSNFAYYYSRE 372          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK5 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS8])

HSP 1 Score: 334.724 bits (857), Expect = 6.864e-110
Identity = 198/387 (51.16%), Postives = 267/387 (68.99%), Query Frame = 3
Query:  363 RIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAI----EKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRV-KPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYF-RSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHR 1505
            R+ +NVSG R++T ++TL++FP TLLG+P KR +Y+D   NEYFFDRN+  F+ ILYFYQS G L  P ++A E+ +EE+ F++LGE AI    E   DEE    E  + +P N+IQ + W L EY +SS  A+ +A+ SV +IV SI + CVETLPNF    +  P N+ +   +  H E   +      F  +E   I WF+ E L+RF SSP+K  F ++ +N+ID ++I+P++I L   ++++ +S +   SLA LRI+RLVRVFRIFKLSRHS GLQILG TL+ S+ EL +L FFL I V++FSS AY+ EA  + T+  RSIPD FWWALVTMTTVGYGD+ P T+WGK+VGS CA+ GVL IALPVPVIVSNF+  Y +
Sbjct:    1 RVTLNVSGFRYQTYVETLDKFPTTLLGDPAKRREYFDPDLNEYFFDRNKQVFEIILYFYQSNGRLVCPPDLAPEILLEEVEFFDLGETAINAVKELLTDEEP--DETPRDMPTNKIQTQFWNLFEYADSSKAARVIALFSVSIIVASIAVLCVETLPNFAILPIHDPNNTEEVRRVNKHNEGAILAR--RWFGYLEAAFIAWFTLEYLVRFLSSPKKCPFVRSFLNVIDILAIVPFYIDL---ILNSVQSNDGTLSLAFLRILRLVRVFRIFKLSRHSSGLQILGLTLRKSLRELGLLIFFLFIGVVIFSSMAYYAEAGTKDTHLGRSIPDTFWWALVTMTTVGYGDLVPKTLWGKLVGSCCALCGVLAIALPVPVIVSNFDAIYKK 380          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3-like [Source:NCBI gene;Acc:105354379])

HSP 1 Score: 509.605 bits (1311), Expect = 1.599e-175
Identity = 276/412 (66.99%), Postives = 331/412 (80.34%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYR--VKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEK 1577
            ++  ER+VIN+SGLRFET+LKTL+QFP TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG +RRP NV +++F EEI FYELGEEA+EK+R++EGF+KEE + LP N+ Q+++WLL EYPESS  A+ VAI+SVLVI++SIVIFC+ETLP FR     V  +    + T+ Y I       F++PFF++ET+CIIWFSFELL+RF + P K  F+KNIMNIID V+I+PYFITLGT L +   +  QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD  ++ F SIPD FWWA+VTMTTVGYGDM PVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+HV S    A  E+
Sbjct:   70 HECCERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYELGEEAMEKFREDEGFIKEEERPLPENEFQRQVWLLFEYPESSGPARGVAIVSVLVILISIVIFCLETLPEFRDENNDVITLAPVINGTVPYFIS-----PFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSKNIMNIIDIVAIVPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLHVGSCQPLADTEE 476          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: KCNA5 (potassium voltage-gated channel subfamily A member 1-like [Source:NCBI gene;Acc:105353871])

HSP 1 Score: 498.049 bits (1281), Expect = 1.391e-168
Identity = 270/419 (64.44%), Postives = 328/419 (78.28%), Query Frame = 3
Query:  351 QNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYR-----VKPVNSTDSNTIEYHIEENDIPS--FTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQN----QATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDE 1574
            +++ER++IN++GLR+ET+L TLNQFP TLLG+P KR KY+D LRNEYFFDRNRPSFDGILYFYQSGG +RRP NV+++VF +EI FY+LGEEA+E++R++EGF+KEE K LP N+ QK++WL+ EYPESS  A+ +AI+SV+VI +SI+ FC+ETLP FR  R     V+P N T              PS  F++PFFI+ET C+IWF+FEL +RF + P K  F+K IMNIID +SIMPYFIT+GT L +    ++    QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   ++F SIPD FWWA+VTMTTVGYGDMRPVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHR  E D+ Q  +  +  S  AS E
Sbjct:  246 ESNERVLINIAGLRYETQLGTLNQFPETLLGDPAKRIKYFDPLRNEYFFDRNRPSFDGILYFYQSGGKIRRPVNVSIDVFADEIRFYQLGEEAMERFREDEGFIKEEEKPLPQNEFQKQVWLIFEYPESSSPARGIAIVSVIVITISIITFCLETLPEFRDERELAVSVRPDNGTAPR-----------PSLTFSDPFFIVETTCVIWFTFELFVRFFACPSKSEFSKTIMNIIDIMSIMPYFITVGTELAEQQGQEHQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESHFSSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHR--ETDQDQSSLKDEPASGRASPE 651          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: kcna2a (potassium voltage-gated channel, shaker-related subfamily, member 2a [Source:ZFIN;Acc:ZDB-GENE-131113-1])

HSP 1 Score: 489.574 bits (1259), Expect = 1.457e-168
Identity = 271/409 (66.26%), Postives = 321/409 (78.48%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFR------QYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNP---KSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVD 1547
            ++  ER+VIN+SGLRFET+LKTL+QFP TLLG+P KR +Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEAIE +R++EGF+KEE + LP N+ Q+++WLL EYPESS  A+ +AIISV+VI++SIV FC+ETLP FR            V S ++NT    I       FT+PFFI+ET+CIIWFSFE L+RF + P K  F  NIMNIID V+I+PYFITLGT L D P   +   QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD   + F SIPD FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  ++ V+
Sbjct:   25 HECCERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAIEMFREDEGFIKEEERPLPDNEFQRQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRNDEDDMHKSHAKVFSPETNTT---IISYTSTYFTDPFFILETLCIIWFSFEFLVRFFACPSKAGFFGNIMNIIDIVAIIPYFITLGTELADRPEDGQPGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFESIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQFLQVN 430          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: ENSORLT00000010657.2 (potassium voltage-gated channel subfamily A member 2 [Source:NCBI gene;Acc:101157775])

HSP 1 Score: 489.189 bits (1258), Expect = 4.028e-168
Identity = 275/454 (60.57%), Postives = 340/454 (74.89%), Query Frame = 3
Query:  360 ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFR-------QYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNP---KSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTL-----VSEKNNNLKLEILKEMN 1676
            ER+VIN+SGLRFET+LKTL+QFP TLLG+P KR +Y+D LRNEYFFDR+RPSFD ILY+YQSGG LRRP NV +++F EEI FYELGEEA+E +R++EGF++EE + LP N+ Q+++WLL EYPESS  A+ +AIISV+VI++SIV FC+ETLP FR        Y+V   ++T  ++  Y         FT+PFFI+ET+CIIWFSFE L+RF + P K  F  NIMNIID V+I+PYFITLGT L + P   +S  QA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFL I VILFSSA YF EAD + + F SIP+ FWWA+V+MTTVGYGDM P T+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y+++      +S +    S S     KS+ +     V+    + + E +K  N
Sbjct:   33 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRHRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAMEIFREDEGFIREEERPLPENEFQRQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPVFRNEEDPYSSYQVMSNSTTTFDSSTY---------FTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFGNIMNIIDIVAIIPYFITLGTELAERPEDGQSGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEKQSQFSSIPEAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLNLPMVPKGSSADDLKKSGSGSTLSKSDYVEIQEAVNHSTEDFRPEAMKTGN 477          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: ENSORLT00000025729.2 (shaker-related potassium channel tsha2 [Source:NCBI gene;Acc:101167693])

HSP 1 Score: 485.723 bits (1249), Expect = 5.571e-167
Identity = 270/425 (63.53%), Postives = 325/425 (76.47%), Query Frame = 3
Query:  360 ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPS------FTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSY-------ASDEKTLLSES 1595
            ER+VIN+SGLRFET+LKTL QFP TLLG+P KR +++D LRNEYFFDRNRPSFD I+Y+YQSGG LRRP NV +++F+EEI FYELGEE IE ++++EGF+KEE + LP ++ Q+++WLL EYPESS  A+ +AI+SVLVI++SIVIFC+ETLP FR+         D+  +E     N   S      FT+PFFI+ET+CIIWFSFELL+RF + P K  F KNIMN ID V+IMPYFITLG  L ++  +  QA SLAILR+IRLVRVFRIFKLSRHSKGLQILG+TL+AS+ EL +L FFL I VILFSSA YF E D   + F SIPD FWWA+V+MTTVGYGDM PVT+ GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E +E+  Y HV     +        SD +  LS S
Sbjct:   36 ERVVINISGLRFETQLKTLAQFPATLLGDPRKRMRFFDPLRNEYFFDRNRPSFDAIVYYYQSGGRLRRPVNVPVDIFMEEIKFYELGEEVIENFKEDEGFIKEEERPLPEHEFQRQVWLLFEYPESSGAARGIAIVSVLVILISIVIFCLETLPEFRE---------DARDLEAQPYVNGTASADRANPFTDPFFIVETLCIIWFSFELLVRFLACPSKPAFFKNIMNTIDIVAIMPYFITLGLELAEHQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAETDDPHSGFSSIPDAFWWAVVSMTTVGYGDMCPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEHEEQFQYTHVTCGQQHPAFGDLKGSDSRASLSRS 451          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000069004.1 (SMESG000069004.1)

HSP 1 Score: 992.26 bits (2564), Expect = 0.000e+0
Identity = 528/528 (100.00%), Postives = 528/528 (100.00%), Query Frame = 3
Query:  135 MNTVNLAXXXXXXXXXXXXVREILYSHINQCKFIVNAAAVPKSSNVLSISQETGKEFGKNTNSENLTFSHGYQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKTKSSLRSPLTDV 1718
            MNTVNLASNSKKSEDKNSNVREILYSHINQCKFIVNAAAVPKSSNVLSISQETGKEFGKNTNSENLTFSHGYQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFVAIISVLVIVLSIVIFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKTKSSLRSPLTDV
Sbjct:    1 MNTVNLASNSKKSEDKNSNVREILYSHINQCKFIVNAAAVPKSSNVLSISQETGKEFGKNTNSENLTFSHGYQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFVAIISVLVIVLSIVIFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSEKNNNLKLEILKEMNEKTKSSLRSPLTDV 528          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000020672.1 (SMESG000020672.1)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 299/403 (74.19%), Postives = 352/403 (87.34%), Query Frame = 3
Query:  360 ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNST--DSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSY 1562
            ER+ IN+SGLRFET+LKTL QFPNTLLGN +KRN+Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV ++VF EEI FYELGEEAIEKYR++EG++KE++K+LP N  Q+++WLL EYPESSM A+ VAI SV VI+LSIVIFC+ETLP+F+ YR+  VNST   +N   Y IEE+DIP F+EPFFIIET+CIIWF+FELL+RF+SSP+KL F K IMN+ID V+I+PYFITLGT++ D+ +SQNQA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFLLI VILFSSA YF EAD + +YFRSIPD FWWA+VTMTTVGYGDMRPVT+WGK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E+++KQ YIH+ +   Y
Sbjct:   61 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAICSVFVIILSIVIFCIETLPHFKHYRI--VNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASVRELGLLVFFLLISVILFSSAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKY 461          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000020672.1 (SMESG000020672.1)

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 299/403 (74.19%), Postives = 352/403 (87.34%), Query Frame = 3
Query:  360 ERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNST--DSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDSFSSY 1562
            ER+ IN+SGLRFET+LKTL QFPNTLLGN +KRN+Y+D LRNEYFFDRNRPSFD ILY+YQSGG LRRP NV ++VF EEI FYELGEEAIEKYR++EG++KE++K+LP N  Q+++WLL EYPESSM A+ VAI SV VI+LSIVIFC+ETLP+F+ YR+  VNST   +N   Y IEE+DIP F+EPFFIIET+CIIWF+FELL+RF+SSP+KL F K IMN+ID V+I+PYFITLGT++ D+ +SQNQA SLAILR+IRLVRVFRIFKLSRHSKGLQILGQTLKAS+ EL +L FFLLI VILFSSA YF EAD + +YFRSIPD FWWA+VTMTTVGYGDMRPVT+WGK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E+++KQ YIH+ +   Y
Sbjct:   55 ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAICSVFVIILSIVIFCIETLPHFKHYRI--VNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASVRELGLLVFFLLISVILFSSAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEDKQTYIHIGNNQKY 455          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000061194.1 (SMESG000061194.1)

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 301/398 (75.63%), Postives = 344/398 (86.43%), Query Frame = 3
Query:  363 RIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRV--KPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQATSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEADEKQVYIHVDS 1550
            RIVIN+SGL+FET L TL+ FPNTLLGNPMKRN++YDALRNEYFFDRNRPSFD ILY+YQSGG LRRP NV M+VF+EEI FYELGEEAI+KYR++EG+ KEEVKVLP N+ Q+R+WLL EYPESS  A+ VAI+SV VIVLSIVIFCVETLP+F+ Y++  K  +S     IE+  EE+DIP FTEPFF+IET CI+WF+FELL+RFASSP+KL F KNIMN+ID V+I+PYFITLGT L+D+ +  NQ TSLAILR+IRLVRVFRIFKLSRHS GLQILGQTLKAS  EL +L FFLLICVILFSSA YF EAD + T FRSIPD FWWA+VTMTTVGYGDM PVT+WGK+VGSLCAIAGVLTIALPVPVIVSNFNYFYHRE E D+KQ Y+HV S
Sbjct:   66 RIVINISGLKFETHLHTLSTFPNTLLGNPMKRNRFYDALRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPMDVFMEEIKFYELGEEAIDKYREDEGYNKEEVKVLPENEFQRRVWLLFEYPESSTSARCVAILSVFVIVLSIVIFCVETLPHFKYYKMINKTTHSDSVQQIEF--EEDDIPKFTEPFFVIETCCIVWFTFELLVRFASSPRKLDFFKNIMNLIDIVAIIPYFITLGTALVDDTRRSNQTTSLAILRVIRLVRVFRIFKLSRHSTGLQILGQTLKASTRELGLLIFFLLICVILFSSAVYFAEADCDQTLFRSIPDAFWWAVVTMTTVGYGDMHPVTIWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRENEIDDKQTYVHVCS 461          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000079731.1 (SMESG000079731.1)

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 283/392 (72.19%), Postives = 339/392 (86.48%), Query Frame = 3
Query:  348 YQNSERIVINVSGLRFETRLKTLNQFPNTLLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAMEVFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPESSMLAKFXXXXXXXXXXXXXXXFCVETLPNFRQYRVKPVNSTDSNTIEYHIEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIIDFVSIMPYFITLGTILMDNPKSQNQA-TSLAXXXXXXXXXXXXXXKLSRHSKGLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIPDGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHREIEAD 1520
            Y + ++++IN+SGL++ET L TL +FP+TLLG+ +KRN YYD+ RNEYFFDRNR SFDGIL++YQSGG LRRP+NV  +VF EEI F+ELGEE  E+++ +EG+VKEE KVLP +  Q+++WLL+EYPESS++AKFVAIISVLVI+LSIV+FCVETLP F+ Y++  V    +N+ E  I E+D P F EPFF+IE++CIIWF+ ELL+RFASSP KL F KN+MN+ID VSI PYFITLGTI+     +QNQA TSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTL+AS+EELTMLTFFLLICVILFSSA YFVEAD ET+ FRSIPDGFWWA+VTMTTVGYGDM PVT++GK++GSLCAIAGVLTIALPVPVIVSNFNYFYHRE+E D
Sbjct:   41 YYSRQKVIINISGLKYETFLDTLTKFPDTLLGDSIKRNMYYDSTRNEYFFDRNRSSFDGILHYYQSGGVLRRPNNVPFDVFAEEIRFFELGEEVFERFKIDEGYVKEEEKVLPKHSFQRKVWLLIEYPESSIMAKFVAIISVLVIILSIVVFCVETLPRFKHYQIVYVPIFATNSSEMQIVEDDTPEFGEPFFMIESICIIWFTLELLIRFASSPLKLDFLKNVMNMIDLVSIFPYFITLGTIISTEGVTQNQATTSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTLRASVEELTMLTFFLLICVILFSSAVYFVEADTETSLFRSIPDGFWWAVVTMTTVGYGDMMPVTVFGKLIGSLCAIAGVLTIALPVPVIVSNFNYFYHREMEND 432          
The following BLAST results are available for this feature:
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA31.578e-17263.62potassium voltage-gated channel subfamily A member... [more]
KCNA22.094e-17161.10potassium voltage-gated channel subfamily A member... [more]
KCNA22.094e-17161.10potassium voltage-gated channel subfamily A member... [more]
KCNA22.094e-17161.10potassium voltage-gated channel subfamily A member... [more]
KCNA22.094e-17161.10potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shk-13.903e-11247.57Potassium voltage-gated channel protein shk-1 [So... [more]
shk-13.903e-11247.57Potassium voltage-gated channel protein shk-1 [So... [more]
shk-16.682e-11248.59Potassium voltage-gated channel protein shk-1 [So... [more]
shk-11.247e-11147.83Potassium voltage-gated channel protein shk-1 [So... [more]
shk-16.010e-11147.00Potassium voltage-gated channel protein shk-1 [So... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sh1.688e-17565.85gene:FBgn0003380 transcript:FBtr0346706[more]
Sh7.640e-17464.61gene:FBgn0003380 transcript:FBtr0089660[more]
Sh1.451e-17365.61gene:FBgn0003380 transcript:FBtr0089657[more]
Sh2.276e-17365.61gene:FBgn0003380 transcript:FBtr0302903[more]
Sh2.276e-17365.61gene:FBgn0003380 transcript:FBtr0089661[more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcna2b2.764e-17363.27potassium voltage-gated channel, shaker-related su... [more]
kcna1b3.055e-16862.93potassium voltage-gated channel, shaker-related su... [more]
kcna1b3.055e-16862.93potassium voltage-gated channel, shaker-related su... [more]
kcna2a7.053e-16760.77potassium voltage-gated channel, shaker-related su... [more]
kcna2a7.053e-16760.77potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA35.534e-17764.30potassium voltage-gated channel subfamily A member... [more]
KCNA11.029e-17066.42potassium channel, voltage gated shaker related su... [more]
KCNA22.439e-17061.73potassium channel, voltage gated shaker related su... [more]
KCNA58.157e-17061.42potassium channel, voltage gated shaker related su... [more]
ENSXETT00000049277.13.912e-16762.99potassium channel, voltage gated shaker related su... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcna32.304e-17263.07potassium voltage-gated channel, shaker-related su... [more]
Kcna29.511e-17261.10potassium voltage-gated channel, shaker-related su... [more]
Kcna29.511e-17261.10potassium voltage-gated channel, shaker-related su... [more]
Kcna29.511e-17261.10potassium voltage-gated channel, shaker-related su... [more]
Kcna16.685e-17166.67potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P08510|KCNAS_DROME1.454e-17265.61Potassium voltage-gated channel protein Shaker OS=... [more]
sp|P22001|KCNA3_HUMAN7.580e-17263.62Potassium voltage-gated channel subfamily A member... [more]
sp|P16390|KCNA3_MOUSE1.612e-17163.07Potassium voltage-gated channel subfamily A member... [more]
sp|P63142|KCNA2_RAT6.653e-17161.10Potassium voltage-gated channel subfamily A member... [more]
sp|P63141|KCNA2_MOUSE6.653e-17161.10Potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G5V40.000e+071.84BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A267G5S40.000e+071.99BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A448XC640.000e+069.98BTB domain-containing protein OS=Protopolystoma xe... [more]
A0A1I8JAN40.000e+071.99BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A5J4NW910.000e+069.79Potassium voltage-gated channel Shaker-related sub... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcna2b1.392e-17162.58potassium voltage-gated channel subfamily A member... [more]
KCNA31.711e-17059.87potassium voltage-gated channel subfamily A member... [more]
ENSAMXT00000027012.25.007e-16964.45potassium voltage-gated channel subfamily A member... [more]
kcna2a5.419e-16860.64potassium voltage-gated channel subfamily A member... [more]
kcna1a1.298e-16364.11potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA37.218e-17767.48potassium voltage-gated channel subfamily A member... [more]
KCNA35.637e-16564.22potassium voltage-gated channel subfamily A member... [more]
KCNA34.302e-14861.82potassium voltage-gated channel subfamily A member... [more]
kcna1b3.982e-12454.07potassium voltage-gated channel, shaker-related su... [more]
kcna1b4.678e-12452.93potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
SHAK48.040e-14161.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK32.241e-12755.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK17.740e-11753.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK62.175e-11352.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK56.864e-11051.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA31.599e-17566.99potassium voltage-gated channel subfamily A member... [more]
KCNA51.391e-16864.44potassium voltage-gated channel subfamily A member... [more]
kcna2a1.457e-16866.26potassium voltage-gated channel, shaker-related su... [more]
ENSORLT00000010657.24.028e-16860.57potassium voltage-gated channel subfamily A member... [more]
ENSORLT00000025729.25.571e-16763.53shaker-related potassium channel tsha2 [Source:NCB... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069004.10.000e+0100.00SMESG000069004.1[more]
SMESG000020672.10.000e+074.19SMESG000020672.1[more]
SMESG000020672.10.000e+074.19SMESG000020672.1[more]
SMESG000061194.10.000e+075.63SMESG000061194.1[more]
SMESG000079731.10.000e+072.19SMESG000079731.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003169 ID=SMED30003169|Name=Potassium voltage-gated channel subfamily A member 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1867bp
TGATAGGCCAGTCGTATTTCTATAGAGAAAAATAAATCTATAATTCTGCG
AATGCACTTCTATAATCTGGAGTGTGACAAATTTGATCGAGTTAATGGTT
TTTTTCCCAATAGTCAATCAATGCCTCTGGAATTATGAACACGGTGAATT
TAGCATCGAATTCGAAAAAATCAGAAGACAAAAACAGTAATGTTAGAGAG
ATTTTATATTCTCATATCAACCAATGTAAGTTTATCGTTAACGCCGCCGC
CGTTCCGAAAAGTTCGAACGTTCTGTCAATTTCTCAGGAAACTGGAAAAG
AATTTGGCAAAAATACTAACAGTGAAAATTTAACATTTTCACATGGCTAT
CAAAATTCAGAAAGAATTGTTATCAATGTTAGTGGGCTACGGTTTGAGAC
AAGACTGAAAACTCTGAATCAATTTCCGAATACTTTGTTGGGGAACCCAA
TGAAACGTAACAAATATTATGATGCTTTGAGAAATGAATACTTTTTCGAC
AGAAATCGTCCTAGTTTTGATGGGATTTTATATTTTTATCAGAGCGGAGG
TAATCTTCGTCGTCCACATAACGTTGCAATGGAGGTATTTGTTGAGGAAA
TAAATTTCTATGAACTAGGAGAAGAGGCTATTGAAAAATATCGAGATGAA
GAAGGATTCGTTAAAGAAGAAGTGAAAGTTTTGCCACTTAATCAGATACA
AAAAAGAATTTGGCTTTTACTGGAGTATCCCGAGAGCTCAATGCTTGCTA
AATTCGTAGCTATAATTTCAGTATTAGTTATTGTACTTTCCATTGTTATA
TTTTGTGTGGAAACTCTTCCAAATTTCAGACAATATCGTGTGAAACCTGT
CAATTCTACAGATTCAAATACAATTGAGTATCATATTGAGGAAAACGATA
TACCAAGTTTCACAGAGCCATTCTTTATAATAGAAACTATGTGCATTATA
TGGTTTTCCTTTGAATTACTACTAAGATTTGCGTCCTCGCCTCAAAAATT
AGTATTTGCCAAGAATATTATGAATATTATAGACTTTGTGTCTATAATGC
CATATTTCATTACCCTTGGTACTATTTTAATGGACAATCCAAAATCTCAA
AACCAAGCCACTTCATTGGCCATTCTCAGAATTATTAGACTTGTTAGAGT
CTTTCGAATATTTAAATTATCTCGACATTCCAAAGGTCTGCAGATTCTTG
GTCAAACGTTAAAGGCTAGTATTGAAGAATTGACAATGTTGACGTTTTTT
CTGTTAATTTGCGTAATTCTATTCTCAAGTGCTGCTTACTTTGTCGAAGC
AGATGTGGAGACAACATATTTTCGCAGTATTCCAGACGGATTCTGGTGGG
CATTGGTTACTATGACTACTGTCGGTTATGGAGATATGCGCCCAGTGACT
ATGTGGGGTAAAATTGTTGGTAGCCTTTGTGCCATTGCCGGTGTTTTAAC
AATTGCCTTGCCAGTGCCGGTTATTGTGTCGAACTTTAACTACTTCTATC
ACAGGGAAATCGAAGCCGATGAAAAACAGGTTTACATTCATGTGGATAGT
TTTTCTAGTTATGCGAGTGATGAAAAAACACTTTTATCGGAGTCTTGTTT
TAATTCTCAAAAGAGTAATACGTTAGTTTCTGAAAAGAATAACAATTTAA
AGCTCGAGATTTTAAAGGAAATGAATGAGAAAACAAAATCGTCTTTGCGA
TCTCCGCTAACAGATGTATGACTCTCCTAATTTATTCCATCTCTCATGCC
TCATTTTATACTAGTCTACTCAATTTTATTCACCTATTTTTCTATTCATA
TGCTGTAAGAGTTTATATAGATGTTATTTAATAATAATTTGTTATTAATG
TTGAATATGTAAAAATC
back to top

protein sequence of SMED30003169-orf-1

>SMED30003169-orf-1 ID=SMED30003169-orf-1|Name=SMED30003169-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=529bp
MNTVNLASNSKKSEDKNSNVREILYSHINQCKFIVNAAAVPKSSNVLSIS
QETGKEFGKNTNSENLTFSHGYQNSERIVINVSGLRFETRLKTLNQFPNT
LLGNPMKRNKYYDALRNEYFFDRNRPSFDGILYFYQSGGNLRRPHNVAME
VFVEEINFYELGEEAIEKYRDEEGFVKEEVKVLPLNQIQKRIWLLLEYPE
SSMLAKFVAIISVLVIVLSIVIFCVETLPNFRQYRVKPVNSTDSNTIEYH
IEENDIPSFTEPFFIIETMCIIWFSFELLLRFASSPQKLVFAKNIMNIID
FVSIMPYFITLGTILMDNPKSQNQATSLAILRIIRLVRVFRIFKLSRHSK
GLQILGQTLKASIEELTMLTFFLLICVILFSSAAYFVEADVETTYFRSIP
DGFWWALVTMTTVGYGDMRPVTMWGKIVGSLCAIAGVLTIALPVPVIVSN
FNYFYHREIEADEKQVYIHVDSFSSYASDEKTLLSESCFNSQKSNTLVSE
KNNNLKLEILKEMNEKTKSSLRSPLTDV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR004053K_chnl_volt-dep_Kv1.6
IPR003968K_chnl_volt-dep_Kv
IPR028325VG_K_chnl
IPR003972K_chnl_volt-dep_Kv1
IPR000210BTB/POZ_dom
IPR005821Ion_trans_dom
IPR003131T1-type_BTB
IPR027359Volt_channel_dom_sf
IPR011333SKP1/BTB/POZ_sf
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0005783endoplasmic reticulum
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0009986cell surface
GO:0016021integral component of membrane
GO:0016324apical plasma membrane
GO:0030054cell junction
GO:0030424axon
GO:0030425dendrite
GO:0031410cytoplasmic vesicle
GO:0033270paranode region of axon
GO:0034705potassium channel complex
GO:0042734presynaptic membrane
GO:0042995cell projection
GO:0043025neuronal cell body
GO:0043204perikaryon
GO:0043679axon terminus
GO:0044224juxtaparanode region of axon
GO:0045202synapse
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005251delayed rectifier potassium channel activity
GO:0005267potassium channel activity
GO:0015079potassium ion transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0051260protein homooligomerization
GO:0001964startle response
GO:0006810transport
GO:0006937regulation of muscle contraction
GO:0007268chemical synaptic transmission
GO:0007405neuroblast proliferation
GO:0007420brain development
GO:0010644cell communication by electrical coupling
GO:0010960magnesium ion homeostasis
GO:0019228neuronal action potential
GO:0021766hippocampus development
GO:0023041neuronal signal transduction
GO:0034613cellular protein localization
GO:0034765regulation of ion transmembrane transport
GO:0042391regulation of membrane potential
GO:0050905neuromuscular process
GO:0050966detection of mechanical stimulus involved in sensory perception of pain
GO:0050976detection of mechanical stimulus involved in sensory perception of touch
GO:0071286cellular response to magnesium ion
GO:0071805potassium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 265..288
score: 51.29
coord: 396..418
score: 76.96
coord: 365..388
score: 50.13
coord: 425..451
score: 78.66
coord: 291..311
score: 57.04
coord: 336..362
score: 73.84
coord: 118..137
score: 64.18
coord: 199..227
score: 49.98
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 75..175
e-value: 3.0E-37
score: 128.8
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 349..459
e-value: 2.5E-33
score: 116.1
NoneNo IPR availableCDDcd18407BTB_POZ_KCNA6coord: 76..202
e-value: 4.10959E-61
score: 195.216
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 201..452
NoneNo IPR availableTMHMMTMhelixcoord: 427..449
NoneNo IPR availableTMHMMTMhelixcoord: 207..229
NoneNo IPR availableTMHMMTMhelixcoord: 294..316
NoneNo IPR availableTMHMMTMhelixcoord: 263..282
NoneNo IPR availableTMHMMTMhelixcoord: 365..387
IPR003968Potassium channel, voltage dependent, KvPRINTSPR01491KVCHANNELcoord: 365..379
score: 46.11
coord: 341..349
score: 85.28
coord: 436..447
score: 86.18
coord: 118..128
score: 73.26
IPR003972Potassium channel, voltage dependent, Kv1PRINTSPR01496SHAKERCHANELcoord: 105..116
score: 55.08
coord: 196..212
score: 59.97
coord: 219..230
score: 78.25
coord: 162..173
score: 57.11
coord: 119..129
score: 98.0
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 76..170
e-value: 1.0E-5
score: 35.0
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 78..168
e-value: 3.6E-27
score: 94.5
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 207..457
e-value: 5.7E-46
score: 156.7
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 176..348
e-value: 2.0E-52
score: 179.0
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 56..503
IPR004053Potassium channel, voltage dependent, Kv1.6PANTHERPTHR11537:SF104POTASSIUM VOLTAGE-GATED CHANNEL SUBFAMILY A MEMBER 6coord: 56..503
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 76..169