slc4a-4

Overview
Nameslc4a-4 (AKN21410.1)
Smed IDSMED30003166
Length (bp)3234
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc4a-4 (SMED30003166) t-SNE clustered cells

Violin plots show distribution of expression levels for slc4a-4 (SMED30003166) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc4a-4 (SMED30003166) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc4a-4 (SMED30003166) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003166

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003166SMESG000039045.1 SmedASXL_014590SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30003166SMESG000039045.1 dd_Smed_v4_12290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003166SMESG000039045.1 dd_Smed_v4_12290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30003166SMESG000039045.1 dd_Smed_v6_12290_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30003166SMESG000039045.1 SMED30003166smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc4a-4 vs. Ensembl Human
Match: SLC4A11 (solute carrier family 4 member 11 [Source:HGNC Symbol;Acc:HGNC:16438])

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 345/806 (42.80%), Postives = 506/806 (62.78%), Query Frame = 2
Query:  644 TADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQ--------MDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAE-------EQRLYRRRSIRITEVMNQAFAYEEKF-PLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVN-----KTVPIVNTTLAKGLLNST------NEFITITTE-----ESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFK-TRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            T +E   G   L+    + + +K+F  E+RA  D++ FL +  ++L+  A  +D ++  +LR     A D    +        M    T+A   +  K H        L+ T++G+      G+   QSW+  +C++  + KRHV I+RL  P N G +S  V FV+LV+ P K K TK+ +E++RTFAT+ SD+ FR +LL  +TE+EFKE L  H R L           R   R ++ +    +      + F P G GI +D+ +R P+Y  D+ DGI G    + K ++   FLYFACLLP++AFG L D+NTDG I+V++ I  Q++GGL +AL  GQPL+++LTTAPL LYI+VI  I   Y L F + ++W G++NS FL LY+  +LS +M    RSTEEI ALFISI F++DAVK  +K+F+K Y    ++     +T  +V+ +     LN++        F+   TE      S +   +L LL+++GT+WLG     F K+P+L+   R +++D +LP+AVL  S I S+ F++I++  F+   SE  F++       +S+ AV  A+GL F LS+LFF++QN+ +A+VN P N+L KG+AYHWDLL++AIIN  LSLFGLPW+H   PHSPLHV+ALA +EER+++GH IY+TIV V+ETRLT L + +L+GLSLLLLP+PL ++P  VL GLF+Y+A+T+L GNQLV+RV LL  EQ AYPP+HY+RRVPQRK+H FT LQ+ QL LLCA G +  PY K+ FP++++  +PIR+ + P+ I   Y+D +D
Sbjct:   80 TENEATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRR---FARDPDNNEPNCNLDLLMAMLFTDAGAPMRGKVHL-------LSDTIQGVTATVT-GVRYQQSWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKLLETRTEEEFKEALV-HQRQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAM--AQIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYDTIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 870          
BLAST of slc4a-4 vs. Ensembl Human
Match: SLC4A11 (solute carrier family 4 member 11 [Source:HGNC Symbol;Acc:HGNC:16438])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 345/806 (42.80%), Postives = 506/806 (62.78%), Query Frame = 2
Query:  644 TADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQ--------MDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAE-------EQRLYRRRSIRITEVMNQAFAYEEKF-PLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVN-----KTVPIVNTTLAKGLLNST------NEFITITTE-----ESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFK-TRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            T +E   G   L+    + + +K+F  E+RA  D++ FL +  ++L+  A  +D ++  +LR     A D    +        M    T+A   +  K H        L+ T++G+      G+   QSW+  +C++  + KRHV I+RL  P N G +S  V FV+LV+ P K K TK+ +E++RTFAT+ SD+ FR +LL  +TE+EFKE L  H R L           R   R ++ +    +      + F P G GI +D+ +R P+Y  D+ DGI G    + K ++   FLYFACLLP++AFG L D+NTDG I+V++ I  Q++GGL +AL  GQPL+++LTTAPL LYI+VI  I   Y L F + ++W G++NS FL LY+  +LS +M    RSTEEI ALFISI F++DAVK  +K+F+K Y    ++     +T  +V+ +     LN++        F+   TE      S +   +L LL+++GT+WLG     F K+P+L+   R +++D +LP+AVL  S I S+ F++I++  F+   SE  F++       +S+ AV  A+GL F LS+LFF++QN+ +A+VN P N+L KG+AYHWDLL++AIIN  LSLFGLPW+H   PHSPLHV+ALA +EER+++GH IY+TIV V+ETRLT L + +L+GLSLLLLP+PL ++P  VL GLF+Y+A+T+L GNQLV+RV LL  EQ AYPP+HY+RRVPQRK+H FT LQ+ QL LLCA G +  PY K+ FP++++  +PIR+ + P+ I   Y+D +D
Sbjct:  123 TENEATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRR---FARDPDNNEPNCNLDLLMAMLFTDAGAPMRGKVHL-------LSDTIQGVTATVT-GVRYQQSWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKLLETRTEEEFKEALV-HQRQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAM--AQIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYDTIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 913          
BLAST of slc4a-4 vs. Ensembl Human
Match: SLC4A11 (solute carrier family 4 member 11 [Source:HGNC Symbol;Acc:HGNC:16438])

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 345/806 (42.80%), Postives = 506/806 (62.78%), Query Frame = 2
Query:  644 TADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQ--------MDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAE-------EQRLYRRRSIRITEVMNQAFAYEEKF-PLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVN-----KTVPIVNTTLAKGLLNST------NEFITITTE-----ESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFK-TRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            T +E   G   L+    + + +K+F  E+RA  D++ FL +  ++L+  A  +D ++  +LR     A D    +        M    T+A   +  K H        L+ T++G+      G+   QSW+  +C++  + KRHV I+RL  P N G +S  V FV+LV+ P K K TK+ +E++RTFAT+ SD+ FR +LL  +TE+EFKE L  H R L           R   R ++ +    +      + F P G GI +D+ +R P+Y  D+ DGI G    + K ++   FLYFACLLP++AFG L D+NTDG I+V++ I  Q++GGL +AL  GQPL+++LTTAPL LYI+VI  I   Y L F + ++W G++NS FL LY+  +LS +M    RSTEEI ALFISI F++DAVK  +K+F+K Y    ++     +T  +V+ +     LN++        F+   TE      S +   +L LL+++GT+WLG     F K+P+L+   R +++D +LP+AVL  S I S+ F++I++  F+   SE  F++       +S+ AV  A+GL F LS+LFF++QN+ +A+VN P N+L KG+AYHWDLL++AIIN  LSLFGLPW+H   PHSPLHV+ALA +EER+++GH IY+TIV V+ETRLT L + +L+GLSLLLLP+PL ++P  VL GLF+Y+A+T+L GNQLV+RV LL  EQ AYPP+HY+RRVPQRK+H FT LQ+ QL LLCA G +  PY K+ FP++++  +PIR+ + P+ I   Y+D +D
Sbjct:   96 TENEATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRR---FARDPDNNEPNCNLDLLMAMLFTDAGAPMRGKVHL-------LSDTIQGVTATVT-GVRYQQSWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKLLETRTEEEFKEALV-HQRQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAM--AQIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYDTIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 886          
BLAST of slc4a-4 vs. Ensembl Human
Match: SLC4A11 (solute carrier family 4 member 11 [Source:HGNC Symbol;Acc:HGNC:16438])

HSP 1 Score: 534.643 bits (1376), Expect = 1.450e-174
Identity = 333/767 (43.42%), Postives = 486/767 (63.36%), Query Frame = 2
Query:  761 KEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQ--------MDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAE-------EQRLYRRRSIRITEVMNQAFAYEEKF-PLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVN-----KTVPIVNTTLAKGLLNST------NEFITITTE-----ESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFK-TRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            ++  ++L+  A  +D ++  +LR     A D    +        M    T+A   +  K H        L+ T++G+      G+   QSW+  +C++  + KRHV I+RL  P N G +S  V FV+LV+ P K K TK+ +E++RTFAT+ SD+ FR +LL  +TE+EFKE L  H R L           R   R ++ +    +      + F P G GI +D+ +R P+Y  D+ DGI G    + K ++   FLYFACLLP++AFG L D+NTDG I+V++ I  Q++GGL +AL  GQPL+++LTTAPL LYI+VI  I   Y L F + ++W G++NS FL LY+  +LS +M    RSTEEI ALFISI F++DAVK  +K+F+K Y    ++     +T  +V+ +     LN++        F+   TE      S +   +L LL+++GT+WLG     F K+P+L+   R +++D +LP+AVL  S I S+ F++I++  F+   SE  F++       +S+ AV  A+GL F LS+LFF++QN+ +A+VN P N+L KG+AYHWDLL++AIIN  LSLFGLPW+H   PHSPLHV+ALA +EER+++GH IY+TIV V+ETRLT L + +L+GLSLLLLP+PL ++P  VL GLF+Y+A+T+L GNQLV+RV LL  EQ AYPP+HY+RRVPQRK+H FT LQ+ QL LLCA G +  PY K+ FP++++  +PIR+ + P+ I   Y+D +D
Sbjct:   96 RKASIVLNETATSLDNVLRTMLRR---FARDPDNNEPNCNLDLLMAMLFTDAGAPMRGKVHL-------LSDTIQGVTATVT-GVRYQQSWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKLLETRTEEEFKEALV-HQRQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAM--AQIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYDTIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 847          
BLAST of slc4a-4 vs. Ensembl Human
Match: SLC4A11 (solute carrier family 4 member 11 [Source:HGNC Symbol;Acc:HGNC:16438])

HSP 1 Score: 486.108 bits (1250), Expect = 3.796e-156
Identity = 324/806 (40.20%), Postives = 475/806 (58.93%), Query Frame = 2
Query:  644 TADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQ--------MDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAE-------EQRLYRRRSIRITEVMNQAFAYEEKF-PLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVN-----KTVPIVNTTLAKGLLNST------NEFITITTE-----ESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFK-TRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            T +E   G   L+    + + +K+F  E+RA  D++ FL +  ++L+  A  +D ++  +LR     A D    +        M    T+A   +  K H        L+ T++G+      G+   QSW+  +C++  + KRHV I+RL  P N G +S  V FV+LV+ P K K TK+ +E++RTFAT+ SD+ FR +LL  +TE+EFKE L  H R L           R   R ++ +    +      + F P G GI +D+ +R P+Y  D+ DGI G    + K ++   FLYFACLLP++AFG L D+NTDG I                                      VI  I   Y L F + ++W G++NS FL LY+  +LS +M    RSTEEI ALFISI F++DAVK  +K+F+K Y    ++     +T  +V+ +     LN++        F+   TE      S +   +L LL+++GT+WLG     F K+P+L+   R +++D +LP+AVL  S I S+ F++I++  F+   SE  F++       +S+ AV  A+GL F LS+LFF++QN+ +A+VN P N+L KG+AYHWDLL++AIIN  LSLFGLPW+H   PHSPLHV+ALA +EER+++GH IY+TIV V+ETRLT L + +L+GLSLLLLP+PL ++P  VL GLF+Y+A+T+L GNQLV+RV LL  EQ AYPP+HY+RRVPQRK+H FT LQ+ QL LLCA G +  PY K+ FP++++  +PIR+ + P+ I   Y+D +D
Sbjct:   80 TENEATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRR---FARDPDNNEPNCNLDLLMAMLFTDAGAPMRGKVHL-------LSDTIQGVTATVT-GVRYQQSWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKLLETRTEEEFKEALV-HQRQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAI--------------------------------------VIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAM--AQIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYDTIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 832          
BLAST of slc4a-4 vs. Ensembl Celegans
Match: abts-3 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:A0A3B1E4W4])

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 376/870 (43.22%), Postives = 555/870 (63.79%), Query Frame = 2
Query:  410 VLTNCNQSPAIDRTNRRT-ISGLYNFKKQSTNND-DKDSKDRNLLLSPTNYINRQISETSEMSTDTVSNFSIGSLARYYRTADENGEGLP--CLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLS--TDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRR--SIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-------VTTLVNKTV--PIVNTTLAKGLLNSTNEFITI--TTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXX-XXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            V+T     P I+ T   + I    +F   STN D D  S   + L  P     R     + M ++  S        RY    D+  +      L+ A+ EKIP+KDF SE+RAT+D++  L + VL+LD++   ++ I   ++ E     MD+   Q   F +E   ++       N  +  L++T++ I    + G S   DQ+WI A+C L  V  RHVAIARL  P NLGR+ + + F+++VI P + K TK+ +E +RTFATL +DME R +L+ AQ+ ++F+  L + A++LA +Q  +R R  SI ++    Q F  E  +P   G+V++ ++R+ +Y SDY DGI+G  T++KL S   FLYFACLLP++AFGVL D NT G INV++VI++Q +GG+ F+L GGQP+I++LTT PL +YIKVI+ IS +    F  M++ VG+F  +FLILYS  +L  LM+++TRS EE+F+LFI+IAF V++++ +   F K+Y       ++    +T      N + A  ++ +    ++I  T    R++  +L++LL+ GT+WLG++  NF KTP+L  S+R  +ADY+LP +VLIMSF GSY F DI+ D F  R E    I+  + + +  S  F  L L F LS LFF+DQN+TSA+VN   NKLKKG++++ DL +VA++N+ LS+FGLPW+HG LPHSPLH++ALAD+EER+  GH ++E I+ VRETRL  LI+H++I +S+  L   PL  +P +VL GLF+YMA+T+L GN++ ER++LL TEQ AYPP+HY+R+VPQRKVHLFT  QL QL +LCA GF+P P+ ++ FPI+    +PIRH + P+ I   Y+DALD
Sbjct:   21 VMTYNGTVPPIEITRSNSPIPSHAHFNLHSTNEDGDSGSLQHSFLRVPVGLSGRSSPSVASMGSEPESCIDD---TRYMTDDDDVIDEYDNVTLMYAKHEKIPMKDFGSEIRATMDIDHLLNKAVLLLDLQETSLEEIFAKIIHE-----MDI---QEPEFTSEQVRSVLFTQDAGN-QFHILSRTVQSICTTGSVGGSFDYDQTWICALCMLNTVQHRHVAIARLSHPTNLGRTMQDLRFIIIVIAPSRAKGTKTALETTRTFATLFADMEIRQRLVMAQSVEQFRSTLLSAAKELAMDQNQWRERKSSIHLSHAKEQIFGPEAWYPF-RGLVEEFKRRLAIYPSDYLDGIRGHKTVQKLFSTVVFLYFACLLPAIAFGVLNDDNTKGAINVRKVIIAQAIGGIFFSLFGGQPMIILLTTVPLAIYIKVIFKISQELGYDFLAMYACVGLFCQMFLILYSATELCSLMKFATRSAEEMFSLFIAIAFTVESIRAIHNSFKKNYNDCDTSAISMKAARTALNAFKNGSNADSIVGNITSSMSIGDTGSLCRRDTSILYMLLMFGTLWLGLFLYNFRKTPYLTRSRREWLADYALPASVLIMSFTGSYAFSDIEKDRFNLRFEFPL-IQMADVTSLPPSGYFVCLLLGFSLSFLFFIDQNITSAIVNNNQNKLKKGTSHNLDLFVVALLNMFLSVFGLPWMHGALPHSPLHLRALADVEERVSQGH-VHEVIMNVRETRLASLIAHVMILVSMFFLIPYPLQLIPTSVLHGLFLYMALTSLSGNEMFERLLLLITEQQAYPPTHYIRKVPQRKVHLFTACQLLQLIILCAFGFSPYPFIEMVFPIVCFFFLPIRHTLIPRLIDYKYLDALD 875          
BLAST of slc4a-4 vs. Ensembl Celegans
Match: abts-3 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:A0A3B1E4W4])

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 355/777 (45.69%), Postives = 524/777 (67.44%), Query Frame = 2
Query:  677 LVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLS--TDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRR--SIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-------VTTLVNKTV--PIVNTTLAKGLLNSTNEFITI--TTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXX-XXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            L+ A+ EKIP+KDF SE+RAT+D++  L + VL+LD++   ++ I   ++ E     MD+   Q   F +E   ++       N  +  L++T++ I    + G S   DQ+WI A+C L  V  RHVAIARL  P NLGR+ + + F+++VI P + K TK+ +E +RTFATL +DME R +L+ AQ+ ++F+  L + A++LA +Q  +R R  SI ++    Q F  E  +P   G+V++ ++R+ +Y SDY DGI+G  T++KL S   FLYFACLLP++AFGVL D NT G INV++VI++Q +GG+ F+L GGQP+I++LTT PL +YIKVI+ IS +    F  M++ VG+F  +FLILYS  +L  LM+++TRS EE+F+LFI+IAF V++++ +   F K+Y       ++    +T      N + A  ++ +    ++I  T    R++  +L++LL+ GT+WLG++  NF KTP+L  S+R  +ADY+LP +VLIMSF GSY F DI+ D F  R E    I+  + + +  S  F  L L F LS LFF+DQN+TSA+VN   NKLKKG++++ DL +VA++N+ LS+FGLPW+HG LPHSPLH++ALAD+EER+  GH ++E I+ VRETRL  LI+H++I +S+  L   PL  +P +VL GLF+YMA+T+L GN++ ER++LL TEQ AYPP+HY+R+VPQRKVHLFT  QL QL +LCA GF+P P+ ++ FPI+    +PIRH + P+ I   Y+DALD
Sbjct:  192 LMYAKHEKIPMKDFGSEIRATMDIDHLLNKAVLLLDLQETSLEEIFAKIIHE-----MDI---QEPEFTSEQVRSVLFTQDAGN-QFHILSRTVQSICTTGSVGGSFDYDQTWICALCMLNTVQHRHVAIARLSHPTNLGRTMQDLRFIIIVIAPSRAKGTKTALETTRTFATLFADMEIRQRLVMAQSVEQFRSTLLSAAKELAMDQNQWRERKSSIHLSHAKEQIFGPEAWYPF-RGLVEEFKRRLAIYPSDYLDGIRGHKTVQKLFSTVVFLYFACLLPAIAFGVLNDDNTKGAINVRKVIIAQAIGGIFFSLFGGQPMIILLTTVPLAIYIKVIFKISQELGYDFLAMYACVGLFCQMFLILYSATELCSLMKFATRSAEEMFSLFIAIAFTVESIRAIHNSFKKNYNDCDTSAISMKAARTALNAFKNGSNADSIVGNITSSMSIGDTGSLCRRDTSILYMLLMFGTLWLGLFLYNFRKTPYLTRSRREWLADYALPASVLIMSFTGSYAFSDIEKDRFNLRFEFPL-IQMADVTSLPPSGYFVCLLLGFSLSFLFFIDQNITSAIVNNNQNKLKKGTSHNLDLFVVALLNMFLSVFGLPWMHGALPHSPLHLRALADVEERVSQGH-VHEVIMNVRETRLASLIAHVMILVSMFFLIPYPLQLIPTSVLHGLFLYMALTSLSGNEMFERLLLLITEQQAYPPTHYIRKVPQRKVHLFTACQLLQLIILCAFGFSPYPFIEMVFPIVCFFFLPIRHTLIPRLIDYKYLDALD 956          
BLAST of slc4a-4 vs. Ensembl Celegans
Match: abts-3 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:A0A3B1E4W4])

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 356/777 (45.82%), Postives = 526/777 (67.70%), Query Frame = 2
Query:  677 LVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLS--TDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRR--SIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-------VTTLVNKTV--PIVNTTLAKGLLNSTNEFITI--TTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXX-XXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            L+ A+ EKIP+KDF SE+RAT+D++  L + VL+LD++   ++ I   ++ E     MD+   Q   F +E   ++       N  +  L++T++ I    + G S   DQ+WI A+C L  V  RHVAIARL  P NLGR+ + + F+++VI P + K TK+ +E +RTFATL +DME R +L+ AQ+ ++F+  L + A++LA +Q  +R R  SI ++    Q F  E  +P   G+V++ ++R+ +Y SDY DGI+G  T++KL S   FLYFACLLP++AFGVL D NT G INV++VI++Q +GG+ F+L GGQP+I++LTT PL +YIKVI+ IS +    F  M++ VG+F  +FLILYS  +L  LM+++TRS EE+F+LFI+IAF V++++ +   F K+Y       ++    +T      N + A  ++ +    ++I  T    R++  +L++LL+ GT+WLG++  NF KTP+L  S+R  +ADY+LP +VLIMSF GSY F DI+ D F  R E    I+  + + +  S  F  L L F LS LFF+DQN+TSA+VN   NKLKKG++++ DL +VA++N+ LS+FGLPW+HG LPHSPLH++ALAD+EER+  GH ++E I+ VRETRL  LI+H++I +S+  L+P PL  +P +VL GLF+YMA+T+L GN++ ER++LL TEQ AYPP+HY+R+VPQRKVHLFT  QL QL +LCA GF+P P+ ++ FPI+    +PIRH + P+ I   Y+DALD
Sbjct:  276 LMYAKHEKIPMKDFGSEIRATMDIDHLLNKAVLLLDLQETSLEEIFAKIIHE-----MDI---QEPEFTSEQVRSVLFTQDAGN-QFHILSRTVQSICTTGSVGGSFDYDQTWICALCMLNTVQHRHVAIARLSHPTNLGRTMQDLRFIIIVIAPSRAKGTKTALETTRTFATLFADMEIRQRLVMAQSVEQFRSTLLSAAKELAMDQNQWRERKSSIHLSHAKEQIFGPEAWYPF-RGLVEEFKRRLAIYPSDYLDGIRGHKTVQKLFSTVVFLYFACLLPAIAFGVLNDDNTKGAINVRKVIIAQAIGGIFFSLFGGQPMIILLTTVPLAIYIKVIFKISQELGYDFLAMYACVGLFCQMFLILYSATELCSLMKFATRSAEEMFSLFIAIAFTVESIRAIHNSFKKNYNDCDTSAISMKAARTALNAFKNGSNADSIVGNITSSMSIGDTGSLCRRDTSILYMLLMFGTLWLGLFLYNFRKTPYLTRSRREWLADYALPASVLIMSFTGSYAFSDIEKDRFNLRFEFPL-IQMADVTSLPPSGYFVCLLLGFSLSFLFFIDQNITSAIVNNNQNKLKKGTSHNLDLFVVALLNMFLSVFGLPWMHGALPHSPLHLRALADVEERVSQGH-VHEVIMNVRETRLASLIAHVMILVSMFFLIPYPLQLIPTSVLHGLFLYMALTSLSGNEMFERLLLLITEQQAYPPTHYIRKVPQRKVHLFTACQLLQLIILCAFGFSPYPFIEMVFPIVCFFFLPIRHTLIPRLIDYKYLDALD 1040          
BLAST of slc4a-4 vs. Ensembl Celegans
Match: abts-3 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:A0A3B1E4W4])

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 355/777 (45.69%), Postives = 524/777 (67.44%), Query Frame = 2
Query:  677 LVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLS--TDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRR--SIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-------VTTLVNKTV--PIVNTTLAKGLLNSTNEFITI--TTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXX-XXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            L+ A+ EKIP+KDF SE+RAT+D++  L + VL+LD++   ++ I   ++ E     MD+   Q   F +E   ++       N  +  L++T++ I    + G S   DQ+WI A+C L  V  RHVAIARL  P NLGR+ + + F+++VI P + K TK+ +E +RTFATL +DME R +L+ AQ+ ++F+  L + A++LA +Q  +R R  SI ++    Q F  E  +P   G+V++ ++R+ +Y SDY DGI+G  T++KL S   FLYFACLLP++AFGVL D NT G INV++VI++Q +GG+ F+L GGQP+I++LTT PL +YIKVI+ IS +    F  M++ VG+F  +FLILYS  +L  LM+++TRS EE+F+LFI+IAF V++++ +   F K+Y       ++    +T      N + A  ++ +    ++I  T    R++  +L++LL+ GT+WLG++  NF KTP+L  S+R  +ADY+LP +VLIMSF GSY F DI+ D F  R E    I+  + + +  S  F  L L F LS LFF+DQN+TSA+VN   NKLKKG++++ DL +VA++N+ LS+FGLPW+HG LPHSPLH++ALAD+EER+  GH ++E I+ VRETRL  LI+H++I +S+  L   PL  +P +VL GLF+YMA+T+L GN++ ER++LL TEQ AYPP+HY+R+VPQRKVHLFT  QL QL +LCA GF+P P+ ++ FPI+    +PIRH + P+ I   Y+DALD
Sbjct:   30 LMYAKHEKIPMKDFGSEIRATMDIDHLLNKAVLLLDLQETSLEEIFAKIIHE-----MDI---QEPEFTSEQVRSVLFTQDAGN-QFHILSRTVQSICTTGSVGGSFDYDQTWICALCMLNTVQHRHVAIARLSHPTNLGRTMQDLRFIIIVIAPSRAKGTKTALETTRTFATLFADMEIRQRLVMAQSVEQFRSTLLSAAKELAMDQNQWRERKSSIHLSHAKEQIFGPEAWYPF-RGLVEEFKRRLAIYPSDYLDGIRGHKTVQKLFSTVVFLYFACLLPAIAFGVLNDDNTKGAINVRKVIIAQAIGGIFFSLFGGQPMIILLTTVPLAIYIKVIFKISQELGYDFLAMYACVGLFCQMFLILYSATELCSLMKFATRSAEEMFSLFIAIAFTVESIRAIHNSFKKNYNDCDTSAISMKAARTALNAFKNGSNADSIVGNITSSMSIGDTGSLCRRDTSILYMLLMFGTLWLGLFLYNFRKTPYLTRSRREWLADYALPASVLIMSFTGSYAFSDIEKDRFNLRFEFPL-IQMADVTSLPPSGYFVCLLLGFSLSFLFFIDQNITSAIVNNNQNKLKKGTSHNLDLFVVALLNMFLSVFGLPWMHGALPHSPLHLRALADVEERVSQGH-VHEVIMNVRETRLASLIAHVMILVSMFFLIPYPLQLIPTSVLHGLFLYMALTSLSGNEMFERLLLLITEQQAYPPTHYIRKVPQRKVHLFTACQLLQLIILCAFGFSPYPFIEMVFPIVCFFFLPIRHTLIPRLIDYKYLDALD 794          
BLAST of slc4a-4 vs. Ensembl Celegans
Match: abts-3 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:A0A3B1E4W4])

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 355/777 (45.69%), Postives = 524/777 (67.44%), Query Frame = 2
Query:  677 LVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLS--TDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRR--SIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-------VTTLVNKTV--PIVNTTLAKGLLNSTNEFITI--TTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXX-XXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            L+ A+ EKIP+KDF SE+RAT+D++  L + VL+LD++   ++ I   ++ E     MD+   Q   F +E   ++       N  +  L++T++ I    + G S   DQ+WI A+C L  V  RHVAIARL  P NLGR+ + + F+++VI P + K TK+ +E +RTFATL +DME R +L+ AQ+ ++F+  L + A++LA +Q  +R R  SI ++    Q F  E  +P   G+V++ ++R+ +Y SDY DGI+G  T++KL S   FLYFACLLP++AFGVL D NT G INV++VI++Q +GG+ F+L GGQP+I++LTT PL +YIKVI+ IS +    F  M++ VG+F  +FLILYS  +L  LM+++TRS EE+F+LFI+IAF V++++ +   F K+Y       ++    +T      N + A  ++ +    ++I  T    R++  +L++LL+ GT+WLG++  NF KTP+L  S+R  +ADY+LP +VLIMSF GSY F DI+ D F  R E    I+  + + +  S  F  L L F LS LFF+DQN+TSA+VN   NKLKKG++++ DL +VA++N+ LS+FGLPW+HG LPHSPLH++ALAD+EER+  GH ++E I+ VRETRL  LI+H++I +S+  L   PL  +P +VL GLF+YMA+T+L GN++ ER++LL TEQ AYPP+HY+R+VPQRKVHLFT  QL QL +LCA GF+P P+ ++ FPI+    +PIRH + P+ I   Y+DALD
Sbjct:  123 LMYAKHEKIPMKDFGSEIRATMDIDHLLNKAVLLLDLQETSLEEIFAKIIHE-----MDI---QEPEFTSEQVRSVLFTQDAGN-QFHILSRTVQSICTTGSVGGSFDYDQTWICALCMLNTVQHRHVAIARLSHPTNLGRTMQDLRFIIIVIAPSRAKGTKTALETTRTFATLFADMEIRQRLVMAQSVEQFRSTLLSAAKELAMDQNQWRERKSSIHLSHAKEQIFGPEAWYPF-RGLVEEFKRRLAIYPSDYLDGIRGHKTVQKLFSTVVFLYFACLLPAIAFGVLNDDNTKGAINVRKVIIAQAIGGIFFSLFGGQPMIILLTTVPLAIYIKVIFKISQELGYDFLAMYACVGLFCQMFLILYSATELCSLMKFATRSAEEMFSLFIAIAFTVESIRAIHNSFKKNYNDCDTSAISMKAARTALNAFKNGSNADSIVGNITSSMSIGDTGSLCRRDTSILYMLLMFGTLWLGLFLYNFRKTPYLTRSRREWLADYALPASVLIMSFTGSYAFSDIEKDRFNLRFEFPL-IQMADVTSLPPSGYFVCLLLGFSLSFLFFIDQNITSAIVNNNQNKLKKGTSHNLDLFVVALLNMFLSVFGLPWMHGALPHSPLHLRALADVEERVSQGH-VHEVIMNVRETRLASLIAHVMILVSMFFLIPYPLQLIPTSVLHGLFLYMALTSLSGNEMFERLLLLITEQQAYPPTHYIRKVPQRKVHLFTACQLLQLIILCAFGFSPYPFIEMVFPIVCFFFLPIRHTLIPRLIDYKYLDALD 887          
BLAST of slc4a-4 vs. Ensembl Fly
Match: CG8177 (gene:FBgn0036043 transcript:FBtr0076326)

HSP 1 Score: 176.022 bits (445), Expect = 2.082e-44
Identity = 144/540 (26.67%), Postives = 266/540 (49.26%), Query Frame = 2
Query: 1370 LGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIV---NTTLAKGLLNSTNEFITITTE------------------ESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDI---KIDTFKTRSEEEFSIK--FVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRH 2911
            L  G+ +DL++R+P+Y SD  DG+       + ++A  F+YFACL  ++ FG L    T+  I +   ++S ++ G+ F  +  QPL+++ TT PL L+ + +     ++   F ++  +VG++  I  +  S  + S  +R  TR T+EIF+  I++ +IV+    ++ ++ ++ + +  N   P +        + LLN+T    T  T+                  +++    L   +L + T  +  Y   F  + FL  + R  + D+ +P+++ I   +  YL   +   K+   +  S  + S +  ++ F   S    FA +  A  + +L FM+  ++  +V+ P   LKKGS  HWD++++ ++N    +FG+PW       S  HV ++  +      G      IV V+E R        L+    +L+   L  +P+AVL G+F+YM + ++ G QL ER+ L F     YPP+ Y++R+   K+HLFT +Q+  L LL ++  +      + FP  L++ +PIR 
Sbjct:  602 LWGGLRNDLKRRMPMYKSDILDGLNT-----ETLAATIFMYFACLSTAITFGGLVSAKTNSWIGISETLISCSLVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQHEFDFLSLRVYVGVWLIIIALTVSAFEGSVYVRLLTRFTQEIFSALITLIYIVETFMKLISIYRENPLLSDYNLPPPTLVAHEHATNESLLNATASVTTNITQMVMNISTTAMPIGPPPLPKNQPNTALFCTILTLATFVVAYYLKLFRNSHFLGRNARRALGDFGVPISIAIFVLV-DYLVPAVYTEKLVVPEGLSPSDPSKRGWYIGFDTSSTWIPFACVIPALLVYILIFMESQISELIVDKPDRGLKKGSGLHWDIVLLCLLNCACGIFGMPWHCAATVRSVTHVSSVTIMSRTHAPGES--PRIVDVKEQR-LSGFFVCLMIGLSVLMAPLLRLIPMAVLFGVFLYMGVASMSGVQLFERIRLYFMPVKHYPPTSYVKRLRPWKLHLFTTIQVLCLVLLWSVKSS---QFSLAFPFFLIMMVPIRQ 1129          
BLAST of slc4a-4 vs. Ensembl Fly
Match: CG8177 (gene:FBgn0036043 transcript:FBtr0076322)

HSP 1 Score: 176.022 bits (445), Expect = 2.292e-44
Identity = 144/540 (26.67%), Postives = 266/540 (49.26%), Query Frame = 2
Query: 1370 LGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIV---NTTLAKGLLNSTNEFITITTE------------------ESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDI---KIDTFKTRSEEEFSIK--FVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRH 2911
            L  G+ +DL++R+P+Y SD  DG+       + ++A  F+YFACL  ++ FG L    T+  I +   ++S ++ G+ F  +  QPL+++ TT PL L+ + +     ++   F ++  +VG++  I  +  S  + S  +R  TR T+EIF+  I++ +IV+    ++ ++ ++ + +  N   P +        + LLN+T    T  T+                  +++    L   +L + T  +  Y   F  + FL  + R  + D+ +P+++ I   +  YL   +   K+   +  S  + S +  ++ F   S    FA +  A  + +L FM+  ++  +V+ P   LKKGS  HWD++++ ++N    +FG+PW       S  HV ++  +      G      IV V+E R        L+    +L+   L  +P+AVL G+F+YM + ++ G QL ER+ L F     YPP+ Y++R+   K+HLFT +Q+  L LL ++  +      + FP  L++ +PIR 
Sbjct:  597 LWGGLRNDLKRRMPMYKSDILDGLNT-----ETLAATIFMYFACLSTAITFGGLVSAKTNSWIGISETLISCSLVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQHEFDFLSLRVYVGVWLIIIALTVSAFEGSVYVRLLTRFTQEIFSALITLIYIVETFMKLISIYRENPLLSDYNLPPPTLVAHEHATNESLLNATASVTTNITQMVMNISTTAMPIGPPPLPKNQPNTALFCTILTLATFVVAYYLKLFRNSHFLGRNARRALGDFGVPISIAIFVLV-DYLVPAVYTEKLVVPEGLSPSDPSKRGWYIGFDTSSTWIPFACVIPALLVYILIFMESQISELIVDKPDRGLKKGSGLHWDIVLLCLLNCACGIFGMPWHCAATVRSVTHVSSVTIMSRTHAPGES--PRIVDVKEQR-LSGFFVCLMIGLSVLMAPLLRLIPMAVLFGVFLYMGVASMSGVQLFERIRLYFMPVKHYPPTSYVKRLRPWKLHLFTTIQVLCLVLLWSVKSS---QFSLAFPFFLIMMVPIRQ 1124          
BLAST of slc4a-4 vs. Ensembl Fly
Match: CG8177 (gene:FBgn0036043 transcript:FBtr0076327)

HSP 1 Score: 175.637 bits (444), Expect = 3.288e-44
Identity = 144/540 (26.67%), Postives = 266/540 (49.26%), Query Frame = 2
Query: 1370 LGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIV---NTTLAKGLLNSTNEFITITTE------------------ESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDI---KIDTFKTRSEEEFSIK--FVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRH 2911
            L  G+ +DL++R+P+Y SD  DG+       + ++A  F+YFACL  ++ FG L    T+  I +   ++S ++ G+ F  +  QPL+++ TT PL L+ + +     ++   F ++  +VG++  I  +  S  + S  +R  TR T+EIF+  I++ +IV+    ++ ++ ++ + +  N   P +        + LLN+T    T  T+                  +++    L   +L + T  +  Y   F  + FL  + R  + D+ +P+++ I   +  YL   +   K+   +  S  + S +  ++ F   S    FA +  A  + +L FM+  ++  +V+ P   LKKGS  HWD++++ ++N    +FG+PW       S  HV ++  +      G      IV V+E R        L+    +L+   L  +P+AVL G+F+YM + ++ G QL ER+ L F     YPP+ Y++R+   K+HLFT +Q+  L LL ++  +      + FP  L++ +PIR 
Sbjct:  669 LWGGLRNDLKRRMPMYKSDILDGLNT-----ETLAATIFMYFACLSTAITFGGLVSAKTNSWIGISETLISCSLVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQHEFDFLSLRVYVGVWLIIIALTVSAFEGSVYVRLLTRFTQEIFSALITLIYIVETFMKLISIYRENPLLSDYNLPPPTLVAHEHATNESLLNATASVTTNITQMVMNISTTAMPIGPPPLPKNQPNTALFCTILTLATFVVAYYLKLFRNSHFLGRNARRALGDFGVPISIAIFVLV-DYLVPAVYTEKLVVPEGLSPSDPSKRGWYIGFDTSSTWIPFACVIPALLVYILIFMESQISELIVDKPDRGLKKGSGLHWDIVLLCLLNCACGIFGMPWHCAATVRSVTHVSSVTIMSRTHAPGES--PRIVDVKEQR-LSGFFVCLMIGLSVLMAPLLRLIPMAVLFGVFLYMGVASMSGVQLFERIRLYFMPVKHYPPTSYVKRLRPWKLHLFTTIQVLCLVLLWSVKSS---QFSLAFPFFLIMMVPIRQ 1196          
BLAST of slc4a-4 vs. Ensembl Fly
Match: CG8177 (gene:FBgn0036043 transcript:FBtr0076325)

HSP 1 Score: 175.252 bits (443), Expect = 3.437e-44
Identity = 144/540 (26.67%), Postives = 266/540 (49.26%), Query Frame = 2
Query: 1370 LGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIV---NTTLAKGLLNSTNEFITITTE------------------ESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDI---KIDTFKTRSEEEFSIK--FVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRH 2911
            L  G+ +DL++R+P+Y SD  DG+       + ++A  F+YFACL  ++ FG L    T+  I +   ++S ++ G+ F  +  QPL+++ TT PL L+ + +     ++   F ++  +VG++  I  +  S  + S  +R  TR T+EIF+  I++ +IV+    ++ ++ ++ + +  N   P +        + LLN+T    T  T+                  +++    L   +L + T  +  Y   F  + FL  + R  + D+ +P+++ I   +  YL   +   K+   +  S  + S +  ++ F   S    FA +  A  + +L FM+  ++  +V+ P   LKKGS  HWD++++ ++N    +FG+PW       S  HV ++  +      G      IV V+E R        L+    +L+   L  +P+AVL G+F+YM + ++ G QL ER+ L F     YPP+ Y++R+   K+HLFT +Q+  L LL ++  +      + FP  L++ +PIR 
Sbjct:  637 LWGGLRNDLKRRMPMYKSDILDGLNT-----ETLAATIFMYFACLSTAITFGGLVSAKTNSWIGISETLISCSLVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQHEFDFLSLRVYVGVWLIIIALTVSAFEGSVYVRLLTRFTQEIFSALITLIYIVETFMKLISIYRENPLLSDYNLPPPTLVAHEHATNESLLNATASVTTNITQMVMNISTTAMPIGPPPLPKNQPNTALFCTILTLATFVVAYYLKLFRNSHFLGRNARRALGDFGVPISIAIFVLV-DYLVPAVYTEKLVVPEGLSPSDPSKRGWYIGFDTSSTWIPFACVIPALLVYILIFMESQISELIVDKPDRGLKKGSGLHWDIVLLCLLNCACGIFGMPWHCAATVRSVTHVSSVTIMSRTHAPGES--PRIVDVKEQR-LSGFFVCLMIGLSVLMAPLLRLIPMAVLFGVFLYMGVASMSGVQLFERIRLYFMPVKHYPPTSYVKRLRPWKLHLFTTIQVLCLVLLWSVKSS---QFSLAFPFFLIMMVPIRQ 1164          
BLAST of slc4a-4 vs. Ensembl Fly
Match: CG8177 (gene:FBgn0036043 transcript:FBtr0076324)

HSP 1 Score: 175.252 bits (443), Expect = 3.437e-44
Identity = 144/540 (26.67%), Postives = 266/540 (49.26%), Query Frame = 2
Query: 1370 LGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIV---NTTLAKGLLNSTNEFITITTE------------------ESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDI---KIDTFKTRSEEEFSIK--FVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRH 2911
            L  G+ +DL++R+P+Y SD  DG+       + ++A  F+YFACL  ++ FG L    T+  I +   ++S ++ G+ F  +  QPL+++ TT PL L+ + +     ++   F ++  +VG++  I  +  S  + S  +R  TR T+EIF+  I++ +IV+    ++ ++ ++ + +  N   P +        + LLN+T    T  T+                  +++    L   +L + T  +  Y   F  + FL  + R  + D+ +P+++ I   +  YL   +   K+   +  S  + S +  ++ F   S    FA +  A  + +L FM+  ++  +V+ P   LKKGS  HWD++++ ++N    +FG+PW       S  HV ++  +      G      IV V+E R        L+    +L+   L  +P+AVL G+F+YM + ++ G QL ER+ L F     YPP+ Y++R+   K+HLFT +Q+  L LL ++  +      + FP  L++ +PIR 
Sbjct:  637 LWGGLRNDLKRRMPMYKSDILDGLNT-----ETLAATIFMYFACLSTAITFGGLVSAKTNSWIGISETLISCSLVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQHEFDFLSLRVYVGVWLIIIALTVSAFEGSVYVRLLTRFTQEIFSALITLIYIVETFMKLISIYRENPLLSDYNLPPPTLVAHEHATNESLLNATASVTTNITQMVMNISTTAMPIGPPPLPKNQPNTALFCTILTLATFVVAYYLKLFRNSHFLGRNARRALGDFGVPISIAIFVLV-DYLVPAVYTEKLVVPEGLSPSDPSKRGWYIGFDTSSTWIPFACVIPALLVYILIFMESQISELIVDKPDRGLKKGSGLHWDIVLLCLLNCACGIFGMPWHCAATVRSVTHVSSVTIMSRTHAPGES--PRIVDVKEQR-LSGFFVCLMIGLSVLMAPLLRLIPMAVLFGVFLYMGVASMSGVQLFERIRLYFMPVKHYPPTSYVKRLRPWKLHLFTTIQVLCLVLLWSVKSS---QFSLAFPFFLIMMVPIRQ 1164          
BLAST of slc4a-4 vs. Ensembl Zebrafish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 478.404 bits (1230), Expect = 1.119e-153
Identity = 306/786 (38.93%), Postives = 495/786 (62.98%), Query Frame = 2
Query:  635 YYRTADENGEGLP-CLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQ-AFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-VTTLVNKTVPIVN---TTLAKGLLNSTNEFITITTEES----RKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            Y     + G G   C+  +    + + +F  EVRA  D++ FL+   ++L  +   +D +++ +LR +   + D    +      E  ++LF  A  +  +   L++TL+ +      G+   QSW+  +C++  + +RHV I+RL  P N G +   V +V+L++ P K K TK+ +EL RTFA++ SD+ FR +LL ++T++EFKE L      L   +R         T+  +Q      + F +G GI +DL +R+P+Y SD+ DG+ G    + K ++ + FLY A LLP++AFG L D++T G+I+V++ I+ Q++GG+ ++L  G PL++ LTTAP+ ++I VI  I   Y L F   ++ +G++NS+FLI+  + +LS L++   RS EE+ ALFISIAF+ DAVK  +K+F+ +Y   TL N +   +N    ++  G LN T E   ++  ES     +   LL LLL++GT+W+G     F ++PFL+   R +++D +LP++VL+ S++GSY+F DI +  F       F +  ++  +++ ++V +A+GL F L LL F+DQN+  ++ N P N+L KG+AYHWDL +  +IN+++S+ GLPW+H   PHS LHV+ LA +EER++ GH +YETIV V+ETR+T L+++ILIG+S+ LLP+PL ++P  VL GLF+Y+A+T++ GNQ+ +R+ LL  EQ +YPP+HY+R+VPQRK+H FT LQ+ QL  LCA G  P PY K+ FP+L+ + +PIR+ + P+ I   Y+D +D
Sbjct:   37 YGSQTHQGGPGQRVCVFASGFRYVKLMNFEEEVRAHRDLDGFLERASILLHEDEASLDDVLKTMLRHV---SQDPHTAEPGCNFEEIMSSLFTDAGSQEVNVHLLSETLQCVTATAT-GIQYQQSWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPSKMKSTKTAMELGRTFASMFSDISFRQKLLESKTQEEFKEALVIQRYHLTAAKRKTTAVEGEETDPHSQKPLKCRDFFRVGRGIYEDLCRRLPLYPSDFTDGLVGNNKALVKFMTTSIFLYIAVLLPAIAFGSLNDESTRGEIDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIMGGVFNLSLLVKLFKRSIEEVIALFISIAFVADAVKGTVKIFHDNYHAPTLANGSAAELNRISGSVHLGELNQT-EAGPVSLPESFILCTRARPLLCLLLMMGTLWVGYTLYQFRRSPFLHVKMREILSDCALPISVLVFSYVGSYVFNDIALPVFNFHEGPVFQVAPLD--KLTGASVLSAMGLGFLLFLLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERVEGGH-LYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIEGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCAFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIEAKYLDIMD 814          
BLAST of slc4a-4 vs. Ensembl Zebrafish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 478.404 bits (1230), Expect = 1.119e-153
Identity = 306/786 (38.93%), Postives = 495/786 (62.98%), Query Frame = 2
Query:  635 YYRTADENGEGLP-CLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQ-AFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-VTTLVNKTVPIVN---TTLAKGLLNSTNEFITITTEES----RKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            Y     + G G   C+  +    + + +F  EVRA  D++ FL+   ++L  +   +D +++ +LR +   + D    +      E  ++LF  A  +  +   L++TL+ +      G+   QSW+  +C++  + +RHV I+RL  P N G +   V +V+L++ P K K TK+ +EL RTFA++ SD+ FR +LL ++T++EFKE L      L   +R         T+  +Q      + F +G GI +DL +R+P+Y SD+ DG+ G    + K ++ + FLY A LLP++AFG L D++T G+I+V++ I+ Q++GG+ ++L  G PL++ LTTAP+ ++I VI  I   Y L F   ++ +G++NS+FLI+  + +LS L++   RS EE+ ALFISIAF+ DAVK  +K+F+ +Y   TL N +   +N    ++  G LN T E   ++  ES     +   LL LLL++GT+W+G     F ++PFL+   R +++D +LP++VL+ S++GSY+F DI +  F       F +  ++  +++ ++V +A+GL F L LL F+DQN+  ++ N P N+L KG+AYHWDL +  +IN+++S+ GLPW+H   PHS LHV+ LA +EER++ GH +YETIV V+ETR+T L+++ILIG+S+ LLP+PL ++P  VL GLF+Y+A+T++ GNQ+ +R+ LL  EQ +YPP+HY+R+VPQRK+H FT LQ+ QL  LCA G  P PY K+ FP+L+ + +PIR+ + P+ I   Y+D +D
Sbjct:   37 YGSQTHQGGPGQRVCVFASGFRYVKLMNFEEEVRAHRDLDGFLERASILLHEDEASLDDVLKTMLRHV---SQDPHTAEPGCNFEEIMSSLFTDAGSQEVNVHLLSETLQCVTATAT-GIQYQQSWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPSKMKSTKTAMELGRTFASMFSDISFRQKLLESKTQEEFKEALVIQRYHLTAAKRKTTAVEGEETDPHSQKPLKCRDFFRVGRGIYEDLCRRLPLYPSDFTDGLVGNNKALVKFMTTSIFLYIAVLLPAIAFGSLNDESTRGEIDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIMGGVFNLSLLVKLFKRSIEEVIALFISIAFVADAVKGTVKIFHDNYHAPTLANGSAAELNRISGSVHLGELNQT-EAGPVSLPESFILCTRARPLLCLLLMMGTLWVGYTLYQFRRSPFLHVKMREILSDCALPISVLVFSYVGSYVFNDIALPVFNFHEGPVFQVAPLD--KLTGASVLSAMGLGFLLFLLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERVEGGH-LYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIEGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCAFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIEAKYLDIMD 814          
BLAST of slc4a-4 vs. Ensembl Zebrafish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 476.478 bits (1225), Expect = 2.409e-153
Identity = 302/763 (39.58%), Postives = 488/763 (63.96%), Query Frame = 2
Query:  701 IPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQ-AFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-VTTLVNKTVPIVN---TTLAKGLLNSTNEFITITTEES----RKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            + + +F  EVRA  D++ FL+   ++L  +   +D +++ +LR +   + D    +      E  ++LF  A  +  +   L++TL+ +      G+   QSW+  +C++  + +RHV I+RL  P N G +   V +V+L++ P K K TK+ +EL RTFA++ SD+ FR +LL ++T++EFKE L      L   +R         T+  +Q      + F +G GI +DL +R+P+Y SD+ DG+ G    + K ++ + FLY A LLP++AFG L D++T G+I+V++ I+ Q++GG+ ++L  G PL++ LTTAP+ ++I VI  I   Y L F   ++ +G++NS+FLI+  + +LS L++   RS EE+ ALFISIAF+ DAVK  +K+F+ +Y   TL N +   +N    ++  G LN T E   ++  ES     +   LL LLL++GT+W+G     F ++PFL+   R +++D +LP++VL+ S++GSY+F DI +  F       F +  ++  +++ ++V +A+GL F L LL F+DQN+  ++ N P N+L KG+AYHWDL +  +IN+++S+ GLPW+H   PHS LHV+ LA +EER++ GH +YETIV V+ETR+T L+++ILIG+S+ LLP+PL ++P  VL GLF+Y+A+T++ GNQ+ +R+ LL  EQ +YPP+HY+R+VPQRK+H FT LQ+ QL  LCA G  P PY K+ FP+L+ + +PIR+ + P+ I   Y+D +D
Sbjct:   24 VKLMNFEEEVRAHRDLDGFLERASILLHEDEASLDDVLKTMLRHV---SQDPHTAEPGCNFEEIMSSLFTDAGSQEVNVHLLSETLQCVTATAT-GIQYQQSWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPSKMKSTKTAMELGRTFASMFSDISFRQKLLESKTQEEFKEALVIQRYHLTAAKRKTTAVEGEETDPHSQKPLKCRDFFRVGRGIYEDLCRRLPLYPSDFTDGLVGNNKALVKFMTTSIFLYIAVLLPAIAFGSLNDESTRGEIDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIMGGVFNLSLLVKLFKRSIEEVIALFISIAFVADAVKGTVKIFHDNYHAPTLANGSAAELNRISGSVHLGELNQT-EAGPVSLPESFILCTRARPLLCLLLMMGTLWVGYTLYQFRRSPFLHVKMREILSDCALPISVLVFSYVGSYVFNDIALPVFNFHEGPVFQVAPLD--KLTGASVLSAMGLGFLLFLLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERVEGGH-LYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIEGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCAFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIEAKYLDIMD 778          
BLAST of slc4a-4 vs. Ensembl Zebrafish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 476.478 bits (1225), Expect = 2.409e-153
Identity = 302/763 (39.58%), Postives = 488/763 (63.96%), Query Frame = 2
Query:  701 IPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQ-AFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-VTTLVNKTVPIVN---TTLAKGLLNSTNEFITITTEES----RKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            + + +F  EVRA  D++ FL+   ++L  +   +D +++ +LR +   + D    +      E  ++LF  A  +  +   L++TL+ +      G+   QSW+  +C++  + +RHV I+RL  P N G +   V +V+L++ P K K TK+ +EL RTFA++ SD+ FR +LL ++T++EFKE L      L   +R         T+  +Q      + F +G GI +DL +R+P+Y SD+ DG+ G    + K ++ + FLY A LLP++AFG L D++T G+I+V++ I+ Q++GG+ ++L  G PL++ LTTAP+ ++I VI  I   Y L F   ++ +G++NS+FLI+  + +LS L++   RS EE+ ALFISIAF+ DAVK  +K+F+ +Y   TL N +   +N    ++  G LN T E   ++  ES     +   LL LLL++GT+W+G     F ++PFL+   R +++D +LP++VL+ S++GSY+F DI +  F       F +  ++  +++ ++V +A+GL F L LL F+DQN+  ++ N P N+L KG+AYHWDL +  +IN+++S+ GLPW+H   PHS LHV+ LA +EER++ GH +YETIV V+ETR+T L+++ILIG+S+ LLP+PL ++P  VL GLF+Y+A+T++ GNQ+ +R+ LL  EQ +YPP+HY+R+VPQRK+H FT LQ+ QL  LCA G  P PY K+ FP+L+ + +PIR+ + P+ I   Y+D +D
Sbjct:   24 VKLMNFEEEVRAHRDLDGFLERASILLHEDEASLDDVLKTMLRHV---SQDPHTAEPGCNFEEIMSSLFTDAGSQEVNVHLLSETLQCVTATAT-GIQYQQSWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPSKMKSTKTAMELGRTFASMFSDISFRQKLLESKTQEEFKEALVIQRYHLTAAKRKTTAVEGEETDPHSQKPLKCRDFFRVGRGIYEDLCRRLPLYPSDFTDGLVGNNKALVKFMTTSIFLYIAVLLPAIAFGSLNDESTRGEIDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIMGGVFNLSLLVKLFKRSIEEVIALFISIAFVADAVKGTVKIFHDNYHAPTLANGSAAELNRISGSVHLGELNQT-EAGPVSLPESFILCTRARPLLCLLLMMGTLWVGYTLYQFRRSPFLHVKMREILSDCALPISVLVFSYVGSYVFNDIALPVFNFHEGPVFQVAPLD--KLTGASVLSAMGLGFLLFLLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERVEGGH-LYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIEGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCAFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIEAKYLDIMD 778          
BLAST of slc4a-4 vs. Ensembl Zebrafish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 476.863 bits (1226), Expect = 9.330e-153
Identity = 302/763 (39.58%), Postives = 488/763 (63.96%), Query Frame = 2
Query:  701 IPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQ-AFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-VTTLVNKTVPIVN---TTLAKGLLNSTNEFITITTEES----RKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            + + +F  EVRA  D++ FL+   ++L  +   +D +++ +LR +   + D    +      E  ++LF  A  +  +   L++TL+ +      G+   QSW+  +C++  + +RHV I+RL  P N G +   V +V+L++ P K K TK+ +EL RTFA++ SD+ FR +LL ++T++EFKE L      L   +R         T+  +Q      + F +G GI +DL +R+P+Y SD+ DG+ G    + K ++ + FLY A LLP++AFG L D++T G+I+V++ I+ Q++GG+ ++L  G PL++ LTTAP+ ++I VI  I   Y L F   ++ +G++NS+FLI+  + +LS L++   RS EE+ ALFISIAF+ DAVK  +K+F+ +Y   TL N +   +N    ++  G LN T E   ++  ES     +   LL LLL++GT+W+G     F ++PFL+   R +++D +LP++VL+ S++GSY+F DI +  F       F +  ++  +++ ++V +A+GL F L LL F+DQN+  ++ N P N+L KG+AYHWDL +  +IN+++S+ GLPW+H   PHS LHV+ LA +EER++ GH +YETIV V+ETR+T L+++ILIG+S+ LLP+PL ++P  VL GLF+Y+A+T++ GNQ+ +R+ LL  EQ +YPP+HY+R+VPQRK+H FT LQ+ QL  LCA G  P PY K+ FP+L+ + +PIR+ + P+ I   Y+D +D
Sbjct:   88 VKLMNFEEEVRAHRDLDGFLERASILLHEDEASLDDVLKTMLRHV---SQDPHTAEPGCNFEEIMSSLFTDAGSQEVNVHLLSETLQCVTATAT-GIQYQQSWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPSKMKSTKTAMELGRTFASMFSDISFRQKLLESKTQEEFKEALVIQRYHLTAAKRKTTAVEGEETDPHSQKPLKCRDFFRVGRGIYEDLCRRLPLYPSDFTDGLVGNNKALVKFMTTSIFLYIAVLLPAIAFGSLNDESTRGEIDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIMGGVFNLSLLVKLFKRSIEEVIALFISIAFVADAVKGTVKIFHDNYHAPTLANGSAAELNRISGSVHLGELNQT-EAGPVSLPESFILCTRARPLLCLLLMMGTLWVGYTLYQFRRSPFLHVKMREILSDCALPISVLVFSYVGSYVFNDIALPVFNFHEGPVFQVAPLD--KLTGASVLSAMGLGFLLFLLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERVEGGH-LYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIEGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCAFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIEAKYLDIMD 842          
BLAST of slc4a-4 vs. Ensembl Xenopus
Match: SLC4A11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:100486382])

HSP 1 Score: 505.368 bits (1300), Expect = 4.185e-163
Identity = 331/807 (41.02%), Postives = 485/807 (60.10%), Query Frame = 2
Query:  644 TADENGEGLPCLVLARLEK-IPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIY--PLAMDVSIG---QMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLF---------AQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVT---------TLVNKTVPIVNTTLAKGLLNSTNEFITITTEESR--------KENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFK-TRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSP-LHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            TA+    G  C++L    K + +K+F  EVRA  D++ FL +  +ILD  A  +D ++  +L+     P   + S      M T  T++        H        L+ T++G+      G+   QSW+  +C++  + KRHV I+RL+ P N G +S  V FV+LV+ P K K TK+  E+ RTF+T+ SD+ FR +LL          A         L N    L +  ++   + +++ E  N          +G GI DD+ +R+PVY  D+ DGI G    I K ++   FLYFACLLPS+AFG L D++T G I+V++ I+ Q +GG+ ++L  GQPL+V+LTTAPL LYI VI  I   Y+L F   ++W G++NS FLILYSL + S LM+   RSTEEI ALFISI F++DA+K ++K+F K Y+             NK +P +N T +  LLNST          S         +E+ +L L+L+ GT+WLG     F K+P+L+S  R +++D +LP++VL  S +GSY FK+I I  F   ++E  F +  +    + +  + +A+GL F LS+LFF++QN+ +++ N P N+L KG+AYHWDLL+VA+IN  LS+FG+PW+H    HS      A    +    +GH IYETIV VRETRLT L++++L+GLSL LLP PL ++P  VL GLF+Y+A+T++ G+QL ERV LL  EQ AYPP+HY+RRVPQRK+H FT LQ+ QL +LC  G +P PY K+ FP++++  +PIR+ + PK I   Y+DA+D
Sbjct:   82 TAENESSG--CVLLHTSRKYLKLKNFEEEVRAHRDLDGFLAKASIILDETATSLDDVLREMLKHFVEDPENAEPSCNFNKIMSTLFTDSGAPREGNVHL-------LSDTIQGVTATAT-GVQYQQSWLCIICTIKSLQKRHVCISRLERPQNWGENSCEVRFVILVLAPPKMKSTKTATEVGRTFSTMFSDINFRQKLLETKTEEEFKEALVHQRHLLTLVNKHSSLNDGHKVQSHKPLKLNEFFN----------VGKGIFDDIARRLPVYPLDFTDGIIGNNKAIGKYITTMIFLYFACLLPSIAFGSLNDESTAGVIDVQKTIVGQCIGGVIYSLFSGQPLVVLLTTAPLALYINVIRGICDDYNLDFKAFYAWTGLWNSCFLILYSLFNCSLLMKLFKRSTEEIIALFISITFVLDALKGIIKIFKKYYLEIPSSHTYPDQEYNKHLPNLNFT-SDVLLNSTFNGSVFAPNGSSDHEEIHYGRESAVLSLMLMFGTLWLGHTLYQFKKSPYLHSRVREMLSDCALPISVLTFSVVGSYFFKEIHIAKFNYIKTESMFVLAPIG--SLPMGPITSAMGLGFLLSMLFFIEQNIVASLTNAPENRLVKGTAYHWDLLLVALINTGLSVFGMPWIHAAFLHSHNARAGARQSWKREWSTGH-IYETIVSVRETRLTSLVANVLVGLSLFLLPYPLQWIPKPVLYGLFLYIALTSIDGSQLFERVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLVILCGFGMSPLPYMKMIFPLIMIGMIPIRYNLLPKIIESKYLDAMD 864          
BLAST of slc4a-4 vs. Ensembl Xenopus
Match: SLC4A11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:100486382])

HSP 1 Score: 504.212 bits (1297), Expect = 7.905e-163
Identity = 331/807 (41.02%), Postives = 485/807 (60.10%), Query Frame = 2
Query:  644 TADENGEGLPCLVLARLEK-IPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIY--PLAMDVSIG---QMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLF---------AQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVT---------TLVNKTVPIVNTTLAKGLLNSTNEFITITTEESR--------KENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFK-TRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSP-LHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            TA+    G  C++L    K + +K+F  EVRA  D++ FL +  +ILD  A  +D ++  +L+     P   + S      M T  T++        H        L+ T++G+      G+   QSW+  +C++  + KRHV I+RL+ P N G +S  V FV+LV+ P K K TK+  E+ RTF+T+ SD+ FR +LL          A         L N    L +  ++   + +++ E  N          +G GI DD+ +R+PVY  D+ DGI G    I K ++   FLYFACLLPS+AFG L D++T G I+V++ I+ Q +GG+ ++L  GQPL+V+LTTAPL LYI VI  I   Y+L F   ++W G++NS FLILYSL + S LM+   RSTEEI ALFISI F++DA+K ++K+F K Y+             NK +P +N T +  LLNST          S         +E+ +L L+L+ GT+WLG     F K+P+L+S  R +++D +LP++VL  S +GSY FK+I I  F   ++E  F +  +    + +  + +A+GL F LS+LFF++QN+ +++ N P N+L KG+AYHWDLL+VA+IN  LS+FG+PW+H    HS      A    +    +GH IYETIV VRETRLT L++++L+GLSL LLP PL ++P  VL GLF+Y+A+T++ G+QL ERV LL  EQ AYPP+HY+RRVPQRK+H FT LQ+ QL +LC  G +P PY K+ FP++++  +PIR+ + PK I   Y+DA+D
Sbjct:   79 TAENESSG--CVLLHTSRKYLKLKNFEEEVRAHRDLDGFLAKASIILDETATSLDDVLREMLKHFVEDPENAEPSCNFNKIMSTLFTDSGAPREGNVHL-------LSDTIQGVTATAT-GVQYQQSWLCIICTIKSLQKRHVCISRLERPQNWGENSCEVRFVILVLAPPKMKSTKTATEVGRTFSTMFSDINFRQKLLETKTEEEFKEALVHQRHLLTLVNKHSSLNDGHKVQSHKPLKLNEFFN----------VGKGIFDDIARRLPVYPLDFTDGIIGNNKAIGKYITTMIFLYFACLLPSIAFGSLNDESTAGVIDVQKTIVGQCIGGVIYSLFSGQPLVVLLTTAPLALYINVIRGICDDYNLDFKAFYAWTGLWNSCFLILYSLFNCSLLMKLFKRSTEEIIALFISITFVLDALKGIIKIFKKYYLEIPSSHTYPDQEYNKHLPNLNFT-SDVLLNSTFNGSVFAPNGSSDHEEIHYGRESAVLSLMLMFGTLWLGHTLYQFKKSPYLHSRVREMLSDCALPISVLTFSVVGSYFFKEIHIAKFNYIKTESMFVLAPIG--SLPMGPITSAMGLGFLLSMLFFIEQNIVASLTNAPENRLVKGTAYHWDLLLVALINTGLSVFGMPWIHAAFLHSHNARAGARQSWKREWSTGH-IYETIVSVRETRLTSLVANVLVGLSLFLLPYPLQWIPKPVLYGLFLYIALTSIDGSQLFERVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLVILCGFGMSPLPYMKMIFPLIMIGMIPIRYNLLPKIIESKYLDAMD 861          
BLAST of slc4a-4 vs. Ensembl Xenopus
Match: SLC4A11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:100486382])

HSP 1 Score: 486.878 bits (1252), Expect = 3.473e-156
Identity = 318/769 (41.35%), Postives = 466/769 (60.60%), Query Frame = 2
Query:  707 IKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIY--PLAMDVSIG---QMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLF---------AQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTL---------VNKTVPIVNTTLAKGLLNSTNEFITITTEESR--------KENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFK-TRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSP-LHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRH 2911
            +K+F  EVRA  D++ FL +  +ILD  A  +D ++  +L+     P   + S      M T  T++        H        L+ T++G+      G+   QSW+  +C++  + KRHV I+RL+ P N G +S  V FV+LV+ P K K TK+  E+ RTF+T+ SD+ FR +LL          A         L N    L +  ++   + +++    +      E F +G GI DD+ +R+PVY  D+ DGI G    I K ++   FLYFACLLPS+AFG L D++T G I+V++ I+ Q +GG+ ++L  GQPL+V+LTTAPL LYI VI  I   Y+L F   ++W G++NS FLILYSL + S LM+   RSTEEI ALFISI F++DA+K ++K+F K Y+             NK +P +N T +  LLNST          S         +E+ +L L+L+ GT+WLG     F K+P+L+S  R +++D +LP++VL  S +GSY FK+I I  F   ++E  F +  +    + +  + +A+GL F LS+LFF++QN+ +++ N P N+L KG+AYHWDLL+VA+IN  LS+FG+PW+H    HS      A    +    +GH IYETIV VRETRLT L++++L+GLSL LLP PL ++P  VL GLF+Y+A+T++ G+QL ERV LL  EQ AYPP+HY+RRVPQRK+H FT LQ+ QL +LC  G +P PY K+ FP++++  +PIR+
Sbjct:   93 LKNFEEEVRAHRDLDGFLAKASIILDETATSLDDVLREMLKHFVEDPENAEPSCNFNKIMSTLFTDSGAPREGNVHL-------LSDTIQGVTATAT-GVQYQQSWLCIICTIKSLQKRHVCISRLERPQNWGENSCEVRFVILVLAPPKMKSTKTATEVGRTFSTMFSDINFRQKLLETKTEEEFKEALVHQRHLLTLVNKHSSLNDGHKVQSHKPLKVRG--SSPPKLNEFFNVGKGIFDDIARRLPVYPLDFTDGIIGNNKAIGKYITTMIFLYFACLLPSIAFGSLNDESTAGVIDVQKTIVGQCIGGVIYSLFSGQPLVVLLTTAPLALYINVIRGICDDYNLDFKAFYAWTGLWNSCFLILYSLFNCSLLMKLFKRSTEEIIALFISITFVLDALKGIIKIFKKYYLEIPSSHTYPDQEYNKHLPNLNFT-SDVLLNSTFNGSVFAPNGSSDHEEIHYGRESAVLSLMLMFGTLWLGHTLYQFKKSPYLHSRVREMLSDCALPISVLTFSVVGSYFFKEIHIAKFNYIKTESMFVLAPIG--SLPMGPITSAMGLGFLLSMLFFIEQNIVASLTNAPENRLVKGTAYHWDLLLVALINTGLSVFGMPWIHAAFLHSHNARAGARQSWKREWSTGH-IYETIVSVRETRLTSLVANVLVGLSLFLLPYPLQWIPKPVLYGLFLYIALTSIDGSQLFERVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLVILCGFGMSPLPYMKMIFPLIMIGMIPIRY 847          
BLAST of slc4a-4 vs. Ensembl Xenopus
Match: SLC4A11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:100486382])

HSP 1 Score: 472.626 bits (1215), Expect = 3.465e-152
Identity = 307/751 (40.88%), Postives = 453/751 (60.32%), Query Frame = 2
Query:  707 IKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIY--PLAMDVSIG---QMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLF---------AQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSP-LHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRH 2911
            +K+F  EVRA  D++ FL +  +ILD  A  +D ++  +L+     P   + S      M T  T++        H        L+ T++G+      G+   QSW+  +C++  + KRHV I+RL+ P N G +S  V FV+LV+ P K K TK+  E+ RTF+T+ SD+ FR +LL          A         L N    L +  ++   + +++ E  N          +G GI DD+ +R+PVY  D+ DGI G    I K ++   FLYFACLLPS+AFG L D++T G I+V++ I+ Q +GG+ ++L  GQPL+V+LTTAPL LYI VI  I   Y+L F   ++W G++NS FLILYSL + S LM+   RSTEEI ALFISI F++DA+K ++K   KS      N  + +V             E +  T     +E+ +L L+L+ GT+WLG     F K+P+L+S  R +++D +LP++VL  S +GSY FK+I      ++  + F +  +    + +  + +A+GL F LS+LFF++QN+ +++ N P N+L KG+AYHWDLL+VA+IN  LS+FG+PW+H    HS      A    +    +GH IYETIV VRETRLT L++++L+GLSL LLP PL ++P  VL GLF+Y+A+T++ G+QL ERV LL  EQ AYPP+HY+RRVPQRK+H FT LQ+ QL +LC  G +P PY K+ FP++++  +PIR+
Sbjct:   21 LKNFEEEVRAHRDLDGFLAKASIILDETATSLDDVLREMLKHFVEDPENAEPSCNFNKIMSTLFTDSGAPREGNVHL-------LSDTIQGVTATAT-GVQYQQSWLCIICTIKSLQKRHVCISRLERPQNWGENSCEVRFVILVLAPPKMKSTKTATEVGRTFSTMFSDINFRQKLLETKTEEEFKEALVHQRHLLTLVNKHSSLNDGHKVQSHKPLKLNEFFN----------VGKGIFDDIARRLPVYPLDFTDGIIGNNKAIGKYITTMIFLYFACLLPSIAFGSLNDESTAGVIDVQKTIVGQCIGGVIYSLFSGQPLVVLLTTAPLALYINVIRGICDDYNLDFKAFYAWTGLWNSCFLILYSLFNCSLLMKLFKRSTEEIIALFISITFVLDALKGIIKS--KSIYYPQTNSNMRLV-----------WKELLGYTEIHYGRESAVLSLMLMFGTLWLGHTLYQFKKSPYLHSRVREMLSDCALPISVLTFSVVGSYFFKEI-----HSKLPDMFVLAPIG--SLPMGPITSAMGLGFLLSMLFFIEQNIVASLTNAPENRLVKGTAYHWDLLLVALINTGLSVFGMPWIHAAFLHSHNARAGARQSWKREWSTGH-IYETIVSVRETRLTSLVANVLVGLSLFLLPYPLQWIPKPVLYGLFLYIALTSIDGSQLFERVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLVILCGFGMSPLPYMKMIFPLIMIGMIPIRY 732          
BLAST of slc4a-4 vs. Ensembl Xenopus
Match: SLC4A11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:100486382])

HSP 1 Score: 454.136 bits (1167), Expect = 1.273e-144
Identity = 309/766 (40.34%), Postives = 456/766 (59.53%), Query Frame = 2
Query:  644 TADENGEGLPCLVLARLEK-IPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIY--PLAMDVSIG---QMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEML--QNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSP-LHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRH 2911
            TA+    G  C++L    K + +K+F  EVRA  D++ FL +  +ILD  A  +D ++  +L+     P   + S      M T  T++        H        L+ T++G+      G+   QSW+  +C++  + KRHV I+RL+ P N G +S  V FV+LV+ P K K TK+  E+ RTF+T+ SD+ FR +LL  +TE+EFKE L  Q H   L  +              +N      E F +G GI DD+ +R+PVY  D+ DGI G    I K ++   FLYFACLLPS+AFG L D++T G I+V++ I+ Q +GG+ ++L  GQPL+V+LTTAPL LYI VI  I   Y+L F   ++W G++NS FLILYSL + S LM+   RSTEEI ALFISI F++DA+K ++K           +K++  + +    G          +  + +   +G        G +WL          P+L+S  R +++D +LP++VL  S +GSY FK+I      ++  + F +  +    + +  + +A+GL F LS+LFF++QN+ +++ N P N+L KG+AYHWDLL+VA+IN  LS+FG+PW+H    HS      A    +    +GH IYETIV VRETRLT L++++L+GLSL LLP PL ++P  VL GLF+Y+A+T++ G+QL ERV LL  EQ AYPP+HY+RRVPQRK+H FT LQ+ QL +LC  G +P PY K+ FP++++  +PIR+
Sbjct:   64 TAENESSG--CVLLHTSRKYLKLKNFEEEVRAHRDLDGFLAKASIILDETATSLDDVLREMLKHFVEDPENAEPSCNFNKIMSTLFTDSGAPREGNVHL-------LSDTIQGVTATAT-GVQYQQSWLCIICTIKSLQKRHVCISRLERPQNWGENSCEVRFVILVLAPPKMKSTKTATEVGRTFSTMFSDINFRQKLLETKTEEEFKEALVHQRHLLTLVNKH-----------SSLNDGHKLNEFFNVGKGIFDDIARRLPVYPLDFTDGIIGNNKAIGKYITTMIFLYFACLLPSIAFGSLNDESTAGVIDVQKTIVGQCIGGVIYSLFSGQPLVVLLTTAPLALYINVIRGICDDYNLDFKAFYAWTGLWNSCFLILYSLFNCSLLMKLFKRSTEEIIALFISITFVLDALKGIIK-----------SKSIYCIISVRPLGRDWGCGIAGIVGRDGAYSSSGW-------GGLWL----------PYLHSRVREMLSDCALPISVLTFSVVGSYFFKEI-----HSKLPDMFVLAPIG--SLPMGPITSAMGLGFLLSMLFFIEQNIVASLTNAPENRLVKGTAYHWDLLLVALINTGLSVFGMPWIHAAFLHSHNARAGARQSWKREWSTGH-IYETIVSVRETRLTSLVANVLVGLSLFLLPYPLQWIPKPVLYGLFLYIALTSIDGSQLFERVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLVILCGFGMSPLPYMKMIFPLIMIGMIPIRY 772          
BLAST of slc4a-4 vs. Ensembl Mouse
Match: Slc4a11 (solute carrier family 4, sodium bicarbonate transporter-like, member 11 [Source:MGI Symbol;Acc:MGI:2138987])

HSP 1 Score: 530.406 bits (1365), Expect = 5.372e-173
Identity = 345/792 (43.56%), Postives = 497/792 (62.75%), Query Frame = 2
Query:  674 CLVLARLEK-IPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDT--------FITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEML--QNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYV-----TTLVNKTVPI----------VNTTLAKGLLNSTNEFITITTE---ESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            C++L    K + +K+F  EVRA  D++ FL +  +IL+  A  +D ++  +L      A+D +  + D           T+A   +  K H  + + Q +  T++G+          +QSW+  +C++  + KRHV I+RL  P N G +S  V FV+LV+ P K K TK+ +E++RTFAT+ SD+ FR +LL  +TE+EFKE L  Q     +   +      S   T    Q    ++ FP G GI  D+ +R PVY  D+ DGI G   ++ K V+   FLYFACLLP++AFG L D+NT+G I+V++ I  Q++GGL +AL  GQPL+++LTTAPL +Y +VI  I   Y+L F   ++W G++NS FL LY+ L+LS LM    RSTEEI ALFISI F++DAVK ++K+F K Y      T   +  V +          ++T L   LL S  E  T ++     S +   +L LL+++GT+WLG     F K+P+L+   R  ++D +LP+AVL  S IGSY F++I++  F+    E    +      +S  A+ +A+GL F LSLLFF++QN+ +A+VN P N+L KG+AYHWDLL++AIIN  LSLFGLPW+H   PHSPLHV+ALA +EER+++GH IYETIV V+ETRLT L + +L+GLSLLLLP PL ++P  VL GLF+Y+A+T+L GNQL  RV LL  EQ +YPP+HY+RRVPQRK+H FT LQ+ QL LLCA G +  PY K+ FP++++  +PIR+ + P+ I   Y+D +D
Sbjct:   79 CVLLHTSRKYLKLKNFEEEVRAHRDLDGFLAQASIILNETATSLDDVLRTMLNR---FALDPNHAEPDCDLDLLMAKLFTDAGAPMESKVHLLSDTIQGVTATVRGV--------QYEQSWLCIICTMKTLQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDITFRQKLLKTRTEEEFKEALVHQRQLLTMMMPRAAGHSMSSLHTHRHPQPPKCKDFFPFGKGIWMDIMRRFPVYPMDFTDGIIGKSKSVGKYVTTTLFLYFACLLPTIAFGSLNDENTNGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLAIYTQVIRVICDDYNLDFNAFYAWTGLWNSFFLALYAFLNLSLLMNLFKRSTEEIIALFISITFVLDAVKGMVKIFGKYYYGHHYHTKRTSSLVSLLGIGRSPNSSLHTALNASLLASPVEMATTSSPGSTHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVRETLSDCALPIAVLSFSLIGSYGFQEIEMSKFRYNPSESL-FEVAQIHSLSFKAIGSAMGLGFLLSLLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYETIVDVKETRLTALGASVLVGLSLLLLPFPLQWIPKPVLYGLFLYIALTSLDGNQLFSRVALLLKEQTSYPPTHYIRRVPQRKIHYFTGLQILQLLLLCAFGMSSLPYMKMVFPLIMIAMIPIRYNLLPRIIEAKYLDVMD 857          
BLAST of slc4a-4 vs. Ensembl Mouse
Match: Slc4a1 (solute carrier family 4 (anion exchanger), member 1 [Source:MGI Symbol;Acc:MGI:109393])

HSP 1 Score: 189.504 bits (480), Expect = 8.768e-49
Identity = 160/536 (29.85%), Postives = 284/536 (52.99%), Query Frame = 2
Query: 1376 NGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIM----SFI-GSYLFKDIKIDTFK--TRSEEEFSIKFVNFSQI-SISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
             G++ D+R+R P Y+SD  D +       ++++A  F+YFA L P++ FG L  + T   + V  +++S  V G+ FAL+G QPL+V+  + PL ++ +  ++     +L +    +W+G +  + ++L    + S L+++ +R T+EIF+  IS+ FI +    ++K+F + Y   L     P+V     +G + +T  F  +               L+ GT  L +    F  + +     R ++ D+ +P+++LIM    SFI G+Y  K    D  K    S   + I  +   ++     +FA++  A  + +L F++  +T+ +V+ P  K+ KGS +H DLL+V  +  V +LFG+PW+  T   S  H  AL  + +   SG      I +V+E R++GL+  +L+GLS+L+ PI    +P+AVL G+F+YM +T+L G QL +R++LLF     +P   +++RV   ++HLFT +Q+  L +L  +   P   A +  P +L+L +P+R  I P       +  LD
Sbjct:  399 GGLIRDIRRRYPYYLSDITDALS-----PQVLAAVIFIYFAALSPAVTFGGLLGEKTRNLMGVSELLISTAVQGILFALLGAQPLLVLGFSGPLLVFEEAFFSFCESNNLEYIVGRAWIGFWLILLVMLVVAFEGSFLVQYISRYTQEIFSFLISLIFIYETFSKLIKIF-QDY--PLQQTYAPVVMKPKPQGPVPNTALFSLV---------------LMAGTFLLAMTLRKFKNSTYFPGKLRRVIGDFGVPISILIMVLVDSFIKGTYTQKLSVPDGLKVSNSSARGWVIHPLGLYRLFPTWMMFASVLPALLVFILIFLESQITTLIVSKPERKMIKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKA--SGPGAAAQIQEVKEQRISGLLVSVLVGLSILMEPILSR-IPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPFVKRVKTWRMHLFTGIQIICLAVLWVVKSTP---ASLALPFVLILTVPLRRLILPLIFRELELQCLD 905          
BLAST of slc4a-4 vs. Ensembl Mouse
Match: Slc4a2 (solute carrier family 4 (anion exchanger), member 2 [Source:MGI Symbol;Acc:MGI:109351])

HSP 1 Score: 174.481 bits (441), Expect = 1.161e-43
Identity = 153/562 (27.22%), Postives = 269/562 (47.86%), Query Frame = 2
Query: 1367 PLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKT------VPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXI----GTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISA------VFAALGLAFPLS---------------LLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            P G G++ D+R+R P Y+SD++D +       + ++A  F+YFA L P++ FG L  + T   I V  +I+S  + G+ F L+G QPL+V+  + PL ++ +  ++  +   L +     W+G +     +L   L+ S L+R+ +R T+EIFA  IS+ FI +    ++K+F +  +                 N T A  +L   N   +  + + +        LL +    GT ++  +   F  + F     R ++ D+ +P+A+LIM  +      D  I       E+ ++ K    S  S++A      V   LG   P                 +L FM+  +T+ +++     L+KGS +H DLL++  +  + +LFGLPW+      S  H  AL  + + +  G +    I +V+E R    +   L+    +++   L  +P+AVL G+F+YM +T+L G Q  ER+ LL      +P   Y+++V   ++HLFT LQL  L LL A+       A + FP +L+L +P+R  +  +  +   +  LD
Sbjct:  668 PFG-GLIRDVRRRYPHYLSDFRDALDP-----QCLAAVIFIYFAALSPAITFGGLLGEKTKDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNELEYLVGRVWIGFWLVFLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLIKIFQEHPLHGCSGSNDSEAGSSSSSNMTWATTILVPDNSSASGQSGQEKPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLV------DYSI-------EDTYTQKLSVPSGFSVTAPDKRGWVINPLGEKTPFPVWMMVASLLPAVLVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALFGLPWLAAATVRSVTHANALTVMSKAVAPGDK--PKIQEVKEQR-VTGLLVALLVGLSMVIGDLLRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKVRTMRMHLFTALQLLCLALLWAVMST---AASLAFPFILILTVPLRMVVLTRIFTEREMKCLD 1204          
BLAST of slc4a-4 vs. Ensembl Mouse
Match: Slc4a2 (solute carrier family 4 (anion exchanger), member 2 [Source:MGI Symbol;Acc:MGI:109351])

HSP 1 Score: 174.096 bits (440), Expect = 1.163e-43
Identity = 153/562 (27.22%), Postives = 269/562 (47.86%), Query Frame = 2
Query: 1367 PLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKT------VPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXI----GTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISA------VFAALGLAFPLS---------------LLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            P G G++ D+R+R P Y+SD++D +       + ++A  F+YFA L P++ FG L  + T   I V  +I+S  + G+ F L+G QPL+V+  + PL ++ +  ++  +   L +     W+G +     +L   L+ S L+R+ +R T+EIFA  IS+ FI +    ++K+F +  +                 N T A  +L   N   +  + + +        LL +    GT ++  +   F  + F     R ++ D+ +P+A+LIM  +      D  I       E+ ++ K    S  S++A      V   LG   P                 +L FM+  +T+ +++     L+KGS +H DLL++  +  + +LFGLPW+      S  H  AL  + + +  G +    I +V+E R    +   L+    +++   L  +P+AVL G+F+YM +T+L G Q  ER+ LL      +P   Y+++V   ++HLFT LQL  L LL A+       A + FP +L+L +P+R  +  +  +   +  LD
Sbjct:  663 PFG-GLIRDVRRRYPHYLSDFRDALDP-----QCLAAVIFIYFAALSPAITFGGLLGEKTKDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNELEYLVGRVWIGFWLVFLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLIKIFQEHPLHGCSGSNDSEAGSSSSSNMTWATTILVPDNSSASGQSGQEKPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLV------DYSI-------EDTYTQKLSVPSGFSVTAPDKRGWVINPLGEKTPFPVWMMVASLLPAVLVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALFGLPWLAAATVRSVTHANALTVMSKAVAPGDK--PKIQEVKEQR-VTGLLVALLVGLSMVIGDLLRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKVRTMRMHLFTALQLLCLALLWAVMST---AASLAFPFILILTVPLRMVVLTRIFTEREMKCLD 1199          
BLAST of slc4a-4 vs. Ensembl Mouse
Match: Slc4a2 (solute carrier family 4 (anion exchanger), member 2 [Source:MGI Symbol;Acc:MGI:109351])

HSP 1 Score: 173.711 bits (439), Expect = 1.905e-43
Identity = 153/562 (27.22%), Postives = 269/562 (47.86%), Query Frame = 2
Query: 1367 PLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKT------VPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXI----GTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISA------VFAALGLAFPLS---------------LLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            P G G++ D+R+R P Y+SD++D +       + ++A  F+YFA L P++ FG L  + T   I V  +I+S  + G+ F L+G QPL+V+  + PL ++ +  ++  +   L +     W+G +     +L   L+ S L+R+ +R T+EIFA  IS+ FI +    ++K+F +  +                 N T A  +L   N   +  + + +        LL +    GT ++  +   F  + F     R ++ D+ +P+A+LIM  +      D  I       E+ ++ K    S  S++A      V   LG   P                 +L FM+  +T+ +++     L+KGS +H DLL++  +  + +LFGLPW+      S  H  AL  + + +  G +    I +V+E R    +   L+    +++   L  +P+AVL G+F+YM +T+L G Q  ER+ LL      +P   Y+++V   ++HLFT LQL  L LL A+       A + FP +L+L +P+R  +  +  +   +  LD
Sbjct:  677 PFG-GLIRDVRRRYPHYLSDFRDALDP-----QCLAAVIFIYFAALSPAITFGGLLGEKTKDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNELEYLVGRVWIGFWLVFLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLIKIFQEHPLHGCSGSNDSEAGSSSSSNMTWATTILVPDNSSASGQSGQEKPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLV------DYSI-------EDTYTQKLSVPSGFSVTAPDKRGWVINPLGEKTPFPVWMMVASLLPAVLVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALFGLPWLAAATVRSVTHANALTVMSKAVAPGDK--PKIQEVKEQR-VTGLLVALLVGLSMVIGDLLRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKVRTMRMHLFTALQLLCLALLWAVMST---AASLAFPFILILTVPLRMVVLTRIFTEREMKCLD 1213          
BLAST of slc4a-4 vs. UniProt/SwissProt
Match: sp|Q8NBS3|S4A11_HUMAN (Sodium bicarbonate transporter-like protein 11 OS=Homo sapiens OX=9606 GN=SLC4A11 PE=1 SV=2)

HSP 1 Score: 553.132 bits (1424), Expect = 1.533e-180
Identity = 345/806 (42.80%), Postives = 506/806 (62.78%), Query Frame = 2
Query:  644 TADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQ--------MDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAE-------EQRLYRRRSIRITEVMNQAFAYEEKF-PLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVN-----KTVPIVNTTLAKGLLNST------NEFITITTE-----ESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFK-TRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            T +E   G   L+    + + +K+F  E+RA  D++ FL +  ++L+  A  +D ++  +LR     A D    +        M    T+A   +  K H        L+ T++G+      G+   QSW+  +C++  + KRHV I+RL  P N G +S  V FV+LV+ P K K TK+ +E++RTFAT+ SD+ FR +LL  +TE+EFKE L  H R L           R   R ++ +    +      + F P G GI +D+ +R P+Y  D+ DGI G    + K ++   FLYFACLLP++AFG L D+NTDG I+V++ I  Q++GGL +AL  GQPL+++LTTAPL LYI+VI  I   Y L F + ++W G++NS FL LY+  +LS +M    RSTEEI ALFISI F++DAVK  +K+F+K Y    ++     +T  +V+ +     LN++        F+   TE      S +   +L LL+++GT+WLG     F K+P+L+   R +++D +LP+AVL  S I S+ F++I++  F+   SE  F++       +S+ AV  A+GL F LS+LFF++QN+ +A+VN P N+L KG+AYHWDLL++AIIN  LSLFGLPW+H   PHSPLHV+ALA +EER+++GH IY+TIV V+ETRLT L + +L+GLSLLLLP+PL ++P  VL GLF+Y+A+T+L GNQLV+RV LL  EQ AYPP+HY+RRVPQRK+H FT LQ+ QL LLCA G +  PY K+ FP++++  +PIR+ + P+ I   Y+D +D
Sbjct:   96 TENEATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRR---FARDPDNNEPNCNLDLLMAMLFTDAGAPMRGKVHL-------LSDTIQGVTATVT-GVRYQQSWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKLLETRTEEEFKEALV-HQRQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAM--AQIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYDTIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 886          
BLAST of slc4a-4 vs. UniProt/SwissProt
Match: sp|A2AJN7|S4A11_MOUSE (Sodium bicarbonate transporter-like protein 11 OS=Mus musculus OX=10090 GN=Slc4a11 PE=2 SV=1)

HSP 1 Score: 530.406 bits (1365), Expect = 3.758e-172
Identity = 345/792 (43.56%), Postives = 497/792 (62.75%), Query Frame = 2
Query:  674 CLVLARLEK-IPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDT--------FITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEML--QNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYV-----TTLVNKTVPI----------VNTTLAKGLLNSTNEFITITTE---ESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            C++L    K + +K+F  EVRA  D++ FL +  +IL+  A  +D ++  +L      A+D +  + D           T+A   +  K H  + + Q +  T++G+          +QSW+  +C++  + KRHV I+RL  P N G +S  V FV+LV+ P K K TK+ +E++RTFAT+ SD+ FR +LL  +TE+EFKE L  Q     +   +      S   T    Q    ++ FP G GI  D+ +R PVY  D+ DGI G   ++ K V+   FLYFACLLP++AFG L D+NT+G I+V++ I  Q++GGL +AL  GQPL+++LTTAPL +Y +VI  I   Y+L F   ++W G++NS FL LY+ L+LS LM    RSTEEI ALFISI F++DAVK ++K+F K Y      T   +  V +          ++T L   LL S  E  T ++     S +   +L LL+++GT+WLG     F K+P+L+   R  ++D +LP+AVL  S IGSY F++I++  F+    E    +      +S  A+ +A+GL F LSLLFF++QN+ +A+VN P N+L KG+AYHWDLL++AIIN  LSLFGLPW+H   PHSPLHV+ALA +EER+++GH IYETIV V+ETRLT L + +L+GLSLLLLP PL ++P  VL GLF+Y+A+T+L GNQL  RV LL  EQ +YPP+HY+RRVPQRK+H FT LQ+ QL LLCA G +  PY K+ FP++++  +PIR+ + P+ I   Y+D +D
Sbjct:   79 CVLLHTSRKYLKLKNFEEEVRAHRDLDGFLAQASIILNETATSLDDVLRTMLNR---FALDPNHAEPDCDLDLLMAKLFTDAGAPMESKVHLLSDTIQGVTATVRGV--------QYEQSWLCIICTMKTLQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDITFRQKLLKTRTEEEFKEALVHQRQLLTMMMPRAAGHSMSSLHTHRHPQPPKCKDFFPFGKGIWMDIMRRFPVYPMDFTDGIIGKSKSVGKYVTTTLFLYFACLLPTIAFGSLNDENTNGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLAIYTQVIRVICDDYNLDFNAFYAWTGLWNSFFLALYAFLNLSLLMNLFKRSTEEIIALFISITFVLDAVKGMVKIFGKYYYGHHYHTKRTSSLVSLLGIGRSPNSSLHTALNASLLASPVEMATTSSPGSTHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVRETLSDCALPIAVLSFSLIGSYGFQEIEMSKFRYNPSESL-FEVAQIHSLSFKAIGSAMGLGFLLSLLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYETIVDVKETRLTALGASVLVGLSLLLLPFPLQWIPKPVLYGLFLYIALTSLDGNQLFSRVALLLKEQTSYPPTHYIRRVPQRKIHYFTGLQILQLLLLCAFGMSSLPYMKMVFPLIMIAMIPIRYNLLPRIIEAKYLDVMD 857          
BLAST of slc4a-4 vs. UniProt/SwissProt
Match: sp|P15575|B3AT_CHICK (Band 3 anion transport protein OS=Gallus gallus OX=9031 GN=SLC4A1 PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 3.945e-51
Identity = 172/669 (25.71%), Postives = 313/669 (46.79%), Query Frame = 2
Query: 1106 VYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQN--------HARDLAEEQRLY----------RRR-----SIR-------ITEVMNQAFAYEEKFPL------GNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVF-----YKSYVTTL-VNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEE---------FSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            V FV+ V+ P   + +  +I   R  AT+++D  FR          E    LQ           +++  EQ L+          RRR     ++R         +  ++  A ++  PL        G+V D+R+R P Y+SD +D +       + ++A  F+YFA L P++ FG L  + T G + V  ++LS +V  L F+L+  QPL+V+  + PL ++ +  +     + L +     W+G +  + ++L    + + L+R+ +R T+EIF+  IS+ FI +    ++ +F      +SY T +    +VP  NT L   +L +                         GT +L ++   F  + FL    R L+ D+ +P+++ +M+ +  +  KD      K     E         F     + +   I  +FA+   A  + +L F++  +T+ +V+ P  KL KGS +H DLL++  +  + +LFG+PW+  T   +  H  AL  + +    G R +  IV+V+E R    +   ++    +L+   L Y+P+AVL G+F+YM +T+L+G QL +R++LL      +P   Y+ RV   ++    + Q+  + LL  +  +P   A +  P +L+L +P+R  + P+  S   +  LD
Sbjct:  269 VRFVLTVLGPDSPRLSYHEIR--RAAATVMADRVFRRDAYLCGGRAELLGGLQGFLEASIVLPPQEVPSEQHLHALIPLQRHAVRRRYQHPDTVRSPGGPTAPKDTGDKGQAPQDDDPLLRTRRPFGGLVRDIRRRYPKYLSDIRDALN-----PQCLAAVIFIYFAALSPAITFGGLLGEKTRGMMGVSELLLSTSVQCLLFSLLSAQPLLVVGFSGPLLVFEEAFFRFCEDHGLEYIVGRVWIGFWLILLVLLVVACEGTVLVRYLSRYTQEIFSFLISLIFIYETFAKLVTIFEAHPLQQSYDTDVSTEPSVPKPNTALLSLVLMA-------------------------GTFFLALFLRQFKNSVFLPGKVRRLIGDFGVPISIFVMA-LADFFIKDTYTQKLKVPRGLEVTNGTARGWFIHPMGSATPFPIWMMFASPVPALLVFILIFLETQITTLIVSKPERKLVKGSGFHLDLLLIVAMGGLAALFGMPWLSATTVRTITHANALTVVGKSAVPGERAH--IVEVKEQR-LSGLLVAVLIGVSILMEPILKYIPLAVLFGIFLYMGVTSLFGIQLFDRILLLLMPPKYHPKEPYVTRVKTWRITSSPLTQILVVALLWGVKVSP---ASLRCPFVLVLTVPLRRLLLPRIFSEIELKCLD 898          
BLAST of slc4a-4 vs. UniProt/SwissProt
Match: sp|P02730|B3AT_HUMAN (Band 3 anion transport protein OS=Homo sapiens OX=9606 GN=SLC4A1 PE=1 SV=3)

HSP 1 Score: 193.356 bits (490), Expect = 3.020e-49
Identity = 184/639 (28.79%), Postives = 314/639 (49.14%), Query Frame = 2
Query: 1166 ELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNH--------ARDLAEEQ----------RLYRRRSIRITEVMNQAF------------AYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFI-----GSYLFKDIKIDTFK--TRSEEEFSIKFVNF-SQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFP---KFISLTYIDALD 2959
            +L R  ATL+S+  FR     AQ+  E    L+            D   EQ           L RRR        + +F              ++   L  G+V D+R+R P Y+SD  D         ++++A  F+YFA L P++ FG L  + T  ++ V  +++S  V G+ FAL+G QPL+V+  + PL ++ +  ++      L +     W+G +  + ++L    + S L+R+ +R T+EIF+  IS+ FI +    ++K+F    +    N  V +V     +G L +T                LL L+L+ GT +  +    F  + +     R ++ D+ +P+++LIM  +      +Y  K    D FK    S   + I  +   S+  I  +FA+   A  + +L F++  +T+ +V+ P  K+ KGS +H DLL+V  +  V +LFG+PW+  T   S  H  AL  + +    G      I +V+E R++GL+  +L+GLS+L+ PI    +P+AVL G+F+YM +T+L G QL +R++LLF     +P   Y++RV   ++HLFT +Q+  L +L  +   P   A +  P +L+L +P+R  + P   + + L  +DA D
Sbjct:  280 QLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDAFS-----PQVLAAVIFIYFAALSPAITFGGLLGEKTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPLLVFEEAFFSFCETNGLEYIVGRVWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIFIYETFSKLIKIFQDHPLQKTYNYNVLMVPK--PQGPLPNT---------------ALLSLVLMAGTFFFAMMLRKFKNSSYFPGKLRRVIGDFGVPISILIMVLVDFFIQDTYTQKLSVPDGFKVSNSSARGWVIHPLGLRSEFPIWMMFASALPALLVFILIFLESQITTLIVSKPERKMVKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKASTPGAA--AQIQEVKEQRISGLLVAVLVGLSILMEPILSR-IPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHLFTGIQIICLAVLWVVKSTP---ASLALPFVLILTVPLRRVLLPLIFRNVELQCLDADD 890          
BLAST of slc4a-4 vs. UniProt/SwissProt
Match: sp|P04919|B3AT_MOUSE (Band 3 anion transport protein OS=Mus musculus OX=10090 GN=Slc4a1 PE=1 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 6.133e-48
Identity = 160/536 (29.85%), Postives = 284/536 (52.99%), Query Frame = 2
Query: 1376 NGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIM----SFI-GSYLFKDIKIDTFK--TRSEEEFSIKFVNFSQI-SISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
             G++ D+R+R P Y+SD  D +       ++++A  F+YFA L P++ FG L  + T   + V  +++S  V G+ FAL+G QPL+V+  + PL ++ +  ++     +L +    +W+G +  + ++L    + S L+++ +R T+EIF+  IS+ FI +    ++K+F + Y   L     P+V     +G + +T  F  +               L+ GT  L +    F  + +     R ++ D+ +P+++LIM    SFI G+Y  K    D  K    S   + I  +   ++     +FA++  A  + +L F++  +T+ +V+ P  K+ KGS +H DLL+V  +  V +LFG+PW+  T   S  H  AL  + +   SG      I +V+E R++GL+  +L+GLS+L+ PI    +P+AVL G+F+YM +T+L G QL +R++LLF     +P   +++RV   ++HLFT +Q+  L +L  +   P   A +  P +L+L +P+R  I P       +  LD
Sbjct:  399 GGLIRDIRRRYPYYLSDITDALS-----PQVLAAVIFIYFAALSPAVTFGGLLGEKTRNLMGVSELLISTAVQGILFALLGAQPLLVLGFSGPLLVFEEAFFSFCESNNLEYIVGRAWIGFWLILLVMLVVAFEGSFLVQYISRYTQEIFSFLISLIFIYETFSKLIKIF-QDY--PLQQTYAPVVMKPKPQGPVPNTALFSLV---------------LMAGTFLLAMTLRKFKNSTYFPGKLRRVIGDFGVPISILIMVLVDSFIKGTYTQKLSVPDGLKVSNSSARGWVIHPLGLYRLFPTWMMFASVLPALLVFILIFLESQITTLIVSKPERKMIKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKA--SGPGAAAQIQEVKEQRISGLLVSVLVGLSILMEPILSR-IPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPFVKRVKTWRMHLFTGIQIICLAVLWVVKSTP---ASLALPFVLILTVPLRRLILPLIFRELELQCLD 905          
BLAST of slc4a-4 vs. TrEMBL
Match: A0A0H3YEW7 (Slc4a-4 OS=Schmidtea mediterranea OX=79327 GN=slc4a-4 PE=2 SV=1)

HSP 1 Score: 1687.16 bits (4368), Expect = 0.000e+0
Identity = 891/891 (100.00%), Postives = 891/891 (100.00%), Query Frame = 2
Query:  296 MNNLMPTQNSLNRRNSRSVDHLNMINSYSSNDKSVPKLVLTNCNQSPAIDRTNRRTISGLYNFKKQSTNNDDKDSKDRNLLLSPTNYINRQISETSEMSTDTVSNFSIGSLARYYRTADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI 2968
            MNNLMPTQNSLNRRNSRSVDHLNMINSYSSNDKSVPKLVLTNCNQSPAIDRTNRRTISGLYNFKKQSTNNDDKDSKDRNLLLSPTNYINRQISETSEMSTDTVSNFSIGSLARYYRTADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNSIFLILYSLLDLSKLMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGLLFLLLLIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRLTGLISHILIGLSLLLLPIPLIYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHLFTVLQLTQLGLLCALGFAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI
Sbjct:    1 MNNLMPTQNSLNRRNSRSVDHLNMINSYSSNDKSVPKLVLTNCNQSPAIDRTNRRTISGLYNFKKQSTNNDDKDSKDRNLLLSPTNYINRQISETSEMSTDTVSNFSIGSLARYYRTADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNSIFLILYSLLDLSKLMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGLLFLLLLIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRLTGLISHILIGLSLLLLPIPLIYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHLFTVLQLTQLGLLCALGFAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI 891          
BLAST of slc4a-4 vs. TrEMBL
Match: A0A0H3YK00 (Slc4a-8 OS=Schmidtea mediterranea OX=79327 GN=slc4a-8 PE=2 SV=1)

HSP 1 Score: 867.07 bits (2239), Expect = 0.000e+0
Identity = 468/851 (54.99%), Postives = 638/851 (74.97%), Query Frame = 2
Query:  485 KKQSTNNDDKDSKDRNLLL---SPTNYINRQI--SETSEMSTDTVSNFSIGSLARYYRTADEN-GEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQ--MDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVN---------------KTVPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI 2968
            +++ T  D++ S   +L L   SP   ++RQ   S  S +S D +SN S  +LA   + ADE   + +PCL L+RLEKIP+KDFS+EVRATLD++KFLKE VL+LDM  + ++ I++ +L  I  LA +V+  +  ++  + EAK  LF+++ Y  ++YQRLAKT++G+ ++E EGL TDQSW+  MCSL C+HKRHVAIARL  PVN+GRSSEG+YF++LV+TP KEK TKSDIEL RTFAT+ +D+EFR QLLF+++ ++FKE+LQ H+ DL E+Q + RR+S+++ EVMNQAF +++K+ +G+GIV D +KR PVY+ D++DG +G GTIRK++SA  FLYFACLLPS+AFGVL   NT+GKI+V+RVI+SQ +GGLCF    GQPLI++LTTAPL L++K+I +I   Y L F+ M+S VG+ NS+ LILY++ D+SKLMRWSTRS+EEIFALF++I+F+VDAVKD+ K F   Y +  ++               +    + + ++  L  +       ++   ++E  +L+L L+ GTVWL I     TKTPFLN++KR ++ D++LPLAV+IMS IG+YLFK+I++  F    EE+   +     ++   A+  A+ LAFPLSLL FMDQN++SAMVN P+NKLKKGS+YHWDLL+VA+IN  LS+FGLP VHG LPHSPLHVKALADLEERID+ H +++TIVKVRETR+T ++SH+ IG+SL +LPIPLIY+P+AVLDGLFVYMA+T LYGNQ  ER++LLFTEQ+AYPPSHYLRRVPQRK+H+FT LQ+ QL  LC LGF+P+PY K+GFP+LLL  M  RH + P+ I   Y++ALDKPI
Sbjct:   68 EQEVTIKDNRTSISSHLFLLPPSPGRRLSRQRQGSSASNVSVDNMSNISGSTLAYCLQNADETEDDSVPCLFLSRLEKIPMKDFSAEVRATLDIQKFLKEAVLLLDMSGSCLEEIIDSMLLTI--LANEVTDAKVSLEALVEEAKKTLFIQSSYLTYTYQRLAKTIRGLSLSETEGLMTDQSWLCTMCSLNCIHKRHVAIARLNNPVNMGRSSEGIYFIILVVTPTKEKGTKSDIELGRTFATIFADVEFRQQLLFSESVEQFKELLQYHSGDLMEDQAMNRRKSLKVQEVMNQAFHFDKKYLVGSGIVSDFKKRFPVYLMDFRDGFRGKGTIRKVISATIFLYFACLLPSIAFGVLNYNNTEGKIDVRRVIISQAIGGLCFGFFSGQPLIILLTTAPLALFVKIISSICNDYDLDFFAMYSCVGLINSLLLILYAMFDISKLMRWSTRSSEEIFALFVAISFVVDAVKDIYKEFSTHYFSCYLSANNQSTEHLRLSRFKRAFSGIISNISISLTQTNLNSSLYSSNSCQREVSILYLFLVAGTVWLAIQLFTSTKTPFLNNAKREMLTDFALPLAVVIMSLIGTYLFKEIEMQPFVI-VEEKVKFEASGILKLPWLAIAGAIALAFPLSLLMFMDQNISSAMVNSPANKLKKGSSYHWDLLVVALINAGLSVFGLPLVHGALPHSPLHVKALADLEERIDTAHHVHQTIVKVRETRITSILSHVFIGISLQMLPIPLIYIPVAVLDGLFVYMAVTTLYGNQFFERILLLFTEQSAYPPSHYLRRVPQRKLHIFTGLQIFQLAGLCLLGFSPSPYLKMGFPLLLLFHMVFRHQVVPRVIDEKYLNALDKPI 915          
BLAST of slc4a-4 vs. TrEMBL
Match: A0A267H8X4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030243g1 PE=4 SV=1)

HSP 1 Score: 864.759 bits (2233), Expect = 0.000e+0
Identity = 463/841 (55.05%), Postives = 621/841 (73.84%), Query Frame = 2
Query:  596 DTVSNFSIGSLARYYRTADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIY-----------------------PLAM-------------------DVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTT--LVNKT-----VPIVNTTLAKGLLNSTNEFIT-ITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI 2968
            D +S  S GSLA YYR+ D   E LPCLV++RLEKIP+KDFSSE+RA LD+E+FLKE  L+LD+E +++++I++ +L+ I+                       P++                    D +   ++  + +AK  LF++A + ++SYQRLAKT+K I + ++EGL TD SW+  MCSL+ V+KRHVAIARL +PVNLGRSSEGV+F++LV+TP KEK TKSDIE+ RTFAT+L+D +FR +L+ A++EDEFK M+Q+HA+DL EEQR+YRR+S+R  + M QAF+YE  + L NGI  D+++R+  Y SD+ DG +GP T+ K++S   FLYFACLLP +AFGVL  + TDGKI+V+RV+LSQ +GG+ FALIGGQPLIVMLTTAPL LY ++IY +S  + L F+ +F WVG+FN++ L+LY+ +D++KLMRWSTRSTEEIFALFISIAF+V+A K V  VF ++Y     + N T       + + TL   L++S+N     +     R++  +LFL+L  GTV+L +Y LNFTKTP+LN +KR LMAD+SLP+AVL+MSF GSYLF D+ +  F+ +S     ++F   + +  +A+  A  LA PLS+LFFMDQN++SAMVNCP+NKLKKGSAYH DLL+VA+IN  LS  GLPW+HG LPHSPLHVKALADLEERID G  + +T+V+VRETR+TG++++ L+GLSLL+ P PL Y+P+ VL+GLFV MAIT++ GNQL ER++LLFTEQAAYPPSH+LRRVPQRKVH+FT+LQL QL  LCA+GF+   YAK+ FP+LL LQMPIRH + PK I   Y+DALDKP+
Sbjct:  145 DNLSLISGGSLAMYYRSPDGVDETLPCLVVSRLEKIPLKDFSSEIRANLDIERFLKEATLLLDLEGDNIESIIDRMLQSIFKADIEAHGSNHHHHHHHNQHHQHPVSAAAQADQAATSTGAAAADGGDPNDAALEAKVQDAKKTLFLQASWMDYSYQRLAKTIKSISVIDSEGLITDNSWLCTMCSLSGVNKRHVAIARLSSPVNLGRSSEGVHFILLVVTPTKEKGTKSDIEIGRTFATILADADFRQRLMLAESEDEFKSMMQSHAQDLGEEQRIYRRKSLRTKDFMTQAFSYENSWLLCNGIKADIKRRLRHYPSDFVDGFRGPKTLTKVLSTVIFLYFACLLPCIAFGVLNHKQTDGKISVERVVLSQGIGGVVFALIGGQPLIVMLTTAPLALYTRIIYEVSEAHGLDFFALFGWVGVFNALLLLLYATVDMAKLMRWSTRSTEEIFALFISIAFMVEAYKSVYYVFRENYSCAKPIANATDAASIANLSDATLIAPLIDSSNASTPDLAAPSCRRDISILFLMLCAGTVFLAMYLLNFTKTPYLNRAKRELMADFSLPVAVLVMSFCGSYLFSDVGLQKFECKS--IIRLQFTIATPLPAAAILGAFVLALPLSMLFFMDQNISSAMVNCPTNKLKKGSAYHLDLLVVALINGCLSCVGLPWIHGALPHSPLHVKALADLEERIDLGQHVQQTVVRVRETRITGILANCLVGLSLLMCPSPLSYIPVPVLNGLFVCMAITSVMGNQLFERILLLFTEQAAYPPSHFLRRVPQRKVHIFTLLQLLQLAALCAVGFSGIAYAKMVFPVLLGLQMPIRHLLIPKLIDENYLDALDKPM 983          
BLAST of slc4a-4 vs. TrEMBL
Match: A0A267G7Q1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031769g2 PE=4 SV=1)

HSP 1 Score: 851.277 bits (2198), Expect = 0.000e+0
Identity = 465/835 (55.69%), Postives = 614/835 (73.53%), Query Frame = 2
Query:  572 SETSEMSTDTVSNFSIGSLARYYRTADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSI----------------------GQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-------------VTTLVNKTVPIVNTTL-AKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI 2968
            S  + +  D +S  S GSLA +YR AD   E LPCLV++RLEKIP+KDFSSE+RA +D+++FLKE  L+LD+E  +V+ I+E +LR I+    +                          ++D  + +AK  LF++A++ +++YQRLAKT+K I + ++EGL TD SW+  MCSL  V KRHVAIARL TPVNLGRSSEGV F++LV+TP KEK TKSDIEL RTFAT+L+D EFR +LL A+TE EFKEMLQ HA +L EEQ++YRR+S+R  + M+QAF YE  +P+ NGI  DL++R+  Y+SD+ D  +   TIRK+V+   FLYFACL+P +AFGVL +  T+G I V RVILSQ +GG+ FAL GGQPLI+MLTTAPL LY ++I+ +S  + L F+  F WVG+FN+  L+LY++LDLSKLMRWSTRSTEEIFA+FIS+AF V AVK V   F   Y             +T+  +K  P  N TL ++  LN ++  +    +  +++  +LFLLL IGTV+L +Y LNFTKTP+LN +KR LMAD+SLP++VL MSF+G+YLF++++++ F         ++FV    +   A+  A GLA PLS+LFFM+QN++SAMVNCP+NKL+KGSAYH DLL VA++N V+S FGLPWVHG LPHSPLHVKALADLEERID G  +++++V+VRETR+TG++S++LIGLSLL+ P+PL ++P+ VLDGLFV MAITAL+ NQL ER++LLFTEQAAYPPSHYLRRVPQRKVH+FT LQL QL +LCALGF    YAK+GFP++L LQMP+RH + PK I   Y+DALDKP+
Sbjct:   98 SSAASVDRDNLSIMSGGSLAMFYRNADGTDESLPCLVVSRLEKIPLKDFSSEIRANMDIQRFLKEATLLLDVEGANVECIIEQMLRSIFRADHESHHSSGSGGGGGDGGSVAGAAGAIDSRLDAKVQDAKKTLFLQANWMDYTYQRLAKTIKSISVVDSEGLITDNSWLCTMCSLNGVQKRHVAIARLSTPVNLGRSSEGVSFILLVVTPTKEKGTKSDIELGRTFATILADSEFRQKLLLAETESEFKEMLQGHAHELGEEQKIYRRKSLRTKDFMSQAFNYESSWPICNGIRADLKRRLSHYLSDFIDAFRDNKTIRKVVTTVIFLYFACLMPCIAFGVLNNSLTNGYITVHRVILSQCIGGVTFALFGGQPLIIMLTTAPLALYTRIIFELSQNHGLDFFAFFGWVGVFNAALLLLYAVLDLSKLMRWSTRSTEEIFAMFISVAFTVGAVKSVYGNFDTYYCDGNGGAETNGGNLTSGSDKWGP--NLTLDSQSALNGSSS-VGQKQQNCQRDVSILFLLLCIGTVFLSMYLLNFTKTPYLNRAKRELMADFSLPVSVLAMSFVGTYLFRNVQLEKFSCL--PYIQLEFVIARPLPGLAILGAFGLAIPLSMLFFMEQNISSAMVNCPANKLRKGSAYHLDLLTVALMNGVMSCFGLPWVHGALPHSPLHVKALADLEERIDLGQHVHQSVVRVRETRITGVVSNVLIGLSLLMCPVPLSFIPVPVLDGLFVCMAITALFDNQLFERILLLFTEQAAYPPSHYLRRVPQRKVHIFTCLQLLQLFVLCALGFNSIAYAKLGFPVILFLQMPVRHLLIPKLIDENYLDALDKPM 927          
BLAST of slc4a-4 vs. TrEMBL
Match: A0A267H2A6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031769g1 PE=4 SV=1)

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 465/834 (55.76%), Postives = 607/834 (72.78%), Query Frame = 2
Query:  572 SETSEMSTDTVSNFSIGSLARYYRTADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSI----------------------GQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKG--------LLNSTNEFITITTEESRKEN-----GXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI 2968
            S  + +  D +S  S GSLA +YR AD   E LPCLV++RLEKIP+KDFSSE+RA +D+++FLKE  L+LD+E  +V+ I+E +LR I+    +                          ++D  + +AK  LF++A++ +++YQRLAKT+K I + ++EGL TD SW+  MCSL  V KRHVAIARL TPVNLGRSSEGV F++LV+TP KEK TKSDIEL RTFAT+L+D EFR +LL A+TE EFKEMLQ HA +L EEQ++YRR+S+R  + M+QAF+YE  +P+ NGI  DL++R+  Y+SD+ D  +   TIRK+V+   FLYFACL+P +AFGVL +  T+G I V RVILSQ +GG+ FAL GGQPLIVMLTTAPL LY  +I+ +S  + L F+  F WVG+FN+  L+LY++LDLSKLMRWSTRSTEEIFA+FIS+AF V AVK V   F   Y     N         L  G         L+S +     ++   +++N      +LFLLL IGTV+L +Y LNFTKTP+LN +KR LMAD+SLP++VL MSF+G+YLF++++++ F         ++FV    +   A+  A GLA PLS+LFFM+QN++SAMVNCP+NKL+KGSAYH DLL VA++N V+S FGLPWVHG LPHSPLHVKALADLEERID G  +++++V+VRETR+TG++S+ILIGLSLL+ P+PL ++P+ VLDGLFV MAITAL+ NQL ER++LLFTEQAAYPPSHYLRRVPQRKVH+FT LQL QL +LCALGF    YAK+GFP++L LQMP+RH + PK I   Y+DALDKP+
Sbjct:   98 SSAASVDRDNLSIMSGGSLAMFYRNADGTDESLPCLVVSRLEKIPLKDFSSEIRANMDIQRFLKEATLLLDVEGANVECIIEQMLRSIFRADHESHHSSGSGGGGGDGGSVAGAAGAIDSRLDAKVQDAKKTLFLQANWMDYTYQRLAKTIKSISVVDSEGLITDNSWLCTMCSLNGVQKRHVAIARLSTPVNLGRSSEGVSFILLVVTPTKEKGTKSDIELGRTFATILADSEFRQKLLLAETESEFKEMLQGHAHELGEEQKIYRRKSLRTKDFMSQAFSYESSWPICNGIRADLKRRLSHYLSDFIDAFRDNKTIRKVVTTVIFLYFACLMPCIAFGVLNNSLTNGYITVHRVILSQCIGGVTFALFGGQPLIVMLTTAPLALYTHIIFELSQNHGLDFFAFFGWVGVFNAALLLLYAVLDLSKLMRWSTRSTEEIFAMFISVAFTVGAVKSVYGNFDTYYCDG--NGGAETNGGNLTSGSDKWGRNLTLDSQSALNGSSSVGQKQQNCQRDVSILFLLLCIGTVFLSMYLLNFTKTPYLNRAKRELMADFSLPVSVLAMSFVGTYLFRNVQLENFSCL--PYIQLEFVIARPLPGLAILGAFGLAIPLSMLFFMEQNISSAMVNCPANKLRKGSAYHLDLLTVALMNGVMSCFGLPWVHGALPHSPLHVKALADLEERIDLGQHVHQSVVRVRETRITGVVSNILIGLSLLMCPVPLSFIPVPVLDGLFVCMAITALFDNQLFERILLLFTEQAAYPPSHYLRRVPQRKVHIFTCLQLLQLFVLCALGFNSIAYAKLGFPVILFLQMPVRHLLIPKLIDENYLDALDKPM 927          
BLAST of slc4a-4 vs. Ensembl Cavefish
Match: ENSAMXT00000011908.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000151.1:229098:263825:-1 gene:ENSAMXG00000011585.2 transcript:ENSAMXT00000011908.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 497.278 bits (1279), Expect = 2.703e-161
Identity = 314/764 (41.10%), Postives = 487/764 (63.74%), Query Frame = 2
Query:  707 IKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIR--ITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-VTTLVNKTVPIVN---------TTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            + +F  EVRA  D+  FL +  ++LD  A  +D ++  +L+ +   A D   GQ      E  +ALF  A  +  S   L +T++ +      G+   QSW+  +C++  + +R V I RL+ P N G +   V FV+L++ P + K TK+ IEL RTFATL SD+ FR +LL  +T+D+FK+ L +  + L+  +    + SI       +N+    +E    G GI +DL +R+P Y+SD+ DG+ G   ++ K  + A FLY A LLP++AFG L D++T G+I+V++ I+ Q++GG+ ++L+ G P+++ +TTAPL ++I VI  I   Y L F   ++ +G++NS+FLIL  L ++S  M+   RSTEE+ ALFISIAF+ DAVK  +K+F+K Y   TLVN +   ++          + +     S +  +T+ T    +E  +L LLL++GT+WLG       ++PFL++  R +++D +LP++V+I SF+GSYLF DI++  F   +   F+I  ++   +S   V +A GL F L+LL F+DQN+  ++ N P N+L KG+AYHWDL++   IN+++S+ GLPW+H   PHS LHV+ LA +E+R++ GH +YETIV V+ETRLT L +++LIGLS+ LLP+PL ++P  VL GLF+Y+A+T++ GNQ+ +R+ LL  EQ +YPP+HY+RRVPQRKVH FT LQL QL +LCA G  P PY K+ FP+L++  +P+R+ + PK I   Y+D +D
Sbjct:   42 LMNFQEEVRAHRDLNSFLAQASILLDETAASLDEVLRRMLQHV---ARD---GQGSCDQREVISALFTDAGGQEASVHLLTETIQAVTATAT-GVRYQQSWLCVLCNVKSLQRRCVCITRLERPQNWGVNCCEVRFVILILAPPRTKSTKTAIELGRTFATLFSDISFRQKLLETKTQDDFKQELVHQMQLLSSAEH---KASIEEETGPHINKPLKVKEFLQAGRGIYEDLSRRLPYYVSDFTDGMYGSNRSLLKYTTTAIFLYIAILLPAIAFGSLNDESTRGEIDVQKTIVGQSIGGVIYSLLAGSPMVIPITTAPLAIFISVIRGICDDYDLDFPAFYACIGLWNSLFLILGGLFNISLFMKLFKRSTEEVIALFISIAFVGDAVKGTIKIFHKYYHGPTLVNSSAVEIHHLADMIQHPDSSSSSTAPSLSAVLTLCT----RERPILCLLLMLGTLWLGYVLFLIKRSPFLHAKVREVVSDCALPISVVIFSFVGSYLFIDIELPVFNYYNGSIFNIAPLDM--LSGMNVLSACGLGFLLALLIFIDQNIVISLTNAPENRLLKGTAYHWDLMLSGFINILMSVLGLPWMHAAFPHSTLHVRQLAKVEQRVEQGH-LYETIVSVKETRLTSLAANVLIGLSVFLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRIALLLKEQTSYPPTHYIRRVPQRKVHYFTGLQLIQLIILCAFGMYPLPYMKMIFPLLMIFLIPVRNSMLPKIIEAKYLDIID 788          
BLAST of slc4a-4 vs. Ensembl Cavefish
Match: ENSAMXT00000047690.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000151.1:229977:263825:-1 gene:ENSAMXG00000011585.2 transcript:ENSAMXT00000047690.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 485.337 bits (1248), Expect = 8.589e-157
Identity = 308/748 (41.18%), Postives = 478/748 (63.90%), Query Frame = 2
Query:  707 IKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIR--ITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-VTTLVNKTVPIVN---------TTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRH 2911
            + +F  EVRA  D+  FL +  ++LD  A  +D ++  +L+ +   A D   GQ      E  +ALF  A  +  S   L +T++ +      G+   QSW+  +C++  + +R V I RL+ P N G +   V FV+L++ P + K TK+ IEL RTFATL SD+ FR +LL  +T+D+FK+ L +  + L+  +    + SI       +N+    +E    G GI +DL +R+P Y+SD+ DG+ G   ++ K  + A FLY A LLP++AFG L D++T G+I+V++ I+ Q++GG+ ++L+ G P+++ +TTAPL ++I VI  I   Y L F   ++ +G++NS+FLIL  L ++S  M+   RSTEE+ ALFISIAF+ DAVK  +K+F+K Y   TLVN +   ++          + +     S +  +T+ T    +E  +L LLL++GT+WLG       ++PFL++  R +++D +LP++V+I SF+GSYLF DI++  F   +   F+I  ++   +S   V +A GL F L+LL F+DQN+  ++ N P N+L KG+AYHWDL++   IN+++S+ GLPW+H   PHS LHV+ LA +E+R++ GH +YETIV V+ETRLT L +++LIGLS+ LLP+PL ++P  VL GLF+Y+A+T++ GNQ+ +R+ LL  EQ +YPP+HY+RRVPQRKVH FT LQL QL +LCA G  P PY K+ FP+L++  +P+R+
Sbjct:   42 LMNFQEEVRAHRDLNSFLAQASILLDETAASLDEVLRRMLQHV---ARD---GQGSCDQREVISALFTDAGGQEASVHLLTETIQAVTATAT-GVRYQQSWLCVLCNVKSLQRRCVCITRLERPQNWGVNCCEVRFVILILAPPRTKSTKTAIELGRTFATLFSDISFRQKLLETKTQDDFKQELVHQMQLLSSAEH---KASIEEETGPHINKPLKVKEFLQAGRGIYEDLSRRLPYYVSDFTDGMYGSNRSLLKYTTTAIFLYIAILLPAIAFGSLNDESTRGEIDVQKTIVGQSIGGVIYSLLAGSPMVIPITTAPLAIFISVIRGICDDYDLDFPAFYACIGLWNSLFLILGGLFNISLFMKLFKRSTEEVIALFISIAFVGDAVKGTIKIFHKYYHGPTLVNSSAVEIHHLADMIQHPDSSSSSTAPSLSAVLTLCT----RERPILCLLLMLGTLWLGYVLFLIKRSPFLHAKVREVVSDCALPISVVIFSFVGSYLFIDIELPVFNYYNGSIFNIAPLDM--LSGMNVLSACGLGFLLALLIFIDQNIVISLTNAPENRLLKGTAYHWDLMLSGFINILMSVLGLPWMHAAFPHSTLHVRQLAKVEQRVEQGH-LYETIVSVKETRLTSLAANVLIGLSVFLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRIALLLKEQTSYPPTHYIRRVPQRKVHYFTGLQLIQLIILCAFGMYPLPYMKMIFPLLMIFLIPVRY 772          
BLAST of slc4a-4 vs. Ensembl Cavefish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 471.085 bits (1211), Expect = 2.846e-151
Identity = 300/768 (39.06%), Postives = 482/768 (62.76%), Query Frame = 2
Query:  701 IPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVM-NQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGK-------INVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXM-RWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-VTTLVNKTVPIVNTTLAKGLLNSTNE----FITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            + + +F  E+RA  D++ FL+   ++L  +   +D +++ +LR I   + D    +      E  ++LF  A  +  +   L++TL+ +      G+   QSW+  +C++  + +RHV I+RL  P N G +   V +V+L++ P K K TK+ +EL RTFA++ SD+ FR +LL ++T++EFKE L      L   +R         T+   ++     + F +G GI +DL +R+P Y SD+ DGI G    + K ++ + FLY A LLP++AFG L D++T G+        +V++ I+ Q++GG+ ++L  G PL++ LTTAP+ ++I VI  I   Y L F   ++ +G++NS+FLI+  + +LS L+ +   RS EE+ ALFISIAF+ DA+K  +K+F+K Y   TL N ++  +N       +N T E    FI  T     +   LL LLL++GT+W+G     F ++PFL++  R +++D +LP++VLI S++GSY+F DI +  F       F +      +++ ++V +A+GL F L+LL F+DQN+  ++ N P N+L KG+AYHWDL +  +IN+++S+ GLPW+H   PHS LHV+ LA +EER++ GH +YETIV V+ETR+T L+++ILIG+S+ LLP+PL ++P  VL GLF+Y+A+T++ GNQ+ +R+ LL  EQ +YPP+HY+R+VPQRK+H FT LQ+ QL  LC  G  P PY K+ FP+L+ + +PIR+ + P+ I   Y+D +D
Sbjct:   27 VKLMNFEEEIRAHRDLDGFLERASILLHEDEASLDDVLKTMLRHI---SQDPHTAEPGCNFEEIMSSLFTDAGSQEVNVHLLSETLQCVTATAT-GIQYQQSWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPLKMKSTKTAMELGRTFASMFSDISFRQKLLESKTQEEFKEALVIQRYHLTATKRKTTTVEEEETDPHSHKPLKCRDFFRVGRGIYEDLCRRLPFYPSDFTDGIVGNNKALVKYMTTSIFLYIAVLLPAIAFGSLNDESTRGENSICVSVSDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIIGGVFNLSLLLVKLFKRSIEEVIALFISIAFVADAMKGTVKIFHKYYHAPTLANGSIEELNRISRD--MNLTGELPESFILCT-----RARPLLCLLLMLGTLWVGYTLYQFKRSPFLHAKMREILSDCALPISVLIFSYVGSYVFNDIGLPVFDFHKGPVFRV--APLEKLTGASVLSAMGLGFLLALLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERVEGGH-LYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCTFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIDAKYLDIMD 780          
BLAST of slc4a-4 vs. Ensembl Cavefish
Match: slc4a2b (anion exchange protein 2-like [Source:NCBI gene;Acc:103041005])

HSP 1 Score: 205.297 bits (521), Expect = 1.583e-53
Identity = 196/697 (28.12%), Postives = 343/697 (49.21%), Query Frame = 2
Query: 1052 VAIARLKTPVNLGRSSE---GVYFVMLVITPKKEKDTKSDI-ELSRTFATLLSDMEFRSQLLFAQTEDEFKEML--------------------QNHARDLAEEQR--LYRRRSIRITEVMNQAFAYEEKFPLGN---------------GIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYV--TTLVNKTV-------PIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIK-------FVN----FSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            +A  RL+  V L    E    V F+ +++ P     T  D  ++ R+ +TL+SD  F      A   DE +++L                    +   R +A  QR  L +R    ++ +  +  + EEK  L +               G++ D+R+R P Y+SD+KD +       + ++A  F+YFA L P++ FG L  + T+G I V  +I++  + G+ F L+G QPL+V+  + PL ++ +  Y+      L + T   W+G +  I +++    + S L+R+ +R T+EIF+  IS+ FI +    + K+F +  +   + VN +V       P+ N T +    NS++  +     +      LL L+L+ GT ++  Y   F  + F     R ++ D+ +P+A+LIM  +  Y  ++         S   FS+         VN      Q  +  + A++  A  + +L FM+  +T+ +V+     L KGS +H DLL++  +  + +LFGLPW+      S  HV AL  + + +  G +    I +V+E R+TGL+  IL+GLS+++  +    +PIAVL G+F+YM + +L G QL ER+ LL      +P   Y+R+V   ++HLFT LQ+  L  L A+    +  A + FP +L+L +P++ ++ P+  S   +  LD
Sbjct:  485 MAFVRLQEAVELDSVLEVPVPVRFLFVLLGPP---STNMDYHQIGRSISTLMSDKSFHEAAYLA---DERQDLLNAINSFLDCSIVLPPSEMGGEELLRSVAHFQREMLRKREEQEVSLLAKEPKSLEEKGQLADCPEDDPLQRTGRPFGGMIRDIRRRYPKYLSDFKDALNP-----QCMAAVIFIYFAALSPAITFGGLLGEKTEGLIGVSELIVATCIQGVVFCLLGAQPLLVVGFSGPLLVFEEAFYSFCKSNGLEYLTGRVWIGFWLIIIVVVMVAFEGSFLVRFVSRFTQEIFSFLISLIFIYETFSKLAKIFQQHPLQRCSFVNVSVLNESEISPMENFTWSSEATNSSSTIVI----KGEPNTALLSLVLMSGTFFIAFYLRKFKNSAFFPGRLRRVIGDFGVPIAILIMVLV-DYSIQETYTQKLSVPS--GFSVTSPDKRGWIVNPLGSEVQFPVWMMAASVLPALLVFILIFMETQITTLIVSKKERMLIKGSGFHLDLLVIVAMGGICALFGLPWMAAATVRSVTHVNALTVMSKAVAPGDK--PRIQEVKEQRVTGLLVAILVGLSIVIGDLLRQ-IPIAVLFGIFLYMGVMSLNGIQLTERMQLLLMPPKYHPDHTYVRKVRTLRMHLFTALQVVCLAALWAVM---STSASLAFPFVLILTVPLKMFLLPRIFSTREMQCLD 1157          
BLAST of slc4a-4 vs. Ensembl Cavefish
Match: slc4a2b (anion exchange protein 2-like [Source:NCBI gene;Acc:103041005])

HSP 1 Score: 201.83 bits (512), Expect = 1.944e-52
Identity = 197/700 (28.14%), Postives = 343/700 (49.00%), Query Frame = 2
Query: 1052 VAIARLKTPVNLGRSSE---GVYFVMLVITPKKEKDTKSDI-ELSRTFATLLSDMEFRSQLLFAQTEDEFKEML--------------------QNHARDLAEEQR--LYRRRSIRITEVMNQAFAYEEK------------------FPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYV--TTLVNKTV-------PIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIK-------FVN----FSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            +A  RL+  V L    E    V F+ +++ P     T  D  ++ R+ +TL+SD  F      A   DE +++L                    +   R +A  QR  L +R    ++ +  +  + EEK                   P G G++ D+R+R P Y+SD+KD +       + ++A  F+YFA L P++ FG L  + T+G I V  +I++  + G+ F L+G QPL+V+  + PL ++ +  Y+      L + T   W+G +  I +++    + S L+R+ +R T+EIF+  IS+ FI +    + K+F +  +   + VN +V       P+ N T +    NS++  +     +      LL L+L+ GT ++  Y   F  + F     R ++ D+ +P+A+LIM  +  Y  ++         S   FS+         VN      Q  +  + A++  A  + +L FM+  +T+ +V+     L KGS +H DLL++  +  + +LFGLPW+      S  HV AL  + + +  G +    I +V+E R+TGL+  IL+GLS+++  +    +PIAVL G+F+YM + +L G QL ER+ LL      +P   Y+R+V   ++HLFT LQ+  L  L A+    +  A + FP +L+L +P++ ++ P+  S   +  LD
Sbjct:  491 MAFVRLQEAVELDSVLEVPVPVRFLFVLLGPP---STNMDYHQIGRSISTLMSDKSFHEAAYLA---DERQDLLNAINSFLDCSIVLPPSEMGGEELLRSVAHFQREMLRKREEQEVSLLAKEPKSLEEKEALLTPFKPEDDPLQRTGRPFG-GMIRDIRRRYPKYLSDFKDALNP-----QCMAAVIFIYFAALSPAITFGGLLGEKTEGLIGVSELIVATCIQGVVFCLLGAQPLLVVGFSGPLLVFEEAFYSFCKSNGLEYLTGRVWIGFWLIIIVVVMVAFEGSFLVRFVSRFTQEIFSFLISLIFIYETFSKLAKIFQQHPLQRCSFVNVSVLNESEISPMENFTWSSEATNSSSTIVI----KGEPNTALLSLVLMSGTFFIAFYLRKFKNSAFFPGRLRRVIGDFGVPIAILIMVLV-DYSIQETYTQKLSVPS--GFSVTSPDKRGWIVNPLGSEVQFPVWMMAASVLPALLVFILIFMETQITTLIVSKKERMLIKGSGFHLDLLVIVAMGGICALFGLPWMAAATVRSVTHVNALTVMSKAVAPGDK--PRIQEVKEQRVTGLLVAILVGLSIVIGDLLRQ-IPIAVLFGIFLYMGVMSLNGIQLTERMQLLLMPPKYHPDHTYVRKVRTLRMHLFTALQVVCLAALWAVM---STSASLAFPFVLILTVPLKMFLLPRIFSTREMQCLD 1165          
BLAST of slc4a-4 vs. Ensembl Sea Lamprey
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 538.11 bits (1385), Expect = 3.132e-178
Identity = 324/765 (42.35%), Postives = 485/765 (63.40%), Query Frame = 2
Query:  695 EKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLA---EEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIK--IDTFK---TRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRX-XXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDK 2962
            + + IK+FS EVRA  DV++FL +  ++LD+ +  +++ + H+L  +  L  +      +   +  K     K H        L++T++ + +N + GL   QSW+  +C+ T +  R V IARL+   N G +   V FV+LV+ P K K TK+  E+ RTFAT+  D+ FR QL+ A++ +EFK  L     DL    EEQ    + S+ I     Q F     +PL  GI +D+R+R+P Y SD+ DGI     I K + A  FLYFACLLPS+AFG L D NT G I+V++ +++Q++GG+ FA++ GQPLIV+LTTAPL LYI  I  I  ++ L F+  ++ +G++NS FL LY+LL +S  +  S RS EEIFALFISIAF+VDA+KD++K+F ++Y+           N T   G   +    +     +  ++  LL LLL++GTVWLG     F K P+L+   R +++D ++PL+V+  SF+GSY+F+DI   +   K   T SE  F++  +N   +++ ++ +A+G+ F LS+LFFM+  + +++ N P N+LKKG++YHWDLL+VA++N   SLFGLPW+H   PHSPLHV+ALA +EER++ GH + ET     +TR+   L   +L      LLP+PL ++P  VLDG+F+Y+A+T+L GNQL +R+ LLFTEQ AYPP+HY+RRVPQRK+H FT LQL QL +LC +GF+P PY K+ FP+++L  +P+R +  PK I   Y+D +D+
Sbjct:    1 QSVKIKNFSEEVRAGRDVDRFLSQAAVLLDLPSRSLESTLCHMLESV--LEDNPCAEPREARCSLLKTDCINKVHL-------LSETIQAVTVNPS-GLHYQQSWLCVLCTETTLQHREVCIARLERAQNWGENCCEVRFVILVLAPPKSKSTKTATEVGRTFATIFVDIGFRQQLIEARSPEEFKHALLLRRHDLTAQHEEQEDSSKSSVSIQHPHEQVFG-AVVWPL-MGIWEDIRRRLPYYSSDFTDGILRNRCIGKYIIAMIFLYFACLLPSIAFGSLNDINTRGAIDVQKTLVAQSMGGVLFAVLSGQPLIVLLTTAPLALYIYAIRTICDEFELDFHAYYACIGLWNSFFLTLYALLHMSTRLHLSKRSIEEIFALFISIAFVVDAIKDIIKIFKQNYLPGEPGGCGSAGNNTSDDGWEGAAG--VDSGGPKGSRDVALLALLLMLGTVWLGSTLYQFRKRPYLHLQAREILSDCAMPLSVIAFSFLGSYVFRDIDRMVTGLKFSYTPSESYFALAPLNL--LTVGSICSAMGIGFLLSILFFMEHTMAASLTNAPHNRLKKGTSYHWDLLLVAVLNATFSLFGLPWMHAAFPHSPLHVRALATVEERVEDGH-VDETQGNSLKTRVPVLLAHMLLGLSLFFLLPLPLQWIPRPVLDGIFLYIALTSLDGNQLFQRLALLFTEQTAYPPTHYVRRVPQRKIHYFTGLQLLQLAVLCGVGFSPIPYMKMVFPVIMLAALPVRFFAVPKIIESRYLDVMDE 748          
BLAST of slc4a-4 vs. Ensembl Sea Lamprey
Match: SLC4A2 (solute carrier family 4 member 2 [Source:HGNC Symbol;Acc:HGNC:11028])

HSP 1 Score: 183.726 bits (465), Expect = 1.312e-47
Identity = 177/652 (27.15%), Postives = 315/652 (48.31%), Query Frame = 2
Query: 1166 ELSRTFATLLSDMEF---------RSQLLFAQTE---------------DEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFP------------------LGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIV-NTTLAKGLLNST--NEFITITTEESRKENGXXXXXXXI-GTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFI-----GSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLF---FMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            E+ R+ +TL+SD +F         R  LL A TE               D     +    RD+ +++R     S ++  V   A   +   P                  L  G+V D R+R P Y+SD +D +       + ++A  F+YFA L P++ FG L  + T G + V  +I+S  + G+ FAL+G QPL+++  + PL ++ +  ++  +   + + T   W+G +  + ++L    + S ++R+ +R T+EIF++ IS+ FI +    + KVF    + +    T P++ N T      NS+  N     T +   + N  L  LLL+ GT ++  +   F  + FL    R ++ D+ +P+A+L+M  +      +Y  K    D F   S  +               V+       P  L+F   FM+  +T+ +V+     L KGS +H DLL++ ++  + ++FGLPW+      S  HV AL  + +    G +    I  V+E R+TGL+  I++GLS++L  +    +P+AVL G+F+YM +T+L G Q  +R++L+F     +P + Y  +V   +++L+T +Q   LG L A+    +  A + FP +L+L +P+R ++  +  +   +  LD
Sbjct:  356 EIGRSISTLMSDKDFHEAAYVADERQDLLNAMTEFLDVSIVLPPSELTDDGLLRSVAAFQRDMLQKRR-QEDESKKLNIVPTSAELKQTAVPSQRKEDDDPDDPLRRSGRLFGGLVRDARRRYPHYLSDLRDALNP-----QCLAAVIFIYFAALSPAITFGGLLSEKTQGLMGVSELIISTCLQGILFALLGAQPLLIIGFSGPLLVFEEAFFSFCSSQGVEYLTGRVWIGFWMVLIVLLLVAFEGSFMVRFISRFTQEIFSILISLIFIYETFSKLYKVFQDHPLLS----TYPVISNMTTNSDTSNSSIVNGTTAATPKVLNQPNTALLSLLLMSGTFFIAFFLRKFKNSRFLAGKVRRVIGDFGVPIAILVMVLVDFGVPNTYTQKLNVPDGFSVTSPSKRGWVINPLGAEGTFPVWLMFACVIPGLLVFILIFMESQITTLIVSKKERMLLKGSGFHLDLLLIVVMGAICTIFGLPWLTAATVRSVTHVNALTVMSKATAPGDK--PRIECVKEQRITGLLVAIIVGLSMVLGQVLRQ-IPLAVLFGIFLYMGVTSLNGIQFYDRLMLVFMPAKYHPDTAYATKVRTLRMNLYTGIQFVCLGGLWAVM---STAASLAFPFVLILTVPLRRFLLSRIFTDRELKCLD 991          
BLAST of slc4a-4 vs. Ensembl Sea Lamprey
Match: SLC4A2 (solute carrier family 4 member 2 [Source:HGNC Symbol;Acc:HGNC:11028])

HSP 1 Score: 171.014 bits (432), Expect = 1.843e-43
Identity = 184/662 (27.79%), Postives = 315/662 (47.58%), Query Frame = 2
Query: 1166 ELSRTFATLLSDMEF---------RSQLLFAQTE--------------DEF---------KEMLQNHARDLAEEQRLYRR-----RSIRITEVMNQAFAYEEKFPLG------NGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLA-KGLLNSTNEFITITTEESRKENGXXXXXXX------------IGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGS-----YLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLF---FMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            E+ R+ +TL+SD +F         R  LL A TE              DE          ++MLQ       E+ R + R     +S R   V      Y+ + PL        G+V D R+R P Y SD KD +       + ++A  F+YFA L P++ FG L  + T G I V  +I+S ++  + FAL+  QPL+++  + PL ++ +  ++      + + T   W+G +  + ++L    + S L+R+ +R T+EIF++ ISI FI +    + KVF +  +     KT  I  T LA  G+  + +  I   T  +R +      +               GT ++  +      + FL    R ++ D+ +P+A+LIM  + S     Y  K    D F   S ++ S         S   V+       P +L+F   FM+  +T+ +V+    +L KGS +H DLL++ ++    +L G+PW+      S  HV AL  + +    G +    I  V+E R TGL+  +LIGLS++L  +    +P+AVL G+F+YM +T++ G Q+ +R++L F     +P S Y  +V   +++++T +Q   L LL  +    +  A + FP +L+L +P+RH++ P+  +   +  LD
Sbjct:  569 EIGRSISTLMSDKDFHEAAYLADERQDLLTAITEFLDCSIVLPPSELTDEGLLRSVAAFQRDMLQKRRE---EDGRRHPREEPPVQSTRGALVGGGVRLYDVEDPLQRTGRPFGGVVRDARRRYPFYPSDIKDAVDP-----QCLAAVIFIYFAALSPAITFGGLLGEKTQGLIGVSELIISTSIQSIFFALLSAQPLLIVGFSGPLLVFEEAFFSFCWSQDVEYLTGRLWIGFWLILIVLLTVAFEGSFLVRYISRFTQEIFSILISIIFIYETFYKLFKVFKEHPLL----KTYTIGGTDLAGSGVWGNASMVIGSATAAARNDTDAPTKMPSQPNTSLLSLVLMSGTFFIAFFLRKLKNSRFLAGKVRRVIGDFGVPIAILIMVLVDSAIPDTYTQKLAVPDGFSVTSPDQRSWLVNPLGVRSTFPVWMMFACVVPAALVFILIFMETQITTLIVSKSERRLVKGSGFHLDLLLIVLMGGASALLGVPWLTAATVRSVTHVNALTVMSKATAPGEK--PRIECVKEQRATGLLVAVLIGLSVVLGEVLRR-IPLAVLFGIFLYMGVTSVNGIQMYDRLLLAFMPAKHHPDSAYASKVKTWRMNMYTAIQFVCLALLWVVM---STAASLAFPFVLILTVPLRHFLLPRIFTAHELRCLD 1212          
BLAST of slc4a-4 vs. Ensembl Sea Lamprey
Match: slc4a7 (solute carrier family 4 member 7 [Source:ZFIN;Acc:ZDB-GENE-140106-104])

HSP 1 Score: 168.318 bits (425), Expect = 1.191e-42
Identity = 153/552 (27.72%), Postives = 260/552 (47.10%), Query Frame = 2
Query: 1376 NGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKV-------------FYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFI---TITTEESRKENGXXXXXXX------------------IGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVN----FSQISISAVFAALGLAFP---LSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIR 2908
             G+V D++++IP Y SDY+D +       + +++  FLY AC+ P + FG L  + T+G+I+    +   ++ G+ ++L  GQPL ++ +T P+ ++ K++Y     Y+L + ++ + +G++ +   +L    D S L+ + TR TEE FA  I I FI +A++ ++ +                 Y    V  +VP   T  A   +N + + I    +T  +  + +G                           T +L  +   F    +  +  R  ++D+++ L +L M  I  +L     I + K +   EF     +       I  +  +  L  A P    ++L FMDQ +T+ ++N   +KLKKG  YH DLL VAI+  V S+ GLPW       S  HV +L    E    G +     + +RE R    +   ++    + +   L ++P+ VL G+F+YM  ++L G Q  +R+ L        P   YLR VP RKVHLFT +Q T L LL  +  +P   A I FP+++L  + IR
Sbjct:  487 GGLVRDIKRKIPFYWSDYRDSLN-----LQCIASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQPLTILGSTGPVLVFEKILYKFCKDYNLSYLSLRACIGLWTAFLCLLLVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLVHLGETYEVNMHADPELLTQYSCVCVEPSVPSNETLDAWSNMNRSADSIPWGNLTVSKCLELHGQFVGTACGHHGPYIPDVLFWSIILFFATFFLSGFLKQFKTMRYFPTKVRSTVSDFAVFLTILSMVVIDYFL----GIPSPKLQVPSEFKPTRDDRGWIVDPIGPNPWWTILAAAIPALLCTILVFMDQQITAVIINRKEHKLKKGCGYHLDLLWVAIMLAVCSIMGLPWFVAATVLSISHVNSLKVESECSAPGEQ--PKFLGIREQR-VTGLMIFVLMGCSVFMTGVLKFIPMPVLYGVFLYMGASSLKGIQFFDRIKLFVMPAKHQPDFIYLRHVPLRKVHLFTAVQFTCLVLLWVIKASP---AAIVFPMMVLALVFIR 1023          
BLAST of slc4a-4 vs. Ensembl Sea Lamprey
Match: SLC4A4 (solute carrier family 4 member 4 [Source:HGNC Symbol;Acc:HGNC:11030])

HSP 1 Score: 129.413 bits (324), Expect = 5.114e-32
Identity = 125/436 (28.67%), Postives = 204/436 (46.79%), Query Frame = 2
Query: 1370 LGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVF--------YKSYVTTLVNKTVPIVNTTL--AKGLLNSTN-EFITITTEESRKENGXXXXXXX--------------IGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEF---SIK---FV------NFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETR 2566
            L  G+  D+++++P + SD  D +    +I+ L SA  F+Y A +  ++ FG L    TD    V    L   + G  F L  GQPLI++ +T P+ ++ ++++  S +    +     W+G++++   ++    D S L+++ TR TEE F+  IS  FI DA+K +L +F        YK    TL + T    +  L     L N+T  ++  ++ +E  K  G L                   +GT +  +    F    +  ++ R L++D+S+ L+  I +F+G  +   I ++T K     EF   S K   FV       +    +SAV A L     +++L FMDQ +T+ +VN   NKLKKGS YH DL  VA++    S  GLPW       S  H+ +L    E    G +     + VRE R
Sbjct:    2 LFGGLFKDIKRKLPFFCSDIYDAL----SIQSL-SATLFIYLATITNAITFGGLLGDATDNMQGVLESFLGTALSGAVFCLFAGQPLIILSSTGPVLVFERLLFNFSKENDFDYLEFRLWIGLWSAFMSLILVATDASYLVQYFTRFTEEGFSALISFIFIYDAIKKMLGLFNYYPINLDYKPDYITLYSCTCQAPDPVLMIKPDLGNATGPDWSALSKKECSKYGGSLSGKACKFVPDVALVSLLLFMGTYYTTMALKRFKTGRYFPTTIRKLISDFSIILS--IFTFVGLDIL--IGLETPKLVVPTEFKPTSAKRGWFVPPFGGNPWWVYLVSAVPAIL-----ITILVFMDQQITAIIVNRKENKLKKGSGYHLDLFWVAVLMATCSFLGLPWYVAATVLSIAHIDSLKMETETSAPGEQ--PKFLGVREQR 421          
BLAST of slc4a-4 vs. Ensembl Yeast
Match: BOR1 (Boron efflux transporter of the plasma membrane; binds HCO3-, I-, Br-, NO3- and Cl-; has similarity to the characterized boron efflux transporter A. thaliana BOR1 [Source:SGD;Acc:S000005219])

HSP 1 Score: 153.68 bits (387), Expect = 1.653e-39
Identity = 127/470 (27.02%), Postives = 219/470 (46.60%), Query Frame = 2
Query: 1355 EEKFP-LGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMS---FIGSYL----FKDIKIDT--FKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTE 2734
              +FP LG GI  DL+ RIP Y SD+ D         +++ +    YF  LLP++AF       TD    V  V+LS  + G+ F ++GGQPL ++  T P++++   +Y I    +  ++    W+ +++ IF ++ +  +   L+++ T    +IF LFI++ +I                                KG+   T +F   + E+S ++     ++ L+ T + G++F  F   P  +   R  ++DYS  L+VL  S     G YL    FK + I    F T         ++ +  I +  VF AL     L++LF+ D NV+S M      KLKK S++H+D  ++ +   +  + G+P  +G +P +PLH + L       DS  ++   I  V +         +++G     L + L  +P AVL GLF  M I  L  N +++R++ LF++
Sbjct:   52 RRRFPTLGIGIWLDLKDRIPYYKSDWVDAFN-----YRVIPSIVDTYFNNLLPAIAFAQDMFDRTDNSYGVNEVLLSSAMAGIVFGVLGGQPLCIVGVTGPISIFNYTVYEIIKPLNTSYFGFMFWICMWSMIFHLVLAFTNAVCLLQYVTTFPCDIFGLFINVVYI-------------------------------QKGIQILTRQFSAKSGEKSVQDGFASVVVALVMTAF-GLFFKLFHYYPLFSHRIRTFISDYSTALSVLFWSSFTHFGGYLHDVKFKKLPITKAFFPTSKVNRPQNTWLAYEPIPVKDVFIALPFGIFLTILFYFDHNVSSLMAQRHQYKLKKPSSFHYDFALLGLTTCISGVLGIPAPNGLIPQAPLHTETLLVR----DSNQKV---ISCVEQRFTNTFQGLMILGTMTRPLLVCLGEIPQAVLSGLFFIMGINGLMTNSIIQRLVFLFSD 477          
BLAST of slc4a-4 vs. Ensembl Nematostella
Match: EDO40610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6T5])

HSP 1 Score: 308.531 bits (789), Expect = 1.970e-96
Identity = 193/318 (60.69%), Postives = 251/318 (78.93%), Query Frame = 2
Query: 2006 KENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            +E G L+LLL +GTV LG+   NF K+PFL+++KR  +ADY+LP+AVL  SFIG+Y F    + TFK  S    ++K  + S +S  AVF A GL F LSLLFFMDQN++SAMVN P N+LKKGSA+H DLL+VAIIN +LS FGLPW+HG LPHSPLHV+ALAD+EER+D GH +++ IVKVRETRLT LI+HILIGLSLL+LP PL Y+P AVLDGLF+++A+T+L  NQ+ ER++L  TEQ+AYPP+HY+RRVPQRK+H +T +Q+ QLG+LC  GF+P PY K+ FP+LLLL +PIRH + P+ I   ++DA+D
Sbjct:    6 REAGTLYLLLSLGTVLLGVTLYNFKKSPFLDANKREALADYALPVAVLFFSFIGTYFFSGESLHTFK--SSGAVTLKPSSLSLLSAGAVFGACGLGFCLSLLFFMDQNISSAMVNNPGNRLKKGSAFHLDLLVVAIINGILSAFGLPWIHGALPHSPLHVRALADVEERVDQGH-VFDIIVKVRETRLTTLIAHILIGLSLLMLPTPLDYIPTAVLDGLFLFVAVTSLDDNQMFERLLLFVTEQSAYPPNHYIRRVPQRKMHAYTGMQMLQLGILCGFGFSPMPYLKMVFPVLLLLLLPIRHLVVPRVIERKFLDAID 320          
BLAST of slc4a-4 vs. Ensembl Nematostella
Match: EDO40611 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6T6])

HSP 1 Score: 254.218 bits (648), Expect = 1.237e-72
Identity = 139/347 (40.06%), Postives = 222/347 (63.98%), Query Frame = 2
Query:  677 LVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQ-------RLYRRRSIRITEVMNQAFAYEEKFPL--GNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAIS 1690
            L+L + +KI +K+FS+EVRA  D+++FL++  ++L++    ++ I++ +L +I     D  + +++   + A+ A F K      S   L+  ++G  I+E  G    Q+W+ AM  L  + + H+A++RL+   NLGR+ +G + V+L+++P K K TK+ +EL RTFATLLSD++FR  LL A++++EF ++L     DL+  +       +L R  S       +  F ++E   +    GI DD  +R+P Y+SD+KDG+ G  T+ KLVS   FLYFAC+LPS+AFGVL  +NT GK++V++V++SQ  GGL F+L+GGQPLI++LTTAPL LYIK + A S
Sbjct:   14 LMLVKHQKIDMKNFSTEVRARKDIDRFLEKPTVLLNVHKTKIEDIIDLMLDKIIE---DKQLQKVN--FSAARTAFFTKD-----SVHCLSHVIQGTEISEGGGWEETQNWLVAMADLPSIQQSHIAMSRLRHATNLGRTLQGTHLVVLILSPVKTKKTKNSLELGRTFATLLSDIDFRQSLLEAESKEEFVKVLAERKSDLSNNRNKPEINSKLVRSASKGFNP-YHCVFNFQETSTMKPCRGIRDDFMRRMPHYLSDFKDGVVGHRTLFKLVSTVIFLYFACILPSVAFGVLNSKNTKGKMDVQKVLVSQVFGGLFFSLLGGQPLIILLTTAPLALYIKDLTAGS 349          

HSP 2 Score: 193.741 bits (491), Expect = 7.222e-52
Identity = 143/289 (49.48%), Postives = 180/289 (62.28%), Query Frame = 2
Query: 2057 GIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPS---NKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVY--MAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIR 2908
            G+   NF K+PFL+++KR  +ADY+LP+AVL  SFIG+Y F     D                                                +V C S    +LKKGSA+H DLL+VAIIN +LS FGLPW+HG LPHSPLHV+ALAD+EER+D GH +++ IVKVRETRLT LI+HILIGLSLL+LP PL Y+P AVLDGL       + AL  N         F  Q+AYPP+HY+RRVPQRK+H +T +Q+ QLG+LC  GF+P PY K+ FP+LLLL +PIR
Sbjct:  423 GVTLYNFKKSPFLDANKREALADYALPVAVLFFSFIGTYFFSGESCDIV---------------------------------------------VVVLCSSTHIQELKKGSAFHLDLLVVAIINGILSAFGLPWIHGALPHSPLHVRALADVEERVDQGH-VFDIIVKVRETRLTTLIAHILIGLSLLMLPTPLDYIPTAVLDGLASSHNAQVFALLENN-------CFLLQSAYPPNHYIRRVPQRKMHAYTGMQMLQLGILCGFGFSPMPYLKMVFPVLLLLLLPIR 658          
BLAST of slc4a-4 vs. Ensembl Nematostella
Match: EDO45844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRK7])

HSP 1 Score: 202.601 bits (514), Expect = 1.622e-53
Identity = 179/632 (28.32%), Postives = 299/632 (47.31%), Query Frame = 2
Query: 1025 SLTCVHKRHVAIARLKTPVNLGRSSE---GVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARD------------------LAEEQRLYRRR--SIRITEVMNQAFAYEEKFPL------GNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKI-------DTFKTRSEEEFSIK---FVN----FSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVH 2791
            +L C+     A  RL     LG  +E    V F+ +++ P+ + DT    E+ R+ ATL+SD  F     ++++ ++    +     D                  L++ + + +RR  +  I  +  QA A EE  PL        G++ D++ R   YISD+KDG        + +    FLYFA   P++AFG L  + TD  + V  VI +    GL FAL  GQPLI++  T P+ ++ + I+    + ++ F     W+G +  + L L    +   L+R+ TR TEE+FA  IS+ FI +A+  + KVF K+ ++       P+ N T     +      + +T E +     LL  +L+ GT ++  Y   F  + F     R L++D+ + +A++ M  I   + +D  I       D  K         K   F+N       +    VFAA+  A  + +L FM+  +T  ++N   N L+K   Y+ DLL++ +I L+ SLFGLPW+      S  H  AL+        G + Y  +V+VRE R    I   ++    +LL   L +VP+ VL G+ +Y+ +++L   QL+ R+I++      +P   Y+R+VP  K+H
Sbjct:  249 TLDCLKNPVTAFVRLAKGCYLGNVTEVAIPVRFLFVMLGPETQSDTYH--EIGRSIATLMSDQVFHDLAYYSESREDILMAINEFLDDTVVLPPGEWDKQLLIPVLLSQSKTMAKRRKQAKEINAIATQA-AEEEDNPLKRTGRFCGGLIQDIKHRSKTYISDFKDGFNW-----QCLLVTVFLYFAVFAPNVAFGGLLAEKTDQWLGVSEVIFASCFCGLLFALFSGQPLIIIGATGPVMVFEQTIFKFCEQSNIEFLPWRCWIGFWVLVILFLVVAFEGCFLVRYFTRFTEELFACLISLIFIYEAINFLYKVFKKNPLS-----RDPVTNLTNIDPYIKEN--IVPVTGEPN---TALLCAILMFGTYFVAFYMRKFRNSHFFGKKARRLVSDFGIAIAMITMVIIDVAI-RDTVITPKISIGDVTKVGFHPTLKTKRGWFINPMGLVDSMKAGWVFAAIIPALFVGILLFMETELTGVLINKKENCLQKRPGYNMDLLLMGVITLICSLFGLPWMCPATVRSVSHFNALSVWSTSHAPGEKPY--LVEVREQR-ITNILIHVLTGMSILLAPVLHHVPVPVLFGVLLYLGLSSLSNLQLINRLIMMLMPPKHHPDVRYVRKVPTAKIH 858          
BLAST of slc4a-4 vs. Ensembl Nematostella
Match: EDO31793 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWX4])

HSP 1 Score: 165.622 bits (418), Expect = 8.703e-42
Identity = 173/632 (27.37%), Postives = 291/632 (46.04%), Query Frame = 2
Query: 1052 VAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDI-ELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARD--------------------LAEEQR--LYRRRS-----------IRITEVMNQAFAYEEKFPL------GNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTV---PIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFI----GSYLFKDIKI-DTFKTRSEEEFSIKFVN----FSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVH 2791
            V +AR     NL   +  V F+ +++ P    D   D  E+ R  ATL+SD  F      A+   +  + + +   D                    LA+E +    RRR            +   E + ++   E+  PL        G++ D+++R P Y SD  D         + V A   +Y ACL P+++FG L  + T G + V  +I+S  + G+ FAL  GQPLI++  T PL L+   ++ +S  +   +    +WVGI+  +       ++   L+R+ TR TEEIFA  IS+ FI D +K +  +F    +T+   + V    + NT L          F TI               L  GT ++     +   + FLN + R +++D+ + +A++ M  +     S   + + + D F   S       +VN      ++   A+F AL  A  +S+L FM+    + +++   N+LKKG  Y+ DL +V  +  + S+ GLPW+  T  H+  H+ AL         G   +  +++V+E R+T +I H+LIGL++LL P+  +  P+ VL G+FV++  ++L   Q VER  LLF     +P   Y+R V   K++
Sbjct:  222 VRLARGCRLRNLAEVNIPVRFLFILLGPD---DKSIDYHEVGRCVATLMSDRLFLDCAYDAEELQDLYDAMDSFLSDTVIIPPGEWDRNVLAQSLPSLAKETKKTALRRRGALLRKQRHFSDLETQETVTESLELEDD-PLKRTGLFCGGLLRDVKRRFPYYKSDMTDSFNW-----RCVMATILVYVACLAPAISFGGLLYKKTKGWMGVAEMIVSTALSGVIFALFAGQPLIIIGATGPLLLFETNVFNLSESFDFEYMPWRAWVGIWVMLICWALVAMEGCFLIRYFTRFTEEIFACMISLIFIYDGIKYIYDIFGLYPLTSGTTENVDGKDVSNTAL----------FTTI---------------LFFGTFFVAHIIRDVRHSRFLNHTLRRVISDFGVLIAIVAMILVELSAQSIYVQRLNVPDGFDVTS-PHLRGWYVNPMGTERRLGADAIFGALVPAILVSILVFMEVEFCNVILDKKDNQLKKGPGYNLDLFVVGFLMGMCSVLGLPWMCATPVHTVSHLHALMVHSTNHAPGE--HPQLLEVKEQRVTNIIIHVLIGLTMLLAPVIRL-TPVVVLFGVFVHLGFSSLSHLQFVERFKLLFVSPNHHPDRRYVRSVSTGKMN 815          
BLAST of slc4a-4 vs. Ensembl Nematostella
Match: EDO27089 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA82])

HSP 1 Score: 62.003 bits (149), Expect = 1.323e-11
Identity = 32/104 (30.77%), Postives = 60/104 (57.69%), Query Frame = 2
Query: 1574 ILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVF 1885
            +L   +GG+ FAL  GQPLI++  T P+ ++ +++Y    +  L + +   W+GI+  +F ++  + D S ++ + TR TEE FA  I+I +I +  K +  + 
Sbjct:    5 MLGGAIGGILFALFSGQPLIILGATGPMLVFEEIVYTFCERVGLEYLSFRLWIGIWTMLFCLILVVTDASAMICYFTRFTEETFATLIAIIYIYEGFKKLFHIL 108          
BLAST of slc4a-4 vs. Ensembl Medaka
Match: slc4a11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:101165271])

HSP 1 Score: 520.776 bits (1340), Expect = 1.306e-169
Identity = 325/846 (38.42%), Postives = 519/846 (61.35%), Query Frame = 2
Query:  482 FKKQSTNNDDKDSKDRNLLLSPTNYINRQISETSEMSTDTV----SNFSIGSLARYYRTADENGEGLPCLVLARLEK-IPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEML--QNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-VTTLVNKTVPIV-----------NTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            F+KQ     D+ S+DR            +  ++     D +    +  S G+       AD+ G    C++L    + + + +F  EVRA  D++ FL +  ++LD  A  +D +++ +L  +     D    +      E  + LF  A  +  +   L++T++G+      G+   QSW+  +C++  + +RHV I+RL+ P N G +   V +V+L++ P K K TK+ +EL RTFATL SD+ FR +LL  +T++EFKE L  Q H    A +Q     +        ++    ++ F +G GI +D  +R+P Y SD+ DGI G   T+ K ++ A FLY A LLP++AFG L D++T G+I+V++ I+ Q++GG+ ++L  G PL++ LTTAPL ++I VI  I   Y+L F   ++ +G++N +FLIL  + ++S LM+   RSTEE+ ALFISIAF+VDAVK  +K+F + Y   T  N+++              +   A+ +LN+  E I     +  +E  +L LLL++GT+W+G     F ++PFL++  R +++D +LP++VL+ SFIGSY+F DI++  FK  +   F++    F ++S   V +A+GL F L+LL F+DQN+  ++ N P N+L KG+AYHWDL++  +IN+++S+ GLPW+H   PHS LHV+ LA +E+R++ GH +YETIV+V+ETRLT L ++I IG+SLLLLP+PL ++P  VL GLF+Y+A+T++ GNQ+ +R+ LL  EQ +YPP+HY+R+VPQRK+H FT LQ+ QL +LC  G  P PY K+ FP++++  +PIR+ + P  I   Y+D +D
Sbjct:   26 FQKQREAEQDEGSEDRE-----------ETQDSPIACGDDIHLYDNQISPGT------DADDCG----CVLLNTSRRYVKLMNFEEEVRALRDLDGFLAKASILLDETAASLDDVLKRMLHHV---GQDGHAYEPSCNFEEVMSLLFTDAGAQEVNVHLLSETIQGVTATAT-GIQYQQSWLCILCNVKHLQRRHVCISRLERPQNWGENCCEVRYVILILAPSKMKSTKTAMELGRTFATLFSDISFRQKLLETKTQEEFKEALLFQRHQLTAANQQPTALGKE-ETDPRSHKPLKCKDFFKVGRGIYEDFCRRLPFYPSDFTDGIVGSNKTLLKYMTTAIFLYIAILLPAIAFGSLNDESTRGEIDVRKTIVGQSIGGIIYSLFAGSPLVIPLTTAPLAIFISVIRGICDDYNLDFPAFYACIGLWNCLFLILGGIFNVSLLMKLFKRSTEEVIALFISIAFVVDAVKGTVKIFQRYYNAPTSTNRSLEDFRQGGELLEGNRSEVAARLMLNALPETII----QCSRERPVLCLLLMLGTLWMGYTLYQFKRSPFLHAKVREVLSDCALPISVLLFSFIGSYIFSDIELPVFKVHNRPIFNV--APFERLSAMNVVSAMGLGFLLALLIFIDQNIVVSLTNAPENRLLKGTAYHWDLMLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAFVEQRVEGGH-LYETIVQVKETRLTSLAANIFIGVSLLLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMMQLLVLCTFGMYPIPYMKMIFPLVMIFLIPIRNNVLPHIIEAKYLDIMD 838          
BLAST of slc4a-4 vs. Ensembl Medaka
Match: slc4a11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:101165271])

HSP 1 Score: 520.776 bits (1340), Expect = 1.400e-169
Identity = 315/787 (40.03%), Postives = 500/787 (63.53%), Query Frame = 2
Query:  647 ADENGEGLPCLVLARLEK-IPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEML--QNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-VTTLVNKTVPIV-----------NTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            AD+ G    C++L    + + + +F  EVRA  D++ FL +  ++LD  A  +D +++ +L  +     D    +      E  + LF  A  +  +   L++T++G+      G+   QSW+  +C++  + +RHV I+RL+ P N G +   V +V+L++ P K K TK+ +EL RTFATL SD+ FR +LL  +T++EFKE L  Q H    A +Q     +        ++    ++ F +G GI +D  +R+P Y SD+ DGI G   T+ K ++ A FLY A LLP++AFG L D++T G+I+V++ I+ Q++GG+ ++L  G PL++ LTTAPL ++I VI  I   Y+L F   ++ +G++N +FLIL  + ++S LM+   RSTEE+ ALFISIAF+VDAVK  +K+F + Y   T  N+++              +   A+ +LN+  E I     +  +E  +L LLL++GT+W+G     F ++PFL++  R +++D +LP++VL+ SFIGSY+F DI++  FK  +   F++    F ++S   V +A+GL F L+LL F+DQN+  ++ N P N+L KG+AYHWDL++  +IN+++S+ GLPW+H   PHS LHV+ LA +E+R++ GH +YETIV+V+ETRLT L ++I IG+SLLLLP+PL ++P  VL GLF+Y+A+T++ GNQ+ +R+ LL  EQ +YPP+HY+R+VPQRK+H FT LQ+ QL +LC  G  P PY K+ FP++++  +PIR+ + P  I   Y+D +D
Sbjct:   70 ADDCG----CVLLNTSRRYVKLMNFEEEVRALRDLDGFLAKASILLDETAASLDDVLKRMLHHV---GQDGHAYEPSCNFEEVMSLLFTDAGAQEVNVHLLSETIQGVTATAT-GIQYQQSWLCILCNVKHLQRRHVCISRLERPQNWGENCCEVRYVILILAPSKMKSTKTAMELGRTFATLFSDISFRQKLLETKTQEEFKEALLFQRHQLTAANQQPTALGKE-ETDPRSHKPLKCKDFFKVGRGIYEDFCRRLPFYPSDFTDGIVGSNKTLLKYMTTAIFLYIAILLPAIAFGSLNDESTRGEIDVRKTIVGQSIGGIIYSLFAGSPLVIPLTTAPLAIFISVIRGICDDYNLDFPAFYACIGLWNCLFLILGGIFNVSLLMKLFKRSTEEVIALFISIAFVVDAVKGTVKIFQRYYNAPTSTNRSLEDFRQGGELLEGNRSEVAARLMLNALPETII----QCSRERPVLCLLLMLGTLWMGYTLYQFKRSPFLHAKVREVLSDCALPISVLLFSFIGSYIFSDIELPVFKVHNRPIFNV--APFERLSAMNVVSAMGLGFLLALLIFIDQNIVVSLTNAPENRLLKGTAYHWDLMLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAFVEQRVEGGH-LYETIVQVKETRLTSLAANIFIGVSLLLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMMQLLVLCTFGMYPIPYMKMIFPLVMIFLIPIRNNVLPHIIEAKYLDIMD 840          
BLAST of slc4a-4 vs. Ensembl Medaka
Match: slc4a11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:101165271])

HSP 1 Score: 511.916 bits (1317), Expect = 4.321e-166
Identity = 316/798 (39.60%), Postives = 503/798 (63.03%), Query Frame = 2
Query:  647 ADENGEGLPCLVLARLEK-IPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKA-------HYENFSY----QRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEML--QNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSY-VTTLVNKTVPIV-----------NTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            AD+ G    C++L    + + + +F  EVRA  D++ FL +  ++LD  A  +D +++ +L  +     D    +      E  + LF  A       + ++F +      L++T++G+      G+   QSW+  +C++  + +RHV I+RL+ P N G +   V +V+L++ P K K TK+ +EL RTFATL SD+ FR +LL  +T++EFKE L  Q H    A +Q     +        ++    ++ F +G GI +D  +R+P Y SD+ DGI G   T+ K ++ A FLY A LLP++AFG L D++T G+I+V++ I+ Q++GG+ ++L  G PL++ LTTAPL ++I VI  I   Y+L F   ++ +G++N +FLIL  + ++S LM+   RSTEE+ ALFISIAF+VDAVK  +K+F + Y   T  N+++              +   A+ +LN+  E I     +  +E  +L LLL++GT+W+G     F ++PFL++  R +++D +LP++VL+ SFIGSY+F DI++  FK  +   F++    F ++S   V +A+GL F L+LL F+DQN+  ++ N P N+L KG+AYHWDL++  +IN+++S+ GLPW+H   PHS LHV+ LA +E+R++ GH +YETIV+V+ETRLT L ++I IG+SLLLLP+PL ++P  VL GLF+Y+A+T++ GNQ+ +R+ LL  EQ +YPP+HY+R+VPQRK+H FT LQ+ QL +LC  G  P PY K+ FP++++  +PIR+ + P  I   Y+D +D
Sbjct:   70 ADDCG----CVLLNTSRRYVKLMNFEEEVRALRDLDGFLAKASILLDETAASLDDVLKRMLHHV---GQDGHAYEPSCNFEEVMSLLFTDAGAQEVNDNSQSFVFFDDVHLLSETIQGVTATAT-GIQYQQSWLCILCNVKHLQRRHVCISRLERPQNWGENCCEVRYVILILAPSKMKSTKTAMELGRTFATLFSDISFRQKLLETKTQEEFKEALLFQRHQLTAANQQPTALGKE-ETDPRSHKPLKCKDFFKVGRGIYEDFCRRLPFYPSDFTDGIVGSNKTLLKYMTTAIFLYIAILLPAIAFGSLNDESTRGEIDVRKTIVGQSIGGIIYSLFAGSPLVIPLTTAPLAIFISVIRGICDDYNLDFPAFYACIGLWNCLFLILGGIFNVSLLMKLFKRSTEEVIALFISIAFVVDAVKGTVKIFQRYYNAPTSTNRSLEDFRQGGELLEGNRSEVAARLMLNALPETII----QCSRERPVLCLLLMLGTLWMGYTLYQFKRSPFLHAKVREVLSDCALPISVLLFSFIGSYIFSDIELPVFKVHNRPIFNV--APFERLSAMNVVSAMGLGFLLALLIFIDQNIVVSLTNAPENRLLKGTAYHWDLMLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAFVEQRVEGGH-LYETIVQVKETRLTSLAANIFIGVSLLLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMMQLLVLCTFGMYPIPYMKMIFPLVMIFLIPIRNNVLPHIIEAKYLDIMD 851          
BLAST of slc4a-4 vs. Ensembl Medaka
Match: SLC4A11 (sodium bicarbonate transporter-like protein 11 [Source:NCBI gene;Acc:101168050])

HSP 1 Score: 447.588 bits (1150), Expect = 1.266e-143
Identity = 275/684 (40.20%), Postives = 414/684 (60.53%), Query Frame = 2
Query: 1037 VHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAE----------EQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPG-TIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITIT-------TEESRKENGXXXXXXXIGTVWL-------------------------GIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            + +R V IARL  P N G +     +V+L++ P + K TK+ IEL RTFAT+ SD+ FR +LL  +T+DEFK+ L +  R L+E          E+   RR          +     + F  G G+ +DLR+R+P+Y SD+ DGI G    + K ++ A FLY A LLP++AFG L D++T G+I+V++ I+ Q++GG+ ++L  G PL++ LTTAPL ++I +I  I   Y+L F   ++ +G++N  FL+L  L ++S LM+   RSTEE+ ALFISIAF+ DA+K  +K+F   +         PI+ TT +  +L   NE +          TE  + +            V+L                         G       ++P+LN   R +++D +LP++V+I SFIGSYLF DI++  F       F  K+  F ++S  AV +A+GL F L+LL F+DQN+  ++ + P +KL KG+ +HWDL++   IN+++S  GLPW+H   PHS LH + LA +E  +++GH ++ TIV V+ETR+T L+++ILIGLS  +LPIPL ++P  VL GLF+Y+A T+L GNQ+V+R+ LL  EQ +YPP+HY+RRVPQRKVH FT LQ+ QL +LCA G  P PY K+ FP+L++L +P+R  + P+ I   Y+D +D
Sbjct:   18 LQRRQVCIARLDKPQNWGVNCAEARYVILILAPPRTKSTKTAIELGRTFATMFSDISFREKLLDPRTQDEFKQELVSQRRQLSEVNANTIVEEVEESDPRR---------GKPLECRDFFKAGRGVYNDLRRRLPLYPSDFTDGITGKDRCLVKYITTAIFLYIAILLPAIAFGSLNDESTRGEIDVQKTIVGQSIGGVIYSLFAGSPLVIPLTTAPLAIFISIIRGICDDYNLDFEAFYACIGLWNCFFLVLGGLFNVSLLMKLFKRSTEEVIALFISIAFVGDAIKGTIKIFDHYFHG-------PILATTNSSAVLQQINEILEKANNQTPHLTEHHKGDMSQFEQAETQVLVFLPETLVICTRERPILCLLLMLGTLWLGYALYLMKRSPYLNDKIREVVSDCALPISVMIFSFIGSYLFIDIQLPVFNVHDGPVF--KYPEFEKLSGMAVLSAVGLGFLLALLIFIDQNIVISLTHVPEHKLLKGTTFHWDLVLTGFINILMSCLGLPWMHAAFPHSSLHARQLAKVEHHLENGH-LHSTIVSVKETRVTSLVANILIGLSAFMLPIPLQWIPKPVLYGLFLYVAATSLDGNQMVDRMTLLLKEQTSYPPTHYIRRVPQRKVHYFTALQMLQLIILCAFGMYPLPYMKMVFPLLMILLVPVRTGLLPRLIDAKYLDIMD 682          
BLAST of slc4a-4 vs. Ensembl Medaka
Match: slc4a3 (solute carrier family 4 member 3 [Source:NCBI gene;Acc:101164449])

HSP 1 Score: 198.364 bits (503), Expect = 2.848e-51
Identity = 177/674 (26.26%), Postives = 316/674 (46.88%), Query Frame = 2
Query: 1106 VYFVMLVITPKKEKDTKSDI---ELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQN----------------HARDLAE-----EQRLYRRRSIRITEVMNQAFAYEEK------------------------FPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIM-----SFIGSYLFKDIKIDTFKTRSEEE---FSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALD 2959
            V F+ +++ P     ++S++   E+ R+FATL+SD  F     FA   D+ +++L                    +DL +     ++++ R+R  R  +  +     E+                          P G G++ D+R+R P+YISD+KD +       + ++A  F+YFA L P++ FG L  + T+G + V  +I+S    G+ F+L  GQPL+++  + PL ++ +  Y     Y   + T   W+G +    +++    + S L+R+ +  T+EIFA  IS+ FI +    + KVF K +    V  T    +TT A G  N  N         ++    LL L+L++GT ++  +   F  + FL    R ++ D+ +P+++L+      S   +Y  K      F   S ++   F   F +        + A++  A  + +L FM+  +TS +V+    +L KGS +H DLL++ I+  +  LFGLPW+      S  HV AL  + +    G +    I +V+E R    +   ++    +++   L  +P+AVL G+F+YM +T+L G QL ER+ L+ T    +P   Y+ +V   K     +  + QL  + AL    +    + FP +L++ +P+R  I  +      + ALD
Sbjct:  576 VRFIFVLLGP-----SQSNVDYHEIGRSFATLMSDKNFHEVAYFA---DDRQDLLNGINKFLDCSIVIPPSDIEGKDLLKTVADFQKQILRKRREREGKKHHPMLGAEQDNKDVTPNEEEEEEDHEVDPLTRSGIPFG-GLIHDIRRRYPLYISDFKDALD-----MQCIAAVIFIYFAALSPTITFGGLLGEKTEGMMGVTELIVSTATLGVLFSLFAGQPLLIIGFSGPLLVFEEAYYKFCQAYKFEYLTGRVWIGFWLIGIVLVIVAAEGSFLVRYISPFTQEIFAFLISLIFIYETFSKLFKVF-KEHPLMAVYPT----DTTAATGFPNEDNLIF------NQPNTALLSLVLMMGTFFIAFFLRKFRNSRFLGGKARRIIGDFGIPISILVSVLVDYSITDTYTQKLNVPSGFSVTSPDKRGWFISPFGDKQPFPTWMMGASVVPALLVFILIFMETQITSLIVSKKERRLIKGSGFHLDLLLIVILGAICPLFGLPWLTAATVRSVTHVNALTVMSKATAPGEK--PMIQEVKEQR-LTGLLVAVLVGMSIVMTDVLRLIPLAVLFGIFLYMGVTSLTGIQLYERITLMVTPAKHHPDHIYVTKV---KTWRMNMFTIIQLTCIVALWVVKSTVVSLAFPFILIMTVPLRRLILSRIFEERELQALD 1218          
BLAST of slc4a-4 vs. Planmine SMEST
Match: SMESG000039045.1 (SMESG000039045.1)

HSP 1 Score: 1637.47 bits (4239), Expect = 0.000e+0
Identity = 868/868 (100.00%), Postives = 868/868 (100.00%), Query Frame = 2
Query:  365 MINSYSSNDKSVPKLVLTNCNQSPAIDRTNRRTISGLYNFKKQSTNNDDKDSKDRNLLLSPTNYINRQISETSEMSTDTVSNFSIGSLARYYRTADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI 2968
            MINSYSSNDKSVPKLVLTNCNQSPAIDRTNRRTISGLYNFKKQSTNNDDKDSKDRNLLLSPTNYINRQISETSEMSTDTVSNFSIGSLARYYRTADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNSIFLILYSLLDLSKLMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGLLFLLLLIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRLTGLISHILIGLSLLLLPIPLIYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHLFTVLQLTQLGLLCALGFAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI
Sbjct:    1 MINSYSSNDKSVPKLVLTNCNQSPAIDRTNRRTISGLYNFKKQSTNNDDKDSKDRNLLLSPTNYINRQISETSEMSTDTVSNFSIGSLARYYRTADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNSIFLILYSLLDLSKLMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGLLFLLLLIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRLTGLISHILIGLSLLLLPIPLIYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHLFTVLQLTQLGLLCALGFAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI 868          
BLAST of slc4a-4 vs. Planmine SMEST
Match: SMESG000039045.1 (SMESG000039045.1)

HSP 1 Score: 1435.62 bits (3715), Expect = 0.000e+0
Identity = 772/781 (98.85%), Postives = 773/781 (98.98%), Query Frame = 2
Query:  626 LARYYRTADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI 2968
            L + Y      GEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNSIFLILYSLLDLSKLMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGLLFLLLLIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRLTGLISHILIGLSLLLLPIPLIYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHLFTVLQLTQLGLLCALGFAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI
Sbjct:   57 LNKNYTPRTVKGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNSIFLILYSLLDLSKLMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGLLFLLLLIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRLTGLISHILIGLSLLLLPIPLIYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHLFTVLQLTQLGLLCALGFAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI 837          
BLAST of slc4a-4 vs. Planmine SMEST
Match: SMESG000009949.1 (SMESG000009949.1)

HSP 1 Score: 868.611 bits (2243), Expect = 0.000e+0
Identity = 468/851 (54.99%), Postives = 638/851 (74.97%), Query Frame = 2
Query:  485 KKQSTNNDDKDSKDRNLLL---SPTNYINRQI--SETSEMSTDTVSNFSIGSLARYYRTADEN-GEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQ--MDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVN---------------KTVPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI 2968
            +++ T  D++ S   +L L   SP   ++RQ   S  S +S D +SN S  +LA   + ADE   + +PCL L+RLEKIP+KDFS+EVRATLD++KFLKE VL+LDM  + ++ I++ +L  I  LA +V+  +  ++  + EAK  LF+++ Y  ++YQRLAKT++G+ ++E EGL TDQSW+  MCSL C+HKRHVAIARL  PVN+GRSSEG+YF++LV+TP KEK TKSDIEL RTFAT+ +D+EFR QLLF+++ ++FKE+LQ H+ DL E+Q + RR+S+++ EVMNQAF +++K+ +G+GIV D +KR PVY+ D++DG +G GTIRK++SA  FLYFACLLPS+AFGVL   NT+GKI+V+RVI+SQ +GGLCF    GQPLI++LTTAPL L++K+I +I   Y L F+ M+S VG+ NS+ LILY++ D+SKLMRWSTRS+EEIFALF++I+F+VDAVKD+ K F   Y +  ++               +    + + ++  L  +       ++   ++E  +L+L L+ GTVWL I     TKTPFLN++KR ++ D++LPLAV+IMS IG+YLFK+I++  F    EE+   +     ++   A+  A+ LAFPLSLL FMDQN++SAMVN P+NKLKKGS+YHWDLL+VA+IN  LS+FGLP VHG LPHSPLHVKALADLEERID+ H +++TIVKVRETR+T ++SH+ IG+SL +LPIPLIY+P+AVLDGLFVYMA+T LYGNQ  ER++LLFTEQ+AYPPSHYLRRVPQRK+H+FT LQ+ QL  LC LGF+P+PY K+GFP+LLL  M  RH + P+ I   Y++ALDKPI
Sbjct:   68 EQEVTIKDNRTSISSHLFLLPPSPGRRLSRQRQGSSASNVSVDNMSNISGSTLAYCLQNADETEDDSVPCLFLSRLEKIPMKDFSAEVRATLDIQKFLKEAVLLLDMSGSCLEEIIDSMLLTI--LANEVTDAKVSLEALVEEAKKTLFIQSSYLTYTYQRLAKTIRGLSLSETEGLMTDQSWLCTMCSLNCIHKRHVAIARLNNPVNMGRSSEGIYFIILVVTPTKEKGTKSDIELGRTFATIFADVEFRQQLLFSESVEQFKELLQYHSGDLMEDQAMNRRKSLKVQEVMNQAFHFDKKYLVGSGIVSDFKKRFPVYLMDFRDGFRGKGTIRKVISATIFLYFACLLPSIAFGVLNYNNTEGKIDVRRVIISQAIGGLCFGFFSGQPLIILLTTAPLALFVKIISSICNDYDLDFFAMYSCVGLINSLLLILYAMFDISKLMRWSTRSSEEIFALFVAISFVVDAVKDIYKEFSTHYFSCYLSANNQSTDHLRLSRFKRAFSGIISNISISLTQTNLNSSLYSSNSCQREVSILYLFLVAGTVWLAIQLFTSTKTPFLNNAKREMLTDFALPLAVVIMSLIGTYLFKEIEMQPFVI-VEEKVKFEASGILKLPWLAIAGAIALAFPLSLLMFMDQNISSAMVNSPANKLKKGSSYHWDLLVVALINAGLSVFGLPLVHGALPHSPLHVKALADLEERIDTAHHVHQTIVKVRETRITSILSHVFIGISLQMLPIPLIYIPVAVLDGLFVYMAVTTLYGNQFFERILLLFTEQSAYPPSHYLRRVPQRKLHIFTGLQIFQLAGLCLLGFSPSPYLKMGFPLLLLFHMVFRHQVVPRVIDEKYLNALDKPI 915          
BLAST of slc4a-4 vs. Planmine SMEST
Match: SMESG000061700.1 (SMESG000061700.1)

HSP 1 Score: 847.04 bits (2187), Expect = 0.000e+0
Identity = 471/885 (53.22%), Postives = 627/885 (70.85%), Query Frame = 2
Query:  353 DHLNMINSYSSNDKSVPKLVLTNCNQSPAIDRTNRRTISGLYNFKKQSTNNDDKDSKDRNLLLSPTNYINRQISETSEMSTDTVSNFSIGSLARYYRTADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITT---------------EESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDK 2962
             HL++  ++ S++ S   +VL N N     + T+RRT S L  F     NN D    + ++L                     VS   + +L+ +Y +        P LVL+RLEK+P+KDFSSEVRA+LD+EKF+KE VL L+M    ++ I+E +L  I    +   I  ++ +I EAK  LFM   +  +SYQRLAKT+KGI I++ EGL+ DQSWI+AM +L  +HKRH+AIARL TP NLGRS+E V+F++LV+ P KEK TKS+IEL RTF+T+++D++FR QLL  + E +F+ MLQ  AR LAE Q++ R+RS+++ EVM+QAF+ + KF +G GIV D+++RIP Y+SDY DG +G  TIRK+ S  +FLYF+CLLPS+AFGVL   NTD KI+VKRVI+SQ +GGL F ++GGQPLIVMLTTAPL LY K+I+ IS +Y + F  MF+  GIFN+++L++YSL D+ KLM+WST+STEE+FA F++IAF VDA KDV K F + Y     NK    VN ++ K L N +N F   +T                   ++  +L+LLL IGTVWL  +  NFTKTP+LN+ KR L+AD++LPLA+ IMS IG+ LF+DI +D F    E+ F  + VN   +   A+ +   L FPLSLLFFMDQN+ S+MVN PSNKLKKGS +HWDL IVA+IN  LS+FGLPW+HG +PHSPLHVKAL+D+EERID GH++++TIV+VRETR+T ++S+I I LSL LLP PL Y+PIAVLDGLF++MA+T+LY NQ  ER+ LLFTEQ+AYPPSHYLRRVPQRK+HLFT  QL QL +L ALGF+P+PY K+GFPI+LLLQ+PIRH I PKFI   +I+A+DK
Sbjct:   32 QHLSLSPNFLSHNTSHHSIVLENLN-----NVTDRRT-SNLSQF-----NNSDGYPDNISML-------------------SGVSGIGLRNLSLFYNSPP------PYLVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEIS-LEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEVFAFFVAIAFTVDASKDVYKEFAQHYQCAEENK----VNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF-YYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDK 874          
BLAST of slc4a-4 vs. Planmine SMEST
Match: SMESG000012150.1 (SMESG000012150.1)

HSP 1 Score: 548.125 bits (1411), Expect = 6.869e-179
Identity = 332/769 (43.17%), Postives = 475/769 (61.77%), Query Frame = 2
Query:  665 GLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLL-FAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNXXXXXXXXXXXXXXXMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITTEESRKENGXXXXXXXIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRXXXXXXXXXXXXXXXXXXXXXXYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHXXXXXXXXXXXXXXXXXXAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI 2968
            G   LV+ R     +   S E+RA  D EKF     ++L+      + IV+ LL++++ L       ++D  +  A   L +  + +   Y + AKT+ G    +   ++ D SW+ AM SL+ +  R V       P+N+G S   V  + +VI P KEK  K DIE SR  A ++SD EFR  +  +  TE  F++  +  A  L       + +S        +      K  LG GI  D R R+P Y SDYKD      +I K ++    L+F+ LLP++AFG+L +  T+ KINV   +L+Q +GG+ FAL GGQP+I+MLTT+PL+L I   Y +++     F   ++W+GIFN+++L +YS    S +M++S RSTEE F LF+S+ F++D+VK   K F+  Y           VN T+A              T    KE  LLF+LLL+ T+ LG++    T+TPFLNS  R ++++++LP++VL MSFIGSY+FK++KI +F        S+   +  ++ I+ +  A  +AFPLS+LFFM+QN+ S++VNCP NKLKKG AYH+DLL+V IINL+LS+FGLPWVHG LPHSP+HV ALA +EE ID G++I + +VKV ETR+  +I++ILIG  + L+P PL+Y+P  VL+GLF+YMA TAL+ NQL ER++L  TEQ+AYPP+HYL+RVPQ+KVH+FT +Q  QL LLC LGF P  Y K+ FP +L+LQ+P RH IFPK IS  Y+DALDK I
Sbjct:   37 GFNELVITRNRPTNVPFLSEEIRARADAEKFSSTSSIVLNNYHIKTEIIVKDLLQKMF-LTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGIMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETALRLQNS----KPKSDNSEGEHEEHSGLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETFELFVSVTFVIDSVKACTKSFHNYYYGGHC------VNATIA-------------VTGSCTKEESLLFVLLLLSTMALGLWLNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAGIMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSIQFLQLLLLCILGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDKLI 781          
The following BLAST results are available for this feature:
BLAST of slc4a-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC4A110.000e+042.80solute carrier family 4 member 11 [Source:HGNC Sym... [more]
SLC4A110.000e+042.80solute carrier family 4 member 11 [Source:HGNC Sym... [more]
SLC4A110.000e+042.80solute carrier family 4 member 11 [Source:HGNC Sym... [more]
SLC4A111.450e-17443.42solute carrier family 4 member 11 [Source:HGNC Sym... [more]
SLC4A113.796e-15640.20solute carrier family 4 member 11 [Source:HGNC Sym... [more]
back to top
BLAST of slc4a-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abts-30.000e+043.22Anion/Bicarbonate TranSporter family [Source:UniP... [more]
abts-30.000e+045.69Anion/Bicarbonate TranSporter family [Source:UniP... [more]
abts-30.000e+045.82Anion/Bicarbonate TranSporter family [Source:UniP... [more]
abts-30.000e+045.69Anion/Bicarbonate TranSporter family [Source:UniP... [more]
abts-30.000e+045.69Anion/Bicarbonate TranSporter family [Source:UniP... [more]
back to top
BLAST of slc4a-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG81772.082e-4426.67gene:FBgn0036043 transcript:FBtr0076326[more]
CG81772.292e-4426.67gene:FBgn0036043 transcript:FBtr0076322[more]
CG81773.288e-4426.67gene:FBgn0036043 transcript:FBtr0076327[more]
CG81773.437e-4426.67gene:FBgn0036043 transcript:FBtr0076325[more]
CG81773.437e-4426.67gene:FBgn0036043 transcript:FBtr0076324[more]
back to top
BLAST of slc4a-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a111.119e-15338.93solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
slc4a111.119e-15338.93solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
slc4a112.409e-15339.58solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
slc4a112.409e-15339.58solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
slc4a119.330e-15339.58solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc4a-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC4A114.185e-16341.02solute carrier family 4 member 11 [Source:NCBI gen... [more]
SLC4A117.905e-16341.02solute carrier family 4 member 11 [Source:NCBI gen... [more]
SLC4A113.473e-15641.35solute carrier family 4 member 11 [Source:NCBI gen... [more]
SLC4A113.465e-15240.88solute carrier family 4 member 11 [Source:NCBI gen... [more]
SLC4A111.273e-14440.34solute carrier family 4 member 11 [Source:NCBI gen... [more]
back to top
BLAST of slc4a-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc4a115.372e-17343.56solute carrier family 4, sodium bicarbonate transp... [more]
Slc4a18.768e-4929.85solute carrier family 4 (anion exchanger), member ... [more]
Slc4a21.161e-4327.22solute carrier family 4 (anion exchanger), member ... [more]
Slc4a21.163e-4327.22solute carrier family 4 (anion exchanger), member ... [more]
Slc4a21.905e-4327.22solute carrier family 4 (anion exchanger), member ... [more]
back to top
BLAST of slc4a-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NBS3|S4A11_HUMAN1.533e-18042.80Sodium bicarbonate transporter-like protein 11 OS=... [more]
sp|A2AJN7|S4A11_MOUSE3.758e-17243.56Sodium bicarbonate transporter-like protein 11 OS=... [more]
sp|P15575|B3AT_CHICK3.945e-5125.71Band 3 anion transport protein OS=Gallus gallus OX... [more]
sp|P02730|B3AT_HUMAN3.020e-4928.79Band 3 anion transport protein OS=Homo sapiens OX=... [more]
sp|P04919|B3AT_MOUSE6.133e-4829.85Band 3 anion transport protein OS=Mus musculus OX=... [more]
back to top
BLAST of slc4a-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YEW70.000e+0100.00Slc4a-4 OS=Schmidtea mediterranea OX=79327 GN=slc4... [more]
A0A0H3YK000.000e+054.99Slc4a-8 OS=Schmidtea mediterranea OX=79327 GN=slc4... [more]
A0A267H8X40.000e+055.05Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G7Q10.000e+055.69Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H2A60.000e+055.76Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of slc4a-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000011908.22.703e-16141.10pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000047690.18.589e-15741.18pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
slc4a112.846e-15139.06solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
slc4a2b1.583e-5328.12anion exchange protein 2-like [Source:NCBI gene;Ac... [more]
slc4a2b1.944e-5228.14anion exchange protein 2-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of slc4a-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a113.132e-17842.35solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
SLC4A21.312e-4727.15solute carrier family 4 member 2 [Source:HGNC Symb... [more]
SLC4A21.843e-4327.79solute carrier family 4 member 2 [Source:HGNC Symb... [more]
slc4a71.191e-4227.72solute carrier family 4 member 7 [Source:ZFIN;Acc:... [more]
SLC4A45.114e-3228.67solute carrier family 4 member 4 [Source:HGNC Symb... [more]
back to top
BLAST of slc4a-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BOR11.653e-3927.02Boron efflux transporter of the plasma membrane; b... [more]
back to top
BLAST of slc4a-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO406101.970e-9660.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406111.237e-7240.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458441.622e-5328.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317938.703e-4227.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO270891.323e-1130.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc4a-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a111.306e-16938.42solute carrier family 4 member 11 [Source:NCBI gen... [more]
slc4a111.400e-16940.03solute carrier family 4 member 11 [Source:NCBI gen... [more]
slc4a114.321e-16639.60solute carrier family 4 member 11 [Source:NCBI gen... [more]
SLC4A111.266e-14340.20sodium bicarbonate transporter-like protein 11 [So... [more]
slc4a32.848e-5126.26solute carrier family 4 member 3 [Source:NCBI gene... [more]
back to top
BLAST of slc4a-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039045.10.000e+0100.00SMESG000039045.1[more]
SMESG000039045.10.000e+098.85SMESG000039045.1[more]
SMESG000009949.10.000e+054.99SMESG000009949.1[more]
SMESG000061700.10.000e+053.22SMESG000061700.1[more]
SMESG000012150.16.869e-17943.17SMESG000012150.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30003166
GenBankAKN21410.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003166 ID=SMED30003166|Name=slc4a-4|organism=Schmidtea mediterranea sexual|type=transcript|length=3234bp
ATTTCATTCACCAATGAATGGCTTAAAAATGTCTCAAATTATGATTTGTT
ATTGTGATTTACGAGAACTGCTTTTGTTTTAATGTATTCGGGGGATTTGT
CGCGGGAAATCAGCTATTTTCAATAATTACTGATCTGAATTGATTTTGGT
ATTTTTTCTTTTAATGAAACTCTGCCTGTAATAGGAATATTTTGTGGAGA
TTTTATTAGCAAACTCTCAAATTGCATGCTCAATAATTATTGAGAAATTA
ACGCATTTTTCTTGGGAGATCGTTTTCCAAATTAATTGATAAAAAATGAA
TAATTTGATGCCAACACAAAATTCCTTGAATCGAAGAAACTCGAGGTCCG
TCGACCATTTGAACATGATCAATTCCTATTCATCGAATGATAAATCAGTT
CCAAAGCTCGTTCTAACAAATTGTAACCAATCTCCGGCAATTGATAGAAC
AAATCGTAGGACAATATCTGGATTATATAATTTTAAGAAACAGTCAACAA
ATAACGACGACAAGGATTCGAAAGACAGAAATCTGTTGTTATCACCAACG
AATTACATTAATCGACAGATCTCGGAAACTTCGGAAATGAGCACTGATAC
TGTCAGCAACTTCAGCATAGGCAGTCTTGCTCGGTATTATAGAACTGCTG
ATGAGAATGGTGAAGGATTACCATGTTTGGTGCTTGCAAGATTAGAGAAA
ATTCCAATCAAAGACTTTTCATCAGAAGTACGGGCAACTTTAGATGTTGA
AAAGTTTCTCAAAGAGGTTGTACTTATTCTTGATATGGAAGCCAACGACG
TGGACACAATTGTGGAACATTTACTGAGAGAAATCTATCCCTTAGCAATG
GACGTTTCTATAGGTCAGATGGACACATTCATAACAGAAGCAAAAAATGC
ACTATTTATGAAGGCTCACTACGAAAATTTCTCATATCAGCGATTAGCTA
AAACGCTTAAAGGGATACTTATTAATGAAAATGAAGGTTTATCAACCGAT
CAATCTTGGATCAGTGCAATGTGCTCCTTGACTTGTGTACACAAAAGACA
CGTTGCCATTGCTCGCCTAAAAACTCCGGTAAACCTAGGTAGATCTAGCG
AAGGCGTTTACTTTGTAATGTTGGTCATTACTCCGAAAAAAGAGAAAGAC
ACGAAAAGCGATATTGAACTCAGTCGAACATTTGCCACTTTGCTATCAGA
CATGGAATTCCGATCTCAATTGTTGTTTGCTCAAACAGAAGATGAATTCA
AAGAAATGTTACAGAATCATGCGCGAGATTTAGCAGAAGAACAGCGACTC
TATCGGAGGCGTAGCATTCGAATTACGGAAGTGATGAATCAAGCCTTTGC
TTATGAAGAAAAATTTCCCTTGGGGAATGGAATAGTAGATGATCTTAGAA
AACGAATACCTGTCTATATATCAGACTATAAAGATGGAATTCAAGGCCCT
GGTACAATCAGAAAACTCGTGTCAGCTGCAACATTTCTTTATTTTGCTTG
TCTTTTACCCAGTATGGCTTTCGGTGTTCTATATGATCAAAATACTGATG
GAAAAATAAATGTAAAAAGAGTAATTCTTTCACAAACAGTCGGTGGTTTG
TGTTTTGCATTAATTGGAGGACAACCTTTGATTGTCATGCTCACAACTGC
TCCTTTAACATTATATATTAAAGTCATTTATGCAATATCTGCGAAATATT
CGCTGCATTTCTATACGATGTTTTCCTGGGTTGGGATTTTTAACTCTATT
TTTCTGATTCTCTATTCGTTGCTAGATCTTAGTAAATTAATGCGATGGTC
AACCAGATCAACAGAAGAAATATTTGCATTATTTATATCCATTGCATTTA
TAGTTGATGCTGTAAAGGACGTTTTAAAAGTTTTCTATAAAAGTTATGTG
ACAACTTTAGTAAACAAAACTGTTCCCATTGTCAATACAACTTTAGCCAA
AGGTTTGCTCAACTCTACAAATGAATTCATTACAATAACAACTGAAGAAT
CACGTAAAGAAAATGGTCTTCTGTTTTTATTGCTTTTAATTGGTACAGTT
TGGCTTGGAATATACTTTCTCAATTTTACTAAAACGCCTTTTCTCAATTC
GTCCAAGAGATTACTAATGGCGGATTATTCCCTACCTCTTGCAGTCCTAA
TTATGTCATTTATTGGTTCTTATTTGTTCAAGGATATTAAAATCGATACT
TTCAAAACTAGAAGTGAAGAAGAGTTTTCAATAAAATTTGTTAATTTTAG
TCAGATCAGTATTAGTGCTGTATTTGCAGCCCTCGGACTAGCCTTTCCAT
TGTCACTTCTCTTCTTTATGGATCAAAATGTAACAAGTGCTATGGTGAAT
TGTCCATCAAATAAATTGAAAAAAGGTTCAGCTTACCATTGGGATCTCCT
AATCGTAGCAATCATAAATTTAGTATTGTCATTGTTCGGATTGCCATGGG
TCCATGGCACTTTGCCACATTCCCCACTTCACGTCAAAGCCTTAGCAGAT
TTAGAAGAACGGATTGATTCCGGACATCGGATTTATGAAACAATCGTAAA
AGTCCGTGAGACTCGATTGACTGGTTTGATATCTCACATATTAATCGGTT
TATCTCTGTTATTATTACCCATACCGTTGATTTACGTGCCAATAGCAGTT
CTTGATGGCCTTTTTGTTTATATGGCCATAACTGCTCTCTATGGAAATCA
ACTTGTTGAAAGAGTTATTTTGCTTTTTACCGAGCAGGCAGCTTATCCCC
CGTCTCATTATCTAAGGAGAGTTCCTCAGAGAAAAGTTCATTTGTTCACA
GTACTTCAATTGACTCAATTAGGACTGCTTTGTGCATTGGGATTTGCTCC
AACTCCATATGCGAAAATAGGCTTTCCAATTTTACTTTTATTGCAGATGC
CTATCAGGCATTGGATTTTTCCGAAATTCATCTCGTTGACTTACATCGAT
GCCCTTGACAAACCCATCTGACGCTGTGAAATGAAGATTTAGATTCAACA
GAAACGAACCAGCGAGATGTCATATTTTTCTAAACATCTTTAATTCTTTA
AAAGTGCTAGACTCATTGCTACGTATTGGAAATGAATATCATGTAGATTT
ATTTCGCTAGAATATTCATCTGTTTTTTGCACAGCATAGTCGTTTTGGAT
TTTAATAGTTATTATTTTTGGGAAAAGACAAAACTTTTCTAAATGTCAAA
TGCTTTGATTAGATTTTCTAATATTTTTTAGACC
back to top

protein sequence of SMED30003166-orf-1

>SMED30003166-orf-1 ID=SMED30003166-orf-1|Name=SMED30003166-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=892bp
MNNLMPTQNSLNRRNSRSVDHLNMINSYSSNDKSVPKLVLTNCNQSPAID
RTNRRTISGLYNFKKQSTNNDDKDSKDRNLLLSPTNYINRQISETSEMST
DTVSNFSIGSLARYYRTADENGEGLPCLVLARLEKIPIKDFSSEVRATLD
VEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAK
NALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHK
RHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLL
SDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQA
FAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYF
ACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLT
TAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNSIFLILYSLLDLSKLMR
WSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTL
AKGLLNSTNEFITITTEESRKENGLLFLLLLIGTVWLGIYFLNFTKTPFL
NSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVN
FSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWD
LLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETI
VKVRETRLTGLISHILIGLSLLLLPIPLIYVPIAVLDGLFVYMAITALYG
NQLVERVILLFTEQAAYPPSHYLRRVPQRKVHLFTVLQLTQLGLLCALGF
APTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDKPI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR013809ENTH
IPR003020HCO3_transpt_euk
IPR002178PTS_EIIA_type-2_dom
IPR011531HCO3_transpt_C
IPR016152PTrfase/Anion_transptr
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006820anion transport
GO:0006810transport
GO:0015698inorganic anion transport
Vocabulary: molecular function
TermDefinition
GO:0005452inorganic anion exchanger activity
GO:0005215transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003020Bicarbonate transporter, eukaryoticPRINTSPR01231HCO3TRNSPORTcoord: 496..508
score: 45.88
coord: 671..680
score: 44.64
coord: 406..417
score: 33.33
coord: 685..698
score: 45.92
coord: 610..619
score: 36.07
coord: 517..529
score: 29.12
IPR003020Bicarbonate transporter, eukaryoticPANTHERPTHR11453ANION EXCHANGE PROTEINcoord: 131..889
IPR011531Bicarbonate transporter, C-terminalPFAMPF00955HCO3_cotranspcoord: 359..836
e-value: 6.7E-151
score: 503.6
IPR016152Phosphotransferase/anion transporterGENE3DG3DSA:3.40.930.10coord: 242..325
e-value: 2.7E-6
score: 29.2
IPR016152Phosphotransferase/anion transporterSUPERFAMILYSSF55804Phoshotransferase/anion transport proteincoord: 148..324
NoneNo IPR availableGENE3DG3DSA:1.10.287.570coord: 369..415
e-value: 4.8E-8
score: 34.6
NoneNo IPR availablePANTHERPTHR11453:SF92SOLUTE CARRIER FAMILY 4 MEMBER 11coord: 131..889
NoneNo IPR availableTMHMMTMhelixcoord: 761..783
NoneNo IPR availableTMHMMTMhelixcoord: 391..413
NoneNo IPR availableTMHMMTMhelixcoord: 434..456
NoneNo IPR availableTMHMMTMhelixcoord: 858..875
NoneNo IPR availableTMHMMTMhelixcoord: 788..810
NoneNo IPR availableTMHMMTMhelixcoord: 696..718
NoneNo IPR availableTMHMMTMhelixcoord: 831..853
NoneNo IPR availableTMHMMTMhelixcoord: 606..628
NoneNo IPR availableTMHMMTMhelixcoord: 574..591
NoneNo IPR availableTMHMMTMhelixcoord: 654..676
NoneNo IPR availableTMHMMTMhelixcoord: 471..493
IPR002178PTS EIIA type-2 domainPFAMPF00359PTS_EIIA_2coord: 247..324
e-value: 4.9E-6
score: 26.5
IPR002178PTS EIIA type-2 domainPROSITEPS51094PTS_EIIA_TYPE_2coord: 174..325
score: 10.039