Chromatin assembly factor 1 subunit B

Overview
NameChromatin assembly factor 1 subunit B
Smed IDSMED30003162
Length (bp)1598
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chromatin assembly factor 1 subunit B (SMED30003162) t-SNE clustered cells

Violin plots show distribution of expression levels for Chromatin assembly factor 1 subunit B (SMED30003162) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chromatin assembly factor 1 subunit B (SMED30003162) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chromatin assembly factor 1 subunit B (SMED30003162) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003162

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30003162h1SMcG0015752 SmedASXL_013663SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30003162h1SMcG0015752 SmedASXL_013663SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30003162h1SMcG0015752 dd_Smed_v4_5543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003162h1SMcG0015752 dd_Smed_v4_5543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003162h1SMcG0015752 dd_Smed_v4_5543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30003162h1SMcG0015752 dd_Smed_v4_5543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Human
Match: CHAF1B (chromatin assembly factor 1 subunit B [Source:HGNC Symbol;Acc:HGNC:1911])

HSP 1 Score: 309.301 bits (791), Expect = 4.988e-98
Identity = 168/398 (42.21%), Postives = 234/398 (58.79%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFI-RLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKI-----DDDDVNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWK-------SGDS---KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKN--KSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELG 1158
            MK+IT  + +HN EP+Y+ D Q  T   I RLA+ G D +VR+WK   V  G      VEF++NL RH K VNVVR+SP+G +LAS  DD +I+LW  +    P++I     D+  +N E+W+  ++LR H  DVYDICW+ + N + S SVD  AI+WD+    K+ I  +HK +VQGVTWDPL   V T S DR +RVY    +   + V K        G++   ++F D S K FFRRL F+PDG LL+TPAG  E  +NV           +N T   ++F R NL +    +P    A + VR  PV F L+   ++      LPYR +F +  ++ VL+YDT+Q  P   + +IHY +++D SW+ DG  L ++STDGYCSF+ FEK ELG
Sbjct:    1 MKVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWK---VEKGPDGKAIVEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWKVNDNKEPEQIAFQDEDEAQLNKENWTVVKTLRGHLEDVYDICWATDGNLMASASVDNTAIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYVATLSCDRVLRVYSIQKKRVAFNVSKMLSGIGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENV-----------MNTT---YVFSRKNLKRPIAHLPCPGKATLAVRCCPVYFELRPVVETGVELMSLPYRLVFAVASEDSVLLYDTQQSFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCSFVTFEKDELG 381          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Human
Match: HIRA (histone cell cycle regulator [Source:HGNC Symbol;Acc:HGNC:4916])

HSP 1 Score: 147.517 bits (371), Expect = 6.509e-37
Identity = 118/388 (30.41%), Postives = 182/388 (46.91%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCV--HNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDD---VNLESWSPRS-LRRHFLDVYDICWSLNENHLISGSVDCCAILWD-LKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSAF-KLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGE 1161
            MKL+ P  V HN +PI++ DI      F     G     V +W +  V   +  KD    + +  ++ H   VN VRWS SG  LAS  DD +I++W ++    P  +        N+E W   S LR H  DV D+ WS ++  L S SVD   ++W+ +K    +  L+ H   V+G+TWDP+   + +Q+ DR+++V+    RT  +++ ++  +K F +        RL +SPDG  LV+             A+ +  S P      A I  R    K  +     + AV  V+FNP  F  K K+  SA    PY        D  + ++ T    P+V I ++   SI D SW  +G  + V S DG  +F+ F + ELG+
Sbjct:    1 MKLLKPTWVNHNGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMSPVLQEDDEKDENIPKMLCQMDNHLACVNCVRWSNSGMYLASGGDDKLIMVWKRATYIGPSTVFGSSGKLANVEQWRCVSILRNHSGDVMDVAWSPHDAWLASCSVDNTVVIWNAVKFPEILATLRGHSGLVKGLTWDPVGKYIASQADDRSLKVW----RTLDWQL-ETSITKPFDECGGTTHVLRLSWSPDGHYLVS-------------AHAMNNSGPT-----AQIIEREGW-KTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSSAKPSCPYCCCAVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAFLDFSQDELGD 364          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Human
Match: HIRA (histone cell cycle regulator [Source:HGNC Symbol;Acc:HGNC:4916])

HSP 1 Score: 146.362 bits (368), Expect = 1.732e-36
Identity = 118/388 (30.41%), Postives = 182/388 (46.91%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCV--HNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDD---VNLESWSPRS-LRRHFLDVYDICWSLNENHLISGSVDCCAILWD-LKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSAF-KLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGE 1161
            MKL+ P  V HN +PI++ DI      F     G     V +W +  V   +  KD    + +  ++ H   VN VRWS SG  LAS  DD +I++W ++    P  +        N+E W   S LR H  DV D+ WS ++  L S SVD   ++W+ +K    +  L+ H   V+G+TWDP+   + +Q+ DR+++V+    RT  +++ ++  +K F +        RL +SPDG  LV+             A+ +  S P      A I  R    K  +     + AV  V+FNP  F  K K+  SA    PY        D  + ++ T    P+V I ++   SI D SW  +G  + V S DG  +F+ F + ELG+
Sbjct:    1 MKLLKPTWVNHNGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMSPVLQEDDEKDENIPKMLCQMDNHLACVNCVRWSNSGMYLASGGDDKLIMVWKRATYIGPSTVFGSSGKLANVEQWRCVSILRNHSGDVMDVAWSPHDAWLASCSVDNTVVIWNAVKFPEILATLRGHSGLVKGLTWDPVGKYIASQADDRSLKVW----RTLDWQL-ETSITKPFDECGGTTHVLRLSWSPDGHYLVS-------------AHAMNNSGPT-----AQIIEREGW-KTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSSAKPSCPYCCCAVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAFLDFSQDELGD 364          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Human
Match: WDR5B (WD repeat domain 5B [Source:HGNC Symbol;Acc:HGNC:17826])

HSP 1 Score: 69.707 bits (169), Expect = 2.760e-12
Identity = 41/136 (30.15%), Postives = 73/136 (53.68%), Query Frame = 1
Query:  220 HEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCI 627
            H + V+ V++SP+G  LAS+S D +II+W     A   K +           ++L  H L++ D+ WS + + L+S S D    LWD+++   +  LK H  +V    ++P  N++I+ S D T++++   T  C+
Sbjct:   40 HTEAVSSVKFSPNGEWLASSSADRLIIIWG----AYDGKYE-----------KTLYGHNLEISDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCL 160          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Human
Match: NLE1 (notchless homolog 1 [Source:HGNC Symbol;Acc:HGNC:19889])

HSP 1 Score: 65.0846 bits (157), Expect = 1.644e-11
Identity = 50/169 (29.59%), Postives = 68/169 (40.24%), Query Frame = 1
Query:  109 RLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNR---HEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYR 606
            RL +G  D ++ LW             P E    L R   H+  +N V +SP   ++ASAS D  I LW                        SLR H   VY I WS +   L+SGS D    +WD+K     + L  H   V  V W P    V +   D+ +R++R
Sbjct:   51 RLVSGSDDFTLFLWS------------PAEDKKPLTRMTGHQALINQVLFSPDSRIVASASFDKSIKLWDGRTGKYLA---------------SLRGHVAAVYQIAWSADSRLLVSGSSDSTLKVWDVKAQKLAMDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIWR 192          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Celegans
Match: chaf-2 (CHromatin Assembly Factor [Source:UniProtKB/TrEMBL;Acc:Q95XL8])

HSP 1 Score: 154.066 bits (388), Expect = 7.736e-41
Identity = 120/417 (28.78%), Postives = 187/417 (44.84%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKT-DDFIRLATGGFDCSVRLWK------LHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGN--VLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKS------------GD-------SKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLS--KVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYTLVGP 1182
            M    P + +H+ + + + D+  +T +   RLAT      VR+W+      L      NK  L V F+ANL  H   +N V++SPS    +LAS   +G I +W  S + VP   D+   N E+W    +  H  DV  +CW  +   L S S D    + D     ++ +  + +    GV WDP    + T S DR M +  A  R    K + S            GD        KLF D     F R L FSP+G+ +  P    E       ++D+Y +         + F R +L   +   T          V+F+PV FSL   + ++   LPYR ++  +  + +  YD++   PV  + +IH  ++TDAS++ DG  L V+S +G+CSF+     + GEV T + P
Sbjct:    1 MDHFMPIIYWHDRKGLLSVDLHHETRNGKYRLATASVQKEVRVWEFEFEMGLDPKTQENKPQLTVGFLANLVFHNHAINQVKFSPSKEHELLASGDCEGRITIWKLSDQPVPPPQDEMPSNKENWIRYKVLNHNSDVNALCWDPSGTQLASVSNDHTLAVHDALTGKRLFVASNFRS-PNGVCWDPSGKYIATMSPDRKMDLIDA-VRGARLKHFSSALLPSMTIPSANGDLHLETKIHKLFHDDQLFSFQRALGFSPNGEFIAAPCAHLELG-----SSDLYGT---------YFFRREDLGVKEAPYTFYPAPRPTFLVKFSPVTFSLLPSTKENHLGLPYRLLWIALNKDAIYFYDSQHSYPVAVVDNIHLNALTDASFSHDGRVLVVSSLEGFCSFVKINLTQWGEVMTEIVP 401          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Celegans
Match: chaf-2 (CHromatin Assembly Factor [Source:UniProtKB/TrEMBL;Acc:Q95XL8])

HSP 1 Score: 150.214 bits (378), Expect = 2.088e-39
Identity = 120/419 (28.64%), Postives = 188/419 (44.87%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKT-DDFIRLATGGF--DCSVRLWK------LHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGN--VLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKS------------GD-------SKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLS--KVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYTLVGP 1182
            M    P + +H+ + + + D+  +T +   RLAT     +  VR+W+      L      NK  L V F+ANL  H   +N V++SPS    +LAS   +G I +W  S + VP   D+   N E+W    +  H  DV  +CW  +   L S S D    + D     ++ +  + +    GV WDP    + T S DR M +  A  R    K + S            GD        KLF D     F R L FSP+G+ +  P    E       ++D+Y +         + F R +L   +   T          V+F+PV FSL   + ++   LPYR ++  +  + +  YD++   PV  + +IH  ++TDAS++ DG  L V+S +G+CSF+     + GEV T + P
Sbjct:    1 MDHFMPIIYWHDRKGLLSVDLHHETRNGKYRLATASVQKEVRVRVWEFEFEMGLDPKTQENKPQLTVGFLANLVFHNHAINQVKFSPSKEHELLASGDCEGRITIWKLSDQPVPPPQDEMPSNKENWIRYKVLNHNSDVNALCWDPSGTQLASVSNDHTLAVHDALTGKRLFVASNFRS-PNGVCWDPSGKYIATMSPDRKMDLIDA-VRGARLKHFSSALLPSMTIPSANGDLHLETKIHKLFHDDQLFSFQRALGFSPNGEFIAAPCAHLELG-----SSDLYGT---------YFFRREDLGVKEAPYTFYPAPRPTFLVKFSPVTFSLLPSTKENHLGLPYRLLWIALNKDAIYFYDSQHSYPVAVVDNIHLNALTDASFSHDGRVLVVSSLEGFCSFVKINLTQWGEVMTEIVP 403          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Celegans
Match: hira-1 (pep chromosome:WBcel235:III:5191131:5196028:1 gene:WBGene00019627.1 transcript:K10D2.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:hira-1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.044e-16
Identity = 78/325 (24.00%), Postives = 135/325 (41.54%), Query Frame = 1
Query:  223 EKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVP-----QKIDDDDVNLESWSPRS-LRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKN-TNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVE--EANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYT 1170
            + + N  RWSP G   A  SDD  + +W    E V        I     N+E +     LR H ++V  + WS N  +L SGS+D   I+++ +   +++ +L D +  V+G++WDP+   + +   D+ +R +   +  C+  V     ++ F+    +    RL++SPDGK L+TPA     K  ++  +     +   +   H     VR     +   +  GK           R  L   +  S  K    W+F   L             P+  I +I   ++ D +W   G  L   S DG    I+  +  +GE+ +
Sbjct:   74 QSQSNSCRWSPDGKRFAFGSDDSSVSVW----EYVGLINSMGSITGGAQNVERYKECCVLRGHSMEVLTVEWSPNGKYLASGSIDYRIIIYNARKLPDRITVLNDIQLPVKGLSWDPIGKYLASLEGDKKLRFWATDSWQCVKSV-----TEPFESNIEETMLTRLDWSPDGKYLMTPAAVRSGKPLIKLIQRQTWKSDQFLAGHHKGTTCVRAMPRLIEANLKNGK-----------RMQLTCAAVGSRDKSISIWVFPGTLK------------PLFVINNIFNHTVMDFAWC--GRNLLACSQDGTVKVIHLSESVIGEMIS 364          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Celegans
Match: W07E6.2 (pep chromosome:WBcel235:II:480722:483104:-1 gene:WBGene00021074.1 transcript:W07E6.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07E6.2)

HSP 1 Score: 55.0694 bits (131), Expect = 4.795e-9
Identity = 41/142 (28.87%), Postives = 61/142 (42.96%), Query Frame = 1
Query:  190 PVEFVANLNR---HEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYR 606
            P E   ++NR   H + VN V +SP    +ASAS D  + LW                        SLR H   VY + WS +   L+SGS D    +++LK  +    L  H   V  V W P    V++   D+ ++++R
Sbjct:    4 PKETKQSINRMTGHMQLVNQVVFSPDTRYIASASFDKSVKLWCGRTGKYLA---------------SLRGHVGPVYQVAWSADSRLLVSGSADSTLKVFELKTKSLYYDLPGHGDEVFTVDWSPEGTKVVSGGKDKVLKLWR 130          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Celegans
Match: W07E6.2 (pep chromosome:WBcel235:II:480722:484386:-1 gene:WBGene00021074.1 transcript:W07E6.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07E6.2)

HSP 1 Score: 56.9954 bits (136), Expect = 2.141e-8
Identity = 48/190 (25.26%), Postives = 80/190 (42.11%), Query Frame = 1
Query:   61 EPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCVHNGNKDFL-----PVEFVANLNR---HEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYR 606
            EP   C      ++  ++A   ++ ++ +     + +G+ DF      P E   ++NR   H + VN V +SP    +ASAS D  + LW                        SLR H   VY + WS +   L+SGS D    +++LK  +    L  H   V  V W P    V++   D+ ++++R
Sbjct:  298 EPSKRCIKPDTVEECQKVAQTRYEAALEIAGGERLVSGSDDFTLFMWNPKETKQSINRMTGHMQLVNQVVFSPDTRYIASASFDKSVKLWCGRTGKYLA---------------SLRGHVGPVYQVAWSADSRLLVSGSADSTLKVFELKTKSLYYDLPGHGDEVFTVDWSPEGTKVVSGGKDKVLKLWR 472          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Fly
Match: Caf1-105 (gene:FBgn0033526 transcript:FBtr0088310)

HSP 1 Score: 288.886 bits (738), Expect = 1.038e-88
Identity = 157/414 (37.92%), Postives = 234/414 (56.52%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQT-----KTDDFIRLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNL-----------ESW-SPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWK-----------SGDS-KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQS---AFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVY 1167
            MK   P + +HN +P+ + DIQ      ++    RLA+GG D  V +W ++   + + + + VE  A+L+RH++ VN VRWSP+G +LAS  D+ ++ +W        QK D + VN+           E W + + LR H  D+YD+ W+ N   L+SGSVD  A+LWD+ +   + IL DHK +VQGV WDP +  + T S+DR MR++ A+T+  +++V K            G S +L+QDG+ + FFRRL F+PDGKLL+TP+G  +    V+  N  Y             F RH+LSK A  +P  K   + VR +PV + L+  +++       LPYR I+ +   N V  YDT+Q +P   + +IHY  +TD +W+ DG  L V+STDGYCS I FE  ELG+ Y
Sbjct:    1 MKCKIPEISWHNRDPVLSVDIQQNGLGLRSPTICRLASGGSDAHVLIWYVN--RSDDAEGVDVELAADLSRHQRAVNAVRWSPNGELLASGDDESVVFIWK-------QKADHEVVNIVDADGCSEQDKEVWLTLKVLRGHREDIYDLSWAPNSQFLVSGSVDNTAMLWDVHSGKSLAILDDHKGYVQGVAWDPCNQYIATMSTDRQMRIFDANTKRVLHRVSKCVLPVKEDHEMHGKSMRLYQDGTLQTFFRRLCFTPDGKLLLTPSGITDYDGVVKPINTSYG------------FSRHDLSKPAFVLPFPKEYAVAVRCSPVLYRLRPYNAEKNPPIISLPYRMIYAVATKNAVFFYDTQQPVPFAIVSNIHYSRLTDLAWSSDGTVLIVSSTDGYCSLITFEPTELGDCY 393          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Fly
Match: Hira (gene:FBgn0022786 transcript:FBtr0071070)

HSP 1 Score: 140.969 bits (354), Expect = 5.217e-35
Identity = 115/392 (29.34%), Postives = 183/392 (46.68%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGG--FDCS-VRLWKLHCVHNGNKDF---LPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQ-KIDDDDVNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKN-TNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYT 1170
            M+L+ P  V+H+ + I++ DI     D  + ATGG   DC  V +W L  V +   +F   +P + +  +++H   VN VRWS +G  LAS SDD +I++W KS  +           N ESW    +LR H  DV D+ WS N+ +L S S+D   I+WD +   + V  LK H   V+GV+WDPL   + +QS DR+++++     +  + +     ++ F++        RL +SPDG+ LV+             A+ +    P      A I  R    K        + AV  VRF+    S +      +  L Y  +     D  + ++ T    P+V I ++   SI D +W P    L   S DG  + + F + ELG+  +
Sbjct:    1 MRLLKPAWVHHDDKQIFSVDIH---KDCTKFATGGQGSDCGRVVIWNLLPVLSDKAEFDADVP-KMLCQMDQHLACVNCVRWSQNGQNLASGSDDKLIMIWRKSAGSSGVFGTGGMQKNHESWKCFYTLRGHDGDVLDLAWSPNDVYLASCSIDNTVIIWDAQAFPHSVATLKGHTGLVKGVSWDPLGRFLASQSDDRSIKIWNTMNWSLSHTI-----TEPFEECGGTTHILRLSWSPDGQYLVS-------------AHAMNGGGPT-----AQIIEREGW-KCDKDFVGHRKAVTCVRFHNSILSRQENDGSPSKPLQYCCLAVGSRDRSLSVWMTALQRPMVVIHELFNASILDLTWGPQECLLMACSVDGSIACLKFTEEELGKAIS 364          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 68.1662 bits (165), Expect = 5.298e-12
Identity = 46/174 (26.44%), Postives = 80/174 (45.98%), Query Frame = 1
Query:  211 LNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVT 732
            L  H K V+ V++SP+G  LAS+S D +I +W              D   E    +++  H L + D+ WS +   L+SGS D    +W+L     +  LK H  +V    ++P  N++++ S D ++R++   T  C+  +    D               + F+ DG L+V+
Sbjct:   68 LAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAY-----------DGKFE----KTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDP-----------VSAVHFNRDGSLIVS 215          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0070438)

HSP 1 Score: 68.1662 bits (165), Expect = 5.298e-12
Identity = 46/174 (26.44%), Postives = 80/174 (45.98%), Query Frame = 1
Query:  211 LNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVT 732
            L  H K V+ V++SP+G  LAS+S D +I +W              D   E    +++  H L + D+ WS +   L+SGS D    +W+L     +  LK H  +V    ++P  N++++ S D ++R++   T  C+  +    D               + F+ DG L+V+
Sbjct:   68 LAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAY-----------DGKFE----KTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDP-----------VSAVHFNRDGSLIVS 215          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Fly
Match: CG1671 (gene:FBgn0033454 transcript:FBtr0088373)

HSP 1 Score: 62.7734 bits (151), Expect = 5.332e-10
Identity = 60/213 (28.17%), Postives = 96/213 (45.07%), Query Frame = 1
Query:  112 LATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNV-LASASDDGIIILW--TKSKEAVPQKIDDDDVNLESWSPR-SLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPA 738
            L + G DCSVRLW+L      +KD          N H   +  V  + +G    AS S DG + +W   +SKE         D N  S++ R +   H  +V  + ++ N   + + S D  A +W  ++     +L+ H + V  V + P+D +V+T SSD T+R++  S  +CI         K F     +    R EF   GK +++ A
Sbjct:  393 LISVGKDCSVRLWRLQ----HDKDCSLEALTQQANCHTSTIGCVAMTHNGATGFASVSQDGSMKVWQLVRSKE---------DRNSYSFNLRYAALSHDKEVNCVAYAPNNKLIATASQDKTAKVWLAESNTLQGVLRGHTRGVWSVRFSPVDQIVLTSSSDCTLRIWSISNFSCI---------KRFDQ---ECTILRAEFLDHGKFIISAA 580          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Zebrafish
Match: chaf1b (chromatin assembly factor 1, subunit B [Source:ZFIN;Acc:ZDB-GENE-040426-1947])

HSP 1 Score: 317.005 bits (811), Expect = 1.260e-100
Identity = 179/473 (37.84%), Postives = 253/473 (53.49%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFI-RLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILW----TKSKEAVP--QKIDDDDVNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDS----------KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQ--------SAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYTLVGPQSMKNPLKTIENTVESDDSKSDAIYNLKMNLPMLQLDPTEILRVSNQENIASDSDTDNCS 1362
            MK++T  + +HN EP+Y+ D Q   D    RLAT G D +VR+W+   V  G      VEF++NL RH K VNVVR+SP+  VLAS  DD  I+LW     K  E  P  Q+ +D  +N ESWS  ++LR H  DVYDI W+ + N + SGSVD  AI+WD+    K+ I  DHK +VQGV WDPL   + T S DR MRVY A  R   Y + K   S          ++F D S + FFRRL F+PDG  L+ PAG  E  +NV              T+  ++F R +  +    +P    A + VR +PV F L+ K ++        + F LPYR +F +  ++ +  YDT+Q LP   + +IHY +++D SW+ DG  L V+STDGYCSFI F++GELG       P   K PL+ +  +  ++     A+ N +   P+ +   T   +   +E  A  + +   S
Sbjct:    1 MKVVTCEIAWHNKEPVYSLDFQQSGDGKTQRLATAGVDTTVRMWR---VDKGPDGKAVVEFLSNLARHTKAVNVVRFSPTAEVLASGGDDAAILLWKLNDNKEPEQTPTFQEEEDAQLNKESWSVVKTLRGHIEDVYDISWTSDGNFMASGSVDNTAIMWDVNKGQKMCIFNDHKSYVQGVAWDPLGQYISTLSCDRVMRVYSAHNRKKAYSISKMTSSATADGEVKNYRMFHDDSMRSFFRRLTFTPDGSFLLAPAGCVEAGENV--------------TNTTYVFSRKSFKRPIAHLPCPSKATLAVRCSPVYFELRTKRAEDDSLKPVANTFNLPYRLVFAVASEDSIFFYDTQQTLPFGYVSNIHYHTLSDLSWSRDGSFLAVSSTDGYCSFISFDEGELGT------PLKEKPPLEMVTPSSTNEKKGKRALANGRTASPVPRQANTPAAQDKEKEGSAGPASSKTSS 450          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Zebrafish
Match: hira (histone cell cycle regulator a [Source:ZFIN;Acc:ZDB-GENE-030131-6296])

HSP 1 Score: 142.895 bits (359), Expect = 1.602e-35
Identity = 113/389 (29.05%), Postives = 183/389 (47.04%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCV---HNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKI---DDDDVNLESWSPRS-LRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVII-LKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNK-SSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGE 1161
            MKL+ P  V HN +PI++ DI      F     G     V +W +  V    +   + +P + +  ++ H   VN VRWS +G  LAS  DD ++++W ++    P  +        N+E W   + LR H  DV D+ WS ++  L S SVD   ++W+ +   ++++ LK H   V+G+TWDP+   + +Q+ D +++V+    RT  +++ ++  +K F +        RL +SPDG+ LV+             A+ +  S P      A I  R    K  +     + AV  V+FNP  F  K K  S      PY        D  + ++ T    P+V I D+   SI D +W  +G  L V S DG  +F+ F + ELG+
Sbjct:    1 MKLLKPSWVNHNGKPIFSVDIHPDGTKFATGGQGEDSGKVVIWNMAPVLREEDEKNENIP-KLLCQMDNHLACVNCVRWSNNGLYLASGGDDKLVMVWKRAAFIGPSTVFGSSSKLANVEQWRCVTILRNHTGDVMDVAWSPHDVWLASCSVDNTIVIWNARKFPEIVMTLKGHTGLVKGLTWDPVGKYIASQADDHSLKVW----RTMDWQL-ETNITKPFSECGGTTHVLRLSWSPDGQYLVS-------------AHAMNNSGPT-----AQIIERDGW-KTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSTPKPSCPYCCCAVGSKDRSLSVWLTSLKRPLVVIHDLFDKSIMDITWTLNGLGLLVCSMDGTVAFLDFSQDELGD 364          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 68.9366 bits (167), Expect = 4.821e-13
Identity = 41/139 (29.50%), Postives = 71/139 (51.08%), Query Frame = 1
Query:  211 LNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCI 627
            L  H K V+ V++SPSG  LAS+S D +I +W     A   K +           +++  H L + D+ WS + N L+S S D    +WD+ +   +  LK H  +V    ++P  N++++ S D ++R++   T  C+
Sbjct:   41 LAGHTKAVSSVKFSPSGEWLASSSADKLIKIWG----AYDGKFE-----------KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCL 164          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 68.5514 bits (166), Expect = 4.184e-12
Identity = 47/176 (26.70%), Postives = 83/176 (47.16%), Query Frame = 1
Query:  211 LNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPA 738
            L  H K V+ V++SPSG  LAS+S D +I +W     A   K +           +++  H L + D+ WS + N L+S S D    +WD+ +   +  LK H  +V    ++P  N++++ S D ++R++   T  C+  +    D               + F+ DG L+V+ +
Sbjct:   41 LAGHTKAVSSVKFSPSGEWLASSSADKLIKIWG----AYDGKFE-----------KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDP-----------VSAVHFNRDGSLIVSSS 190          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Zebrafish
Match: nle1 (notchless homolog 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050522-321])

HSP 1 Score: 65.0846 bits (157), Expect = 1.078e-10
Identity = 52/167 (31.14%), Postives = 74/167 (44.31%), Query Frame = 1
Query:  109 RLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILW-TKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYR 606
            RL +G  D ++ LW      N  +D  PV   A L  H+  VN V +SP   ++ASAS D  I +W  K+ + +                 SLR H   VY + WS +   L+SGS D    +WD+K       L  H   V  V W P    V +   D+ +R++R
Sbjct:  334 RLVSGSDDFTMFLW------NPAEDKKPV---ARLTGHQALVNEVLFSPDTRLIASASFDKSIKIWDGKTGKYL----------------NSLRGHVGPVYQVAWSADSRLLVSGSSDSTLKVWDIKTGKLNADLPGHADEVFAVDWSPDGQRVASGGKDKCLRIWR 475          

HSP 2 Score: 50.0618 bits (118), Expect = 5.555e-6
Identity = 52/172 (30.23%), Postives = 71/172 (41.28%), Query Frame = 1
Query:  112 LATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNR-HEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWS---LNEN--HLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRA 609
            LA+G  D +VR W L             E   + +R H   V  + WSP G  LAS   +  I LW             D V  +    ++L  H   +  +CW    LN    +L S S DC   +WD    +   IL  H   V  V W   D ++ T S DRT++V+RA
Sbjct:  120 LASGSGDTTVRFWDLS-----------TETPHHTSRGHTHWVLSIAWSPDGKKLASGCKNSQIFLW-------------DPVTGKQIG-KTLTGHTKWITWLCWEPLHLNPECRYLASTSKDCTIRIWDTVLGHYDKILTGHTHSVTCVKWGG-DGLLYTSSQDRTIKVWRA 265          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Xenopus
Match: avpi1 (arginine vasopressin induced 1 [Source:Xenbase;Acc:XB-GENE-485634])

HSP 1 Score: 323.939 bits (829), Expect = 1.233e-103
Identity = 167/403 (41.44%), Postives = 234/403 (58.06%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILW----TKSKEAVP-QKIDDDDVNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDS----------KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLK--------NKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELG 1158
            MK+IT  + +HN EP+Y+ D Q  TD   R+A+ G D +VR+WK+     G      VEFVA+L RH K VNVVR+SP+G +LAS  DD  I+LW     K  EA P Q+ D+ ++N E+W+  ++LR H  DVYDICW+ + N ++S SVD  AI+WD+    K+ I  +HK +VQGVTWDPL   + T S DR MRVY+  T+   Y V K   +          +++ D S K FFRRL F+PDG LL+TPAG  E  ++V           +N T   ++F R NL +    +P    A + VR  P+ F L+            Q     PYR +F +  ++ VL YDT+Q  P   + ++HY +++D SW+ DG  L ++STDGYCSF+ FE+GELG
Sbjct:    1 MKVITCEIAWHNKEPVYSLDFQHGTDRINRMASAGVDTAVRMWKIEKSPEGKAI---VEFVASLARHTKAVNVVRFSPNGEILASGGDDAAIVLWKLNEAKEPEATPFQEQDEPELNKENWTVLKTLRGHLEDVYDICWTQDSNFMVSASVDNTAIMWDVTKGQKLSIFNEHKSYVQGVTWDPLGQYIATLSCDRIMRVYKTETKRVAYNVSKMASAPGADGEVKSFRMYHDDSMKSFFRRLTFTPDGSLLITPAGCVESGESV-----------INTT---YVFSRKNLKRPMAHLPCPTKATLAVRCCPIYFELRPTVKDDSGESQPQGLITQPYRMVFAVASEDAVLFYDTQQLFPFGYVSNVHYHTLSDISWSSDGRFLAISSTDGYCSFVTFEEGELG 386          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Xenopus
Match: avpi1 (arginine vasopressin induced 1 [Source:Xenbase;Acc:XB-GENE-485634])

HSP 1 Score: 322.783 bits (826), Expect = 1.776e-103
Identity = 167/400 (41.75%), Postives = 236/400 (59.00%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILW----TKSKEAVP-QKIDDDDVNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDS----------KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNK-----SSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELG 1158
            MK+IT  + +HN EP+Y+ D Q  TD   R+A+ G D +VR+WK+     G      VEFVA+L RH K VNVVR+SP+G +LAS  DD  I+LW     K  EA P Q+ D+ ++N E+W+  ++LR H  DVYDICW+ + N ++S SVD  AI+WD+    K+ I  +HK +VQGVTWDPL   + T S DR MRVY+  T+   Y V K   +          +++ D S K FFRRL F+PDG LL+TPAG  E  ++V           +N T   ++F R NL +    +P    A + VR  P+ F L+       S +   + PYR +F +  ++ VL YDT+Q  P   + ++HY +++D SW+ DG  L ++STDGYCSF+ FE+GELG
Sbjct:    1 MKVITCEIAWHNKEPVYSLDFQHGTDRINRMASAGVDTAVRMWKIEKSPEGKAI---VEFVASLARHTKAVNVVRFSPNGEILASGGDDAAIVLWKLNEAKEPEATPFQEQDEPELNKENWTVLKTLRGHLEDVYDICWTQDSNFMVSASVDNTAIMWDVTKGQKLSIFNEHKSYVQGVTWDPLGQYIATLSCDRIMRVYKTETKRVAYNVSKMASAPGADGEVKSFRMYHDDSMKSFFRRLTFTPDGSLLITPAGCVESGESV-----------INTT---YVFSRKNLKRPMAHLPCPTKATLAVRCCPIYFELRPTRLNLLSQEPGGENPYRMVFAVASEDAVLFYDTQQLFPFGYVSNVHYHTLSDISWSSDGRFLAISSTDGYCSFVTFEEGELG 383          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Xenopus
Match: HIRA (histone cell cycle regulator [Source:NCBI gene;Acc:100495450])

HSP 1 Score: 143.665 bits (361), Expect = 1.457e-35
Identity = 116/389 (29.82%), Postives = 182/389 (46.79%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCV---HNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKI---DDDDVNLESWSPRS-LRRHFLDVYDICWSLNENHLISGSVDCCAILWD-LKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNK-SSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGE 1161
            MKL+ P  V HN +PI++ DI      F     G     V +W +  +    +   + +P + +  ++ H   VN VRWS SG  LAS  DD +I++W +S    P  +        N+E W   S LR H  DV D+ WS ++  L S SVD   ++W+ LK    +  L+ H   V+G+TWDP+   + +Q+ DR+++V+    RT  +++ ++  +K F +        RL +SPDG  LV+             A+ +  S P      A I  R    K  +     + AV  V+FNP  F  K K  S +    PY        D  + ++ T    P+V I ++   SI D SW  +G  + V S DG  +++ F + ELG+
Sbjct:    1 MKLLKPTWVNHNGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMPPLLKEEDEKNENIP-KMLCQMDNHLACVNCVRWSNSGAYLASGGDDKLIMVWKRSGYIGPSTVFGSSSKLANVEQWRCLSILRSHSGDVMDVSWSPHDAWLASCSVDNTVVIWNALKFPEIISTLRGHSGLVKGLTWDPVGKYIASQADDRSIKVW----RTMDWQL-ETSITKPFDECGGTTHVLRLSWSPDGHYLVS-------------AHAMNNSGPT-----AQIIERDGW-KANMDFVGHRKAVTVVKFNPKIFKKKQKNGSSTKTNCPYCCCAVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAYLDFSQDELGD 364          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Xenopus
Match: HIRA (histone cell cycle regulator [Source:NCBI gene;Acc:100495450])

HSP 1 Score: 139.428 bits (350), Expect = 3.750e-34
Identity = 114/387 (29.46%), Postives = 180/387 (46.51%), Query Frame = 1
Query:   28 LITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCV---HNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKI---DDDDVNLESWSPRS-LRRHFLDVYDICWSLNENHLISGSVDCCAILWD-LKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNK-SSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGE 1161
            L+ P  V HN +PI++ DI      F     G     V +W +  +    +   + +P + +  ++ H   VN VRWS SG  LAS  DD +I++W +S    P  +        N+E W   S LR H  DV D+ WS ++  L S SVD   ++W+ LK    +  L+ H   V+G+TWDP+   + +Q+ DR+++V+    RT  +++ ++  +K F +        RL +SPDG  LV+             A+ +  S P      A I  R    K  +     + AV  V+FNP  F  K K  S +    PY        D  + ++ T    P+V I ++   SI D SW  +G  + V S DG  +++ F + ELG+
Sbjct:   50 LLKPTWVNHNGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMPPLLKEEDEKNENIP-KMLCQMDNHLACVNCVRWSNSGAYLASGGDDKLIMVWKRSGYIGPSTVFGSSSKLANVEQWRCLSILRSHSGDVMDVSWSPHDAWLASCSVDNTVVIWNALKFPEIISTLRGHSGLVKGLTWDPVGKYIASQADDRSIKVW----RTMDWQL-ETSITKPFDECGGTTHVLRLSWSPDGHYLVS-------------AHAMNNSGPT-----AQIIERDGW-KANMDFVGHRKAVTVVKFNPKIFKKKQKNGSSTKTNCPYCCCAVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAYLDFSQDELGD 411          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Xenopus
Match: HIRA (histone cell cycle regulator [Source:NCBI gene;Acc:100495450])

HSP 1 Score: 132.109 bits (331), Expect = 8.821e-32
Identity = 112/387 (28.94%), Postives = 178/387 (45.99%), Query Frame = 1
Query:   28 LITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCV---HNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKI---DDDDVNLESWSPRS-LRRHFLDVYDICWSLNENHLISGSVDCCAILWD-LKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNK-SSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGE 1161
            L + HL   +  PI++ DI      F     G     V +W +  +    +   + +P + +  ++ H   VN VRWS SG  LAS  DD +I++W +S    P  +        N+E W   S LR H  DV D+ WS ++  L S SVD   ++W+ LK    +  L+ H   V+G+TWDP+   + +Q+ DR+++V+    RT  +++ ++  +K F +        RL +SPDG  LV+             A+ +  S P      A I  R    K  +     + AV  V+FNP  F  K K  S +    PY        D  + ++ T    P+V I ++   SI D SW  +G  + V S DG  +++ F + ELG+
Sbjct:    9 LSSEHLKLCSPFPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMPPLLKEEDEKNENIP-KMLCQMDNHLACVNCVRWSNSGAYLASGGDDKLIMVWKRSGYIGPSTVFGSSSKLANVEQWRCLSILRSHSGDVMDVSWSPHDAWLASCSVDNTVVIWNALKFPEIISTLRGHSGLVKGLTWDPVGKYIASQADDRSIKVW----RTMDWQL-ETSITKPFDECGGTTHVLRLSWSPDGHYLVS-------------AHAMNNSGPT-----AQIIERDGW-KANMDFVGHRKAVTVVKFNPKIFKKKQKNGSSTKTNCPYCCCAVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAYLDFSQDELGD 370          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Mouse
Match: Chaf1b (chromatin assembly factor 1, subunit B (p60) [Source:MGI Symbol;Acc:MGI:1314881])

HSP 1 Score: 305.834 bits (782), Expect = 8.235e-97
Identity = 162/405 (40.00%), Postives = 232/405 (57.28%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQ-TKTDDFIRLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKI-----DDDDVNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWK--SGDS--------KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLK---------NKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELG 1158
            MK+IT  + +HN EP+Y+ D Q   T    RLA+ G D +VR+WKL    +G      VEF++NL RH K VNVVR+SP+G +LAS  DD +I+LW  +    P++I     ++  +N E+W+  ++LR H  DVYDICW+ + N + S SVD   I+WD+    K+ I  +HK +VQGVTWDPL   + T S DR +R+Y    +   + + K  SG          ++F D S K FFRRL F+PDG LL+TPAG  E  +NV              T+  ++F R +L +    +P    A + VR  PV F L+          + S     LPYR +F +  ++ VL+YDT+Q  P   + +IHY +++D SW+ DG  L ++STDGYC+F+ FEKGELG
Sbjct:    1 MKVITCEIAWHNKEPVYSLDFQHGATWKIHRLASAGVDTAVRIWKLERGPDGKAI---VEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWKMNDSKEPEQIAFQDEEEAQLNKENWTVVKTLRGHLEDVYDICWATDGNLMTSASVDNTVIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYIATLSCDRVLRIYNTQKKRVAFNISKMLSGQGPEGEARSFRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCMESGENV--------------TNTTYVFSRKHLKRPIAHLPCPGKATLAVRCCPVYFELRPVAETEKASEEPSPELVNLPYRMVFAVASEDSVLLYDTQQSFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCTFVTFEKGELG 388          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Mouse
Match: Chaf1b (chromatin assembly factor 1, subunit B (p60) [Source:MGI Symbol;Acc:MGI:1314881])

HSP 1 Score: 305.834 bits (782), Expect = 8.235e-97
Identity = 162/405 (40.00%), Postives = 232/405 (57.28%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQ-TKTDDFIRLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKI-----DDDDVNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWK--SGDS--------KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLK---------NKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELG 1158
            MK+IT  + +HN EP+Y+ D Q   T    RLA+ G D +VR+WKL    +G      VEF++NL RH K VNVVR+SP+G +LAS  DD +I+LW  +    P++I     ++  +N E+W+  ++LR H  DVYDICW+ + N + S SVD   I+WD+    K+ I  +HK +VQGVTWDPL   + T S DR +R+Y    +   + + K  SG          ++F D S K FFRRL F+PDG LL+TPAG  E  +NV              T+  ++F R +L +    +P    A + VR  PV F L+          + S     LPYR +F +  ++ VL+YDT+Q  P   + +IHY +++D SW+ DG  L ++STDGYC+F+ FEKGELG
Sbjct:    1 MKVITCEIAWHNKEPVYSLDFQHGATWKIHRLASAGVDTAVRIWKLERGPDGKAI---VEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWKMNDSKEPEQIAFQDEEEAQLNKENWTVVKTLRGHLEDVYDICWATDGNLMTSASVDNTVIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYIATLSCDRVLRIYNTQKKRVAFNISKMLSGQGPEGEARSFRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCMESGENV--------------TNTTYVFSRKHLKRPIAHLPCPGKATLAVRCCPVYFELRPVAETEKASEEPSPELVNLPYRMVFAVASEDSVLLYDTQQSFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCTFVTFEKGELG 388          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Mouse
Match: Hira (histone cell cycle regulator [Source:MGI Symbol;Acc:MGI:99430])

HSP 1 Score: 145.206 bits (365), Expect = 2.817e-36
Identity = 117/388 (30.15%), Postives = 181/388 (46.65%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCV--HNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDD---VNLESWSPRS-LRRHFLDVYDICWSLNENHLISGSVDCCAILWD-LKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNK-SSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGE 1161
            MKL+ P  V HN +PI++ DI      F     G     V +W +  V   +  KD    + +  ++ H   VN VRWS SG  LAS  DD +I++W ++    P  +        N+E W   S LR H  DV D+ WS ++  L S SVD   ++W+ +K    +  L+ H   V+G+TWDP+   + +Q+ DR+++V+    RT  +++ ++  +K F +        RL +SPDG  LV+             A+ +  S P      A I  R    K  +     + AV  V+FNP  F  K K  S +    PY        D  + ++ T    P+V I ++   SI D SW  +G  + V S DG  +F+ F + ELG+
Sbjct:    1 MKLLKPTWVNHNGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMSPVLQEDDEKDENIPKMLCQMDNHLACVNCVRWSNSGMYLASGGDDKLIMVWKRATYIGPSTVFGSSGKLANVEQWRCVSILRSHSGDVMDVAWSPHDAWLASCSVDNTVVIWNAVKFPEILATLRGHSGLVKGLTWDPVGKYIASQADDRSLKVW----RTLDWQL-ETSITKPFDECGGTTHVLRLSWSPDGHYLVS-------------AHAMNNSGPT-----AQIIEREGW-KTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSSTKPSCPYCCCAVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAFLDFSQDELGD 364          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Mouse
Match: Hira (histone cell cycle regulator [Source:MGI Symbol;Acc:MGI:99430])

HSP 1 Score: 125.561 bits (314), Expect = 1.180e-30
Identity = 99/328 (30.18%), Postives = 156/328 (47.56%), Query Frame = 1
Query:  196 EFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDD---VNLESWSPRS-LRRHFLDVYDICWSLNENHLISGSVDCCAILWD-LKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSAF-KLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGE 1161
            + +  ++ H   VN VRWS SG  LAS  DD +I++W ++    P  +        N+E W   S LR H  DV D+ WS ++  L S SVD   ++W+ +K    +  L+ H   V+G+TWDP+   + +Q+ DR+++V+    RT  +++ ++  +K F +        RL +SPDG  LV+             A+ +  S P      A I  R    K  +     + AV  V+FNP  F  K K+  S     PY        D  + ++ T    P+V I ++   SI D SW  +G  + V S DG  +F+ F + ELG+
Sbjct:   17 KMLCQMDNHLACVNCVRWSNSGMYLASGGDDKLIMVWKRATYIGPSTVFGSSGKLANVEQWRCVSILRSHSGDVMDVAWSPHDAWLASCSVDNTVVIWNAVKFPEILATLRGHSGLVKGLTWDPVGKYIASQADDRSLKVW----RTLDWQL-ETSITKPFDECGGTTHVLRLSWSPDGHYLVS-------------AHAMNNSGPT-----AQIIEREGW-KTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSSTKPSCPYCCCAVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAFLDFSQDELGD 320          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Mouse
Match: Chaf1b (chromatin assembly factor 1, subunit B (p60) [Source:MGI Symbol;Acc:MGI:1314881])

HSP 1 Score: 90.8929 bits (224), Expect = 1.043e-21
Identity = 47/96 (48.96%), Postives = 63/96 (65.62%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQ-TKTDDFIRLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILW 306
            MK+IT  + +HN EP+Y+ D Q   T    RLA+ G D +VR+WKL    +G      VEF++NL RH K VNVVR+SP+G +LAS  DD +I+LW
Sbjct:    1 MKVITCEIAWHNKEPVYSLDFQHGATWKIHRLASAGVDTAVRIWKLERGPDGKA---IVEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLW 93          
BLAST of Chromatin assembly factor 1 subunit B vs. UniProt/SwissProt
Match: sp|Q5R1S9|CAF1B_CHICK (Chromatin assembly factor 1 subunit B OS=Gallus gallus OX=9031 GN=CHAF1B PE=1 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 3.657e-103
Identity = 178/405 (43.95%), Postives = 239/405 (59.01%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFI-RLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILW--TKSKEAVPQKIDDDD---VNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWK-------SGDS---KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLK---------NKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELG 1158
            MK+IT  + +HN EP+Y+ D Q  TD  I RLA+ G D +VR+WK   V  G      VEF++NL RH K VNVVR+SPSG VLAS  DD +I+LW    SKE  P    D+D   +N E+W+  ++LR H  DVYDICW+ + N++ S SVD  AI+WD+    KV IL +HK +VQG+TWDPL   + T S DR +RVY   T+   + V K        G++   ++F D S K FFRRL F+PDG LL+TPAG  E  +NV              T+  ++F R+NL +    +P    A + VR  PV F L+          KSS +   LPYR +F +  ++ VL YDTEQ  P   + +IHY +++D SW+ DG  L ++STDGYCSF+ FEK ELG
Sbjct:    1 MKVITCEIAWHNKEPVYSLDFQHGTDGKINRLASAGVDTAVRVWK---VEKGPDGKAIVEFLSNLARHTKAVNVVRFSPSGEVLASGGDDAVILLWKLNDSKELEPLAFQDEDEAQLNKENWTVVKTLRGHLEDVYDICWTSDGNYMASASVDNTAIMWDVVKGQKVSILNEHKSYVQGITWDPLGQYIATLSCDRVLRVYNTQTKRVAFNVTKMPSESGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENV--------------TNTTYVFSRNNLKRPMGHLPCPGKATLAVRCCPVYFELRQALNKGEVSQKSSPALLNLPYRLVFAVASEDSVLFYDTEQSFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCSFVTFEKDELG 388          
BLAST of Chromatin assembly factor 1 subunit B vs. UniProt/SwissProt
Match: sp|Q13112|CAF1B_HUMAN (Chromatin assembly factor 1 subunit B OS=Homo sapiens OX=9606 GN=CHAF1B PE=1 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 2.396e-97
Identity = 168/398 (42.21%), Postives = 234/398 (58.79%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFI-RLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKI-----DDDDVNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWK-------SGDS---KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKN--KSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELG 1158
            MK+IT  + +HN EP+Y+ D Q  T   I RLA+ G D +VR+WK   V  G      VEF++NL RH K VNVVR+SP+G +LAS  DD +I+LW  +    P++I     D+  +N E+W+  ++LR H  DVYDICW+ + N + S SVD  AI+WD+    K+ I  +HK +VQGVTWDPL   V T S DR +RVY    +   + V K        G++   ++F D S K FFRRL F+PDG LL+TPAG  E  +NV           +N T   ++F R NL +    +P    A + VR  PV F L+   ++      LPYR +F +  ++ VL+YDT+Q  P   + +IHY +++D SW+ DG  L ++STDGYCSF+ FEK ELG
Sbjct:    1 MKVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWK---VEKGPDGKAIVEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWKVNDNKEPEQIAFQDEDEAQLNKENWTVVKTLRGHLEDVYDICWATDGNLMASASVDNTAIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYVATLSCDRVLRVYSIQKKRVAFNVSKMLSGIGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENV-----------MNTT---YVFSRKNLKRPIAHLPCPGKATLAVRCCPVYFELRPVVETGVELMSLPYRLVFAVASEDSVLLYDTQQSFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCSFVTFEKDELG 381          
BLAST of Chromatin assembly factor 1 subunit B vs. UniProt/SwissProt
Match: sp|Q9D0N7|CAF1B_MOUSE (Chromatin assembly factor 1 subunit B OS=Mus musculus OX=10090 GN=Chaf1b PE=1 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 5.760e-96
Identity = 162/405 (40.00%), Postives = 232/405 (57.28%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQ-TKTDDFIRLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKI-----DDDDVNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWK--SGDS--------KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLK---------NKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELG 1158
            MK+IT  + +HN EP+Y+ D Q   T    RLA+ G D +VR+WKL    +G      VEF++NL RH K VNVVR+SP+G +LAS  DD +I+LW  +    P++I     ++  +N E+W+  ++LR H  DVYDICW+ + N + S SVD   I+WD+    K+ I  +HK +VQGVTWDPL   + T S DR +R+Y    +   + + K  SG          ++F D S K FFRRL F+PDG LL+TPAG  E  +NV              T+  ++F R +L +    +P    A + VR  PV F L+          + S     LPYR +F +  ++ VL+YDT+Q  P   + +IHY +++D SW+ DG  L ++STDGYC+F+ FEKGELG
Sbjct:    1 MKVITCEIAWHNKEPVYSLDFQHGATWKIHRLASAGVDTAVRIWKLERGPDGKAI---VEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWKMNDSKEPEQIAFQDEEEAQLNKENWTVVKTLRGHLEDVYDICWATDGNLMTSASVDNTVIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYIATLSCDRVLRIYNTQKKRVAFNISKMLSGQGPEGEARSFRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCMESGENV--------------TNTTYVFSRKHLKRPIAHLPCPGKATLAVRCCPVYFELRPVAETEKASEEPSPELVNLPYRMVFAVASEDSVLLYDTQQSFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCTFVTFEKGELG 388          
BLAST of Chromatin assembly factor 1 subunit B vs. UniProt/SwissProt
Match: sp|Q9SXY1|FAS2_ARATH (Chromatin assembly factor 1 subunit FAS2 OS=Arabidopsis thaliana OX=3702 GN=FAS2 PE=1 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 1.778e-72
Identity = 146/407 (35.87%), Postives = 213/407 (52.33%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWS-PRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRT-----------CIYKVWKS----GD------SKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSAF-KLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYTL 1173
            MK  T  + +H+ +P+ T D    +     LAT G D  ++LW ++      K    V + ++L  H   VN +R+SPSG +LAS +D G + +W         K+   + N +SW   +SL  H  DV D+ WS ++ +LISGSVD   I+WD+   +   IL  H  +VQGV WDPL   V + SSDRT R+Y    +T           C + + K+    GD      + LF D +   FFRRL +SPDG  L+ PAG ++     E  N            A ++F R +LS+ A+ +P     V+ VRF PV F L+  SS+  F KLPYR +F +   N V IYDTE   P+  +  +HY +ITD +W+P+   L ++S DGYC+ + FE  ELGE  ++
Sbjct:    1 MKGGTIQISWHDGKPVLTVDFHPISG---LLATAGADYDIKLWLINS-GQAEKKVPSVSYQSSLTYHGCAVNTIRFSPSGELLASGADGGELFIW---------KLHPSETN-QSWKVHKSLSFHRKDVLDLQWSPDDAYLISGSVDNSCIIWDVNKGSVHQILDAHCHYVQGVAWDPLAKYVASLSSDRTCRIYANKPQTKSKGVEKMNYVCQHVIMKADQQRGDETKTIKTHLFHDETLPSFFRRLSWSPDGSFLLIPAGSFKVSPTSEAVN------------ATYVFSRKDLSRPALQLPGASKPVVVVRFCPVAFKLRGSSSEEGFFKLPYRLVFAIATLNSVYIYDTECVAPIAVLAGLHYAAITDITWSPNASYLALSSQDGYCTLVEFEDKELGEAVSI 381          
BLAST of Chromatin assembly factor 1 subunit B vs. UniProt/SwissProt
Match: sp|Q6ZD63|FAS2_ORYSJ (Chromatin assembly factor 1 subunit FAS2 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=FAS2 PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 5.889e-65
Identity = 151/480 (31.46%), Postives = 233/480 (48.54%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWS-PRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTR-----------TCIYKVWKSGD-----------SKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYTLVGPQSM---------KNPLKTIENTVESDDSKSDAIYNLKMNLPMLQLDPTEILRVSNQENIASDSDTDNCSN 1365
            M+  T  + +H  +P+ T D    +    RLATGG D  +++W +    + +K      + ++L+ H   VNV+R+SPSG  LAS +D G II+W         K+   D + E+W   ++L  H  DV D+ WS +   L+S SVD   I+WD    +    L+ H  +VQGV WDPL   + + SSDRT R+Y    +            C + + K+             + LF D +   FFRRL +SPDG  LV PAG  +           Y+S  +N    A++  R +LS+ A+ +P    A++ VRF PV F L+   S   FKLPYR IF +   N + +YDTE   P++    +HY +ITD +W+ D   L V+S D +C+ I FE  ELG  Y L G + +           PLK     +++  SK+     +K +   +++ P+  +   N   +  D    N ++
Sbjct:    1 MRGGTVQINWHEQQPVLTLDFHPVSR---RLATGGSDHDIKIWVI-ASDDSDKKLPTATYHSSLSSHSSAVNVLRFSPSGENLASGADGGGIIIW---------KLHSTD-DGEAWKVQKTLLFHHKDVLDLQWSQDGAFLVSASVDNSCIVWDAIKGSVQQKLEGHLHYVQGVAWDPLGQYIASLSSDRTCRIYANKPQGKSKNTDRMNFVCQHTLVKAEHQNHDESKPPVRAHLFHDETLPSFFRRLAWSPDGSFLVLPAGLCK-----------YSSEVIN---TAYVMSRRDLSRPAIQLPGASKAIVAVRFCPVLFKLRGSQSDCFFKLPYRVIFAVATLNSLYVYDTESVAPILIHAGLHYAAITDIAWSSDAKYLAVSSRDCFCTIIEFENEELGLPYNLSGTKELDEGNTNCENMKPLKVDSMEIDAGSSKA----KIKASSAAVEVTPSPPVLAQNNILMTKDVAEGNATS 448          
BLAST of Chromatin assembly factor 1 subunit B vs. TrEMBL
Match: A0A3Q0KQ46 (Chromatin assembly factor I P60 subunit,putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 1.142e-103
Identity = 217/600 (36.17%), Postives = 288/600 (48.00%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTD---------------------------------DFIRLATGGFDCSVRLWKLH------------------CVHNGN-------------------KDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKI----------DDDD-----VNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDL------------------------------------------KNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYE--------RKKNVEEANDIYASNPVNDT--------HAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLK-------NKSSQ--SAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYTLVGPQSMKNPLK-TIENTV-ESDDSKSDAIYNLKMNLPMLQLDPTEILRVSNQENIASDSDTDN 1356
            M+ +TP + +H   PIY+CD+Q +                                   ++ RLAT G D  VRLW++                   C  N                     K F  + ++A+L RHEK VNVVRWSPSG+ LASA DD  II+W+         I          DDDD     +N E W P RSLRRH  D+YD+CWS +E  LISGSVD   I+W L                                          + T K +IL+DHK +VQGV WDPL   V + SSDR  R+YRA T+ C+  V K+G  +LFQD SWK FFRRL FSPDG LLV P+G  E            +   N    S+ + DT        HAAHIFVR N ++  V++PTG   V+ VRF P  F L+       N ++Q  S F L YRW+FCLVL++ VL YDT+Q +P  ++  +HY ++ DASW+ DGH + + STDGYCS I+F  GELG  Y   G     NP   +IEN V E+D  +S+ +  L   +     DP +     ++ NI+S +  D+
Sbjct:    1 MRFLTPEIAWHETLPIYSCDLQNRLKPISDNNKCSNQNSNRSPLSELNFKSIKDLDPGLNWTRLATAGGDNVVRLWRVQLNWLPGVLKTTTEQTESQCTTNLTVTKKGSGFITPGTTQKTDFKQFEHLTYLASLKRHEKPVNVVRWSPSGDYLASAGDDLFIIIWSNQTTTNNGTITSIDNSSNLKDDDDYYDNAINSEIWIPCRSLRRHLEDIYDVCWSPDERALISGSVDHSIIIWHLDLIPSPSSALPAEDFSSVGEVGPENNPSNRPENAPAPSANTSQPTIKTLILRDHKHYVQGVAWDPLGFYVASLSSDRACRIYRAGTKNCLAHVSKAGKQRLFQDDSWKSFFRRLTFSPDGLLLVCPSGNLEDATFAGLTNSTIISSTNGFEQSDKIVDTAIPLVAPQHAAHIFVRSNFTRPVVSLPTGSKPVVAVRFCPQPFQLRQVNLNCQNATNQCTSLFNLAYRWLFCLVLEDSVLFYDTQQTVPFAQVSQLHYQALNDASWSKDGHLVVICSTDGYCSLIHFAHGELGAFYR--GTFGAPNPQPISIENAVSETDKCQSNDVEMLSSVVGDADSDPIKETNNPSKSNISSTTVPDS 598          
BLAST of Chromatin assembly factor 1 subunit B vs. TrEMBL
Match: A0A091TY31 (Chromatin assembly factor 1 subunit B (Fragment) OS=Phaethon lepturus OX=97097 GN=N335_03683 PE=4 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 3.378e-101
Identity = 177/405 (43.70%), Postives = 240/405 (59.26%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFI-RLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILW--TKSKEAVPQKIDDDD---VNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWK--SGDS--------KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKN---------KSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELG 1158
            MK+IT  + +HN EP+Y+ D Q   D  I RLA+ G D +VR+WK   V  G      VEF++NL RH K VNVVR+SPSG +LAS  DD +I+LW    SKE+ P    D+D   +N E+W+  ++LR H  DVYDICW+ + N++ S SVD  AI+WD+    KV IL +HK +VQG+TWDPL   + T S DR +RVY   T+   + V K  SG          ++F D S K FFRRL F+PDG  L+TPAG  E  +NV              T+  ++F R+NL +    +P    A + VR  PV F L++         KS+ + F LPYR +F +  ++ VL YDTEQ  P   + +IHY +++D SW+ DG  L ++STDGYCSF+ FEKGELG
Sbjct:    1 MKVITCEIAWHNKEPVYSLDFQRGADGKINRLASAGVDTAVRIWK---VEKGPDGKAIVEFLSNLARHTKAVNVVRFSPSGEILASGGDDAVILLWKLNDSKESEPLVFQDEDEAQLNKENWTVVKTLRGHLEDVYDICWTSDGNYMASASVDNTAIMWDVNKGQKVSILNEHKSYVQGITWDPLAQYIATLSCDRVLRVYNTQTKRVAFNVTKMPSGSGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSYLLTPAGCVESGENV--------------TNTTYVFSRNNLKRPVGHLPCPGKATLAVRCCPVYFELRHAFNKDEISQKSAPALFNLPYRLVFAVASEDSVLFYDTEQFFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCSFVTFEKGELG 388          
BLAST of Chromatin assembly factor 1 subunit B vs. TrEMBL
Match: G1NNY2 (Chromatin assembly factor 1 subunit B OS=Meleagris gallopavo OX=9103 GN=CHAF1B PE=4 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 4.046e-101
Identity = 179/405 (44.20%), Postives = 239/405 (59.01%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFI-RLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILW--TKSKEAVPQKIDDDD---VNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWK-------SGDS---KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLK---------NKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELG 1158
            MK+IT  + +HN EP+Y+ D Q  TD  I RLA+ G D +VR+WK   V  G      VEF++NL RH K VNVVR+SPSG VLAS  DD +I+LW    SKE  P    D+D   +N E+W+  +SLR H  DVYDICW+ + N++ S SVD  AI+WD+    KV IL +HK +VQG+TWDPL   + T S DR +RVY   T+   + V K        G++   ++F D S K FFRRL F+PDG LL+TPAG  E  +NV              T+  ++F R+NL +    +P    A + VR  PV F L+          KSS +   LPYR +F +  ++ VL YDTEQ  P   + +IHY +++D SW+ DG  L ++STDGYCSF+ FEK ELG
Sbjct:    1 MKVITCEIAWHNKEPVYSLDFQHGTDGKINRLASAGVDTAVRIWK---VEKGPDGKAIVEFLSNLARHTKAVNVVRFSPSGEVLASGGDDAVILLWKLNDSKELEPLAFQDEDEAQLNKENWTVVKSLRGHLEDVYDICWTSDGNYMASASVDNTAIMWDVIKGQKVSILNEHKSYVQGITWDPLGQYIATLSCDRVLRVYNTQTKRVAFNVTKMPSESGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENV--------------TNTTYVFSRNNLKRPMGHLPCPGKATLAVRCCPVYFELRRALNKDEISQKSSPALLNLPYRLVFAVASEDSVLFYDTEQSFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCSFVTFEKDELG 388          
BLAST of Chromatin assembly factor 1 subunit B vs. TrEMBL
Match: A0A087R955 (Chromatin assembly factor 1 subunit B (Fragment) OS=Aptenodytes forsteri OX=9233 GN=AS27_04860 PE=4 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 4.322e-101
Identity = 179/405 (44.20%), Postives = 239/405 (59.01%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFI-RLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILW--TKSKEAVPQKIDDDD---VNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWK--SGDS--------KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLK---------NKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELG 1158
            MK+IT  +V+HN EP+Y+ D Q   D  I RLA+ G D +VR+WK   V  G      VEF++NL RH K VNVVR+SPSG +LAS  DD +I+LW    SKE+ P    D+D   +N E+W+  ++LR H  DVYDICW+ + N++ S SVD  AI+WD+    KV IL +HK +VQGVTWDPL   + T S DR +RVY   T+   + V K  SG          ++F D S K FFRRL F+PDG  L+TPAG  E  +NV              T+  +IF R+NL +    +P    A + VR  PV F L+          KS+ + F LPYR +F +  ++ VL YDTEQ  P   + +IHY +++D SW+ DG  L ++STDGYCSF+ FEK ELG
Sbjct:    1 MKVITCEIVWHNKEPVYSLDFQHGADGKINRLASAGVDTAVRIWK---VEKGPDGKAIVEFLSNLARHTKAVNVVRFSPSGEILASGGDDAVILLWKLNDSKESEPLVFQDEDEAQLNKENWTVVKTLRGHLEDVYDICWTSDGNYMASASVDNTAIMWDVNKGQKVSILNEHKSYVQGVTWDPLGQYIATLSCDRVLRVYNTQTKRVAFNVTKMPSGSGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSYLLTPAGCVESGENV--------------TNTTYIFSRNNLKRPVGHLPCPGKATLAVRCCPVYFELRQAFNKDEISQKSAPALFNLPYRLVFAVASEDSVLFYDTEQSFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCSFVTFEKDELG 388          
BLAST of Chromatin assembly factor 1 subunit B vs. TrEMBL
Match: A8E5V8 (LOC100127620 protein (Fragment) OS=Xenopus tropicalis OX=8364 GN=LOC100127620 PE=2 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 5.494e-101
Identity = 167/403 (41.44%), Postives = 234/403 (58.06%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILW----TKSKEAVP-QKIDDDDVNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDS----------KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLK--------NKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELG 1158
            MK+IT  + +HN EP+Y+ D Q  TD   R+A+ G D +VR+WK+     G      VEFVA+L RH K VNVVR+SP+G +LAS  DD  I+LW     K  EA P Q+ D+ ++N E+W+  ++LR H  DVYDICW+ + N ++S SVD  AI+WD+    K+ I  +HK +VQGVTWDPL   + T S DR MRVY+  T+   Y V K   +          +++ D S K FFRRL F+PDG LL+TPAG  E  ++V           +N T   ++F R NL +    +P    A + VR  P+ F L+            Q     PYR +F +  ++ VL YDT+Q  P   + ++HY +++D SW+ DG  L ++STDGYCSF+ FE+GELG
Sbjct:    1 MKVITCEIAWHNKEPVYSLDFQHGTDRINRMASAGVDTAVRMWKIEKSPEGKAI---VEFVASLARHTKAVNVVRFSPNGEILASGGDDAAIVLWKLNEAKEPEATPFQEQDEPELNKENWTVLKTLRGHLEDVYDICWTQDSNFMVSASVDNTAIMWDVTKGQKLSIFNEHKSYVQGVTWDPLGQYIATLSCDRIMRVYKTETKRVAYNVSKMASAPGADGEVKSFRMYHDDSMKSFFRRLTFTPDGSLLITPAGCVESGESV-----------INTT---YVFSRKNLKRPMAHLPCPTKATLAVRCCPIYFELRPTVKDDSGESQPQGLITQPYRMVFAVASEDAVLFYDTQQLFPFGYVSNVHYHTLSDISWSSDGRFLAISSTDGYCSFVTFEEGELG 386          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Cavefish
Match: chaf1b (chromatin assembly factor 1 subunit B [Source:NCBI gene;Acc:103033721])

HSP 1 Score: 311.227 bits (796), Expect = 2.158e-98
Identity = 178/462 (38.53%), Postives = 253/462 (54.76%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFI-RLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILW----TKSKEAVPQKIDDDD---VNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWK--SGDS--------KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQ--------SAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYTLVGPQSMKNPLKTIENTVESDDSKSDAIYNLKMNLPMLQLDPTEILRVSNQE 1326
            MK++T  + +HN EP+Y+ D Q   +  I RLAT G D +VRLW+   V  G      V+F++NL RH K VNVVR+SPS  +LAS  DD  I+LW    +K  E  P  I +D+   +N ESW+  ++LR H  DVYDI W+ + N L+SGSVD  AI+WD++   K+ I  DHK +VQGV WDPL   + T S DR MRVY   TR   Y V K  SG +        ++F D S + FFRRL F+PDG  L+ PAG  E  +NV              T+  ++F R +  +    +P    A + VR  PV F L+ K ++        +AF+LPYR +F +  ++ +  YDT+Q LP   + +IHY +++D SW+ DG  L V+STDGYCSF+ F++ ELG       P   + PL  I     S+     A    + + P+ +  P  + +   +E
Sbjct:    1 MKVVTCEIAWHNKEPVYSLDFQQNAEGSIDRLATAGVDTTVRLWR---VDRGPDGKAVVDFLSNLTRHTKAVNVVRFSPSSELLASGGDDAAILLWKLNDSKEPEQTPTFIQEDEDAQLNKESWNVVKTLRGHIEDVYDISWTSDGNFLVSGSVDNTAIMWDVQKGQKMCIFNDHKSYVQGVAWDPLGQYISTLSCDRVMRVYSTHTRKKAYIVSKMTSGSAAEGEVKNYRMFHDDSMRSFFRRLTFTPDGSFLLAPAGCVEAGENV--------------TNTTYVFSRKSFKRPVAHLPCPAKATLAVRCCPVYFELRTKKAEDGSVQPLPNAFQLPYRLVFAVASEDSIFFYDTQQTLPFGYVSNIHYHTLSDLSWSHDGSFLAVSSTDGYCSFVSFDELELGT------PLKERPPLNIITPVSASEKKGKRAQAISRTSSPVPRPTPAPVPQEKEKE 439          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Cavefish
Match: ENSAMXT00000007962.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 69.3218 bits (168), Expect = 2.010e-12
Identity = 42/139 (30.22%), Postives = 70/139 (50.36%), Query Frame = 1
Query:  211 LNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCI 627
            L  H K ++ V++SP+G  LAS+S D +I +W              D   E    +SL  H L + D+ WS + N L+S S D    +WD+ +   +  LK H  +V    ++P  N+V++ S D ++R++   T  C+
Sbjct:   38 LAGHTKAISSVKFSPNGEWLASSSADKLIKIW-----------GSFDGKFE----KSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCL 161          

HSP 2 Score: 52.373 bits (124), Expect = 5.672e-7
Identity = 42/179 (23.46%), Postives = 81/179 (45.25%), Query Frame = 1
Query:  196 EFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVT 732
            +F  +L+ H+  ++ V WSP  N+L SASDD  + +W                       ++L+ H   V+   ++   N ++SGS D    +WD+K    +  L  H   V  V ++   +++++ S D   R++ +++  C+          L  D +    F  ++FSP+GK ++ 
Sbjct:   75 KFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKC---------------LKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCL--------KTLIDDDNPPVSF--VKFSPNGKYILA 228          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Cavefish
Match: ENSAMXT00000052579.1 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 69.3218 bits (168), Expect = 2.010e-12
Identity = 42/139 (30.22%), Postives = 70/139 (50.36%), Query Frame = 1
Query:  211 LNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCI 627
            L  H K ++ V++SP+G  LAS+S D +I +W              D   E    +SL  H L + D+ WS + N L+S S D    +WD+ +   +  LK H  +V    ++P  N+V++ S D ++R++   T  C+
Sbjct:   38 LAGHTKAISSVKFSPNGEWLASSSADKLIKIW-----------GSFDGKFE----KSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCL 161          

HSP 2 Score: 52.373 bits (124), Expect = 5.672e-7
Identity = 42/179 (23.46%), Postives = 81/179 (45.25%), Query Frame = 1
Query:  196 EFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVT 732
            +F  +L+ H+  ++ V WSP  N+L SASDD  + +W                       ++L+ H   V+   ++   N ++SGS D    +WD+K    +  L  H   V  V ++   +++++ S D   R++ +++  C+          L  D +    F  ++FSP+GK ++ 
Sbjct:   75 KFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKC---------------LKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCL--------KTLIDDDNPPVSF--VKFSPNGKYILA 228          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Cavefish
Match: ENSAMXT00000007963.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 69.3218 bits (168), Expect = 2.026e-12
Identity = 48/174 (27.59%), Postives = 81/174 (46.55%), Query Frame = 1
Query:  211 LNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVT 732
            L  H K ++ V++SP+G  LAS+S D +I +W              D   E    +SL  H L + D+ WS + N L+S S D    +WD+ +   +  LK H  +V    ++P  N+V++ S D ++R++   T  C+  +    D               + F+ DG L+V+
Sbjct:   38 LAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSF-----------DGKFE----KSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDP-----------VSAVHFNRDGSLIVS 185          

HSP 2 Score: 52.7582 bits (125), Expect = 4.445e-7
Identity = 42/179 (23.46%), Postives = 81/179 (45.25%), Query Frame = 1
Query:  196 EFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVT 732
            +F  +L+ H+  ++ V WSP  N+L SASDD  + +W                       ++L+ H   V+   ++   N ++SGS D    +WD+K    +  L  H   V  V ++   +++++ S D   R++ +++  C+          L  D +    F  ++FSP+GK ++ 
Sbjct:   75 KFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKC---------------LKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCL--------KTLIDDDNPPVSF--VKFSPNGKYILA 228          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 68.5514 bits (166), Expect = 2.834e-12
Identity = 47/176 (26.70%), Postives = 83/176 (47.16%), Query Frame = 1
Query:  211 LNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPA 738
            L  H K V+ V++SPSG  LAS+S D +I +W     A   K +           +++  H L + D+ WS + N L+S S D    +WD+ +   +  LK H  +V    ++P  N++++ S D ++R++   T  C+  +    D               + F+ DG L+V+ +
Sbjct:   41 LAGHTKAVSSVKFSPSGEWLASSSADKLIKIWG----AYDGKFE-----------KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDP-----------VSAVHFNRDGSLIVSSS 190          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 66.6254 bits (161), Expect = 5.253e-12
Identity = 47/208 (22.60%), Postives = 89/208 (42.79%), Query Frame = 1
Query:  109 RLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVT 732
            +LA+G  D  + +W          +F P         H+  V  V++SPSG+++ SAS D  + LW      VP    +  V          + H   V  + +S +   L++ S D    +W +     +  L  H  +V+   + P   ++++ S DRT+RV+ +++R C++  ++ G            F  +++F P G  +  
Sbjct:   32 QLASGSMDACLMVW----------NFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLW------VPSVKGESTV---------FKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGG-----------FVNQVDFHPSGTCIAA 203          

HSP 2 Score: 60.4622 bits (145), Expect = 4.447e-10
Identity = 73/287 (25.44%), Postives = 115/287 (40.07%), Query Frame = 1
Query:  379 SLRRHFLDVYDICWSL----NENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKK-NVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKS-------------SQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYTLVGPQ 1185
            SL RHF    D   S+    N   L SGS+D C ++W+ K   +      HK  V  V + P  ++V++ S D+T+R++  S +         G+S +F+  +     R + FS DG+ LVT +     K   V     +Y+ N     H+       N  + A   P G+  V G     VR    N               +Q  F      I     DN V ++D      +++ + +H  ++   S+ P G+ L   S D     +   +G L   YTL G Q
Sbjct:    9 SLERHFKGHRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVK---------GESTVFK--AHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLN----QHS-------NWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMN-KLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRL--FYTLHGHQ 270          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Sea Lamprey
Match: ciao1 (cytosolic iron-sulfur assembly component 1 [Source:NCBI gene;Acc:795104])

HSP 1 Score: 58.151 bits (139), Expect = 1.506e-9
Identity = 48/173 (27.75%), Postives = 75/173 (43.35%), Query Frame = 1
Query:  109 RLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILW--DLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRT 621
            RLA+  FD +  +W        + DF   E  A L  HE  V  V W+PSGN+LA+ S D  + +W   +E        +D    S     L  H  DV  + W  N   L S S D    L+  D  + +    L+ H+  V  + +D     +++   D+T+R+++    T
Sbjct:   74 RLASASFDATTCVWSRR-----DGDF---EVTATLEGHENEVKGVAWAPSGNLLATCSRDKSVWIWEVDEE--------EDYECAS----VLNSHTQDVKHVVWHPNSEVLASASYDNSIRLYREDGDDWSSFATLEGHESTVWSIDFDATGRRLVSCGDDKTIRIWQEGAAT 226          

HSP 2 Score: 55.4546 bits (132), Expect = 1.165e-8
Identity = 45/168 (26.79%), Postives = 78/168 (46.43%), Query Frame = 1
Query:  112 LATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDL---KNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYR 606
            +A+ G D +VR+W           ++    +A+   H++ V  V WSP G  LASAS D    +W++          D D  + +    +L  H  +V  + W+ + N L + S D    +W++   ++     +L  H Q V+ V W P   V+ + S D ++R+YR
Sbjct:   30 IASCGGDKTVRVWGRE-----GDGWVCRSVLADA--HQRTVRNVAWSPCGTRLASASFDATTCVWSRR---------DGDFEVTA----TLEGHENEVKGVAWAPSGNLLATCSRDKSVWIWEVDEEEDYECASVLNSHTQDVKHVVWHPNSEVLASASYDNSIRLYR 177          

HSP 3 Score: 53.9138 bits (128), Expect = 4.055e-8
Identity = 36/141 (25.53%), Postives = 64/141 (45.39%), Query Frame = 1
Query:  193 VEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSL--RRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVI--ILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVY 603
            ++ +  L  H+ R   V WSPSG ++AS   D  + +W +  +               W  RS+    H   V ++ WS     L S S D    +W  ++ +  +   L+ H+  V+GV W P  N++ T S D+++ ++
Sbjct:    5 LQVLHRLAGHQDRAWSVAWSPSGALIASCGGDKTVRVWGREGDG--------------WVCRSVLADAHQRTVRNVAWSPCGTRLASASFDATTCVWSRRDGDFEVTATLEGHENEVKGVAWAPSGNLLATCSRDKSVWIW 131          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004242.1 (pep scaffold:Pmarinus_7.0:GL482741:5889:16850:1 gene:ENSPMAG00000003878.1 transcript:ENSPMAT00000004242.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 4.576e-8
Identity = 46/171 (26.90%), Postives = 82/171 (47.95%), Query Frame = 1
Query:  112 LATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVN--VVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTN-KVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRAST 615
            LA+G    SV++W+L       ++ L       LNR  + ++  V   + S   LA+ASDD +++LW   +    Q       +   W       H   V   C+S + + L++GS D   + W+++ +  ++ +   H  +V GV WD     V++ S+D T++V+ AST
Sbjct:  285 LASGSEGGSVKVWRLS-----GEEALGDAAALTLNRTLQGLSGAVRALACSDRFLAAASDDAMVVLWPIGEALGGQGEATSAPSGVLWG------HEGAVTCCCFSPDGSQLLTGSKDRSLVFWEVQASRARLRVPSSHGDWVTGVHWDRDGETVVSCSNDCTVKVWDAST 444          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 53.5286 bits (127), Expect = 4.675e-8
Identity = 36/146 (24.66%), Postives = 69/146 (47.26%), Query Frame = 1
Query:  202 VANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDD--VNLESWSPRSLRRHFLDVYDICWSLNEN---HLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTC 624
            V     H + V +VR +  G+++AS S+D  + +W  + +    ++ + +  V   SW+P +     L+              +L+SGS D    +WD+     VI L  H  +V+GV + P    +++ + D+T+RV+    + C
Sbjct:  166 VKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDYKNKRC 311          

HSP 2 Score: 52.7582 bits (125), Expect = 8.701e-8
Identity = 38/139 (27.34%), Postives = 64/139 (46.04%), Query Frame = 1
Query:  211 LNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCI 627
            L+ H   V  V + P  +V+ SAS+D  I +W           D +  + E    R+L+ H   V DI + L+   L S S D    LWD ++   +  +  H   V  V + P  + +++ S D+TM+++   T  C+
Sbjct:   43 LSGHRSPVTRVIFHPVFSVIVSASEDATIKVW-----------DYETGDFE----RTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCV 166          

HSP 3 Score: 51.6026 bits (122), Expect = 2.226e-7
Identity = 40/175 (22.86%), Postives = 80/175 (45.71%), Query Frame = 1
Query:  103 FIRLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWT-KSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTC 624
            F  + +   D ++++W          D+   +F   L  H   V  + +  SG +LAS S D  + LW  +S E +                R++  H  +V  + +  N +HL+S S D    +W+++    V     H+++V+ V  +   +++ + S+D+T+RV+  +T+ C
Sbjct:   59 FSVIVSASEDATIKVW----------DYETGDFERTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECL----------------RTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKEC 207          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003168.1 (pep scaffold:Pmarinus_7.0:GL476396:632759:655100:1 gene:ENSPMAG00000002868.1 transcript:ENSPMAT00000003168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 1.644e-7
Identity = 35/106 (33.02%), Postives = 50/106 (47.17%), Query Frame = 1
Query:  175 NKDFL---PVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDL 483
            N  FL   P +F    + H + VN VR+SP+GN  A+A  DG I ++     A  QK+          S    + H   +Y +CWS +   L+S S D    LWD+
Sbjct:  170 NAAFLQGPPFKFQFTTSDHSRFVNSVRFSPNGNFFATAGADGQIFIY---DGASGQKVS---------SLGGEKAHDGGIYAVCWSPDSTQLMSASGDRTVRLWDV 263          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Yeast
Match: CAC2 (Subunit of chromatin assembly factor I (CAF-1), with Rlf2p and Msi1p; chromatin assembly by CAF-1 is important for multiple processes including silencing at telomeres, mating type loci, and rDNA; maintenance of kinetochore structure, deactivation of the DNA damage checkpoint after DNA repair, chromatin dynamics during transcription; and repression of divergent transcription; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000004570])

HSP 1 Score: 195.667 bits (496), Expect = 5.611e-57
Identity = 139/451 (30.82%), Postives = 232/451 (51.44%), Query Frame = 1
Query:   40 HLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCVHNGN----KDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTK-----SKEAV--PQKIDDD----DVNLESWSP-RSLR-----RHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVY-----RASTRTCI---YKVWKS-----GD----SKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYA---SNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYTLVGPQSM-KNPLKTIENTVESDDSK-SDAIYNL 1263
             + +H+ +P+Y+   Q  + +  +L T G D  VR+WKL+   NG     +    ++F+ +L  HE+ +NV+R++  G+VLASA DDG ++LW +      +E+V  P  +D +    D N E W   + LR         ++YD+ WS +  +++   +D    L+D+     V    DH  +VQGV WDPL+  +++QS+DR++ VY      A   T +    K+ K+     GD    + LF + +   FFRR   SP G L+V P+G Y+   + E AN +Y    S  +N             ++ A+ IP+ K   +   F+PV +    KS     KLPY+ +F +   N VL+YDT+   P+  + +IHY  ITD +W+ DG  L ++STDG+CS++  +     +  + + P +M   PL T E+ V + + + +  I N+
Sbjct:    7 QIYWHDSQPVYSLTFQKNSAN-DKLFTAGGDNKVRIWKLNRDENGQNGGVRKIESLDFLGSLTHHEQAINVIRFNSKGDVLASAGDDGQVLLWKQEDPNTQQESVVRPFGMDAETSEADENKEKWVVWKRLRGGSGATAAAEIYDLAWSPDNRNIVVACMDNSIRLFDVGAGMLVCGQSDHGHYVQGVAWDPLNQFILSQSADRSLHVYGVILSSAGVVTGLKLRSKIAKAELPCPGDVLRTNYLFHNETLPSFFRRCSISPCGGLVVIPSGVYKVAGD-EVANCVYVYTRSGILNSAGGVK-------NRPAIRIPSLKKPALMAAFSPVFYETCQKS---VLKLPYKLVFAIATTNEVLVYDTDVLEPLCVVGNIHYSPITDLAWSEDGSTLLISSTDGFCSYVSIDTET--QFGSRIEPPAMHAEPLDTDESAVAAKNQREAGGIVNM 443          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Yeast
Match: HIR1 (Subunit of the HIR complex; HIR is a nucleosome assembly complex involved in regulation of histone gene transcription; contributes to nucleosome formation, heterochromatic gene silencing, and formation of functional kinetochores [Source:SGD;Acc:S000000104])

HSP 1 Score: 139.428 bits (350), Expect = 1.981e-35
Identity = 112/389 (28.79%), Postives = 174/389 (44.73%), Query Frame = 1
Query:   67 IYTCDIQTKTDDFIRLATGGFDCSVRLWK----LHCVHNGN---KDFLPVEF---VANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRS-LRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEAN----DIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGK-----NAVIGVRFNPVRFSLKNKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYTL 1173
            IYT D+   + D  RLATGG D  +R+W     L C+   +   +  LP +    + +++RH   +  V++SP G  LAS SDD I+++W   +E   Q     +   E W+ R  L  H  D+ DICW+ + + L++  +D   I+W+     K+     H+  V+GV +DP +    T S DRTM+++R      I    +   ++ F++     +FRR  +SPDG+ +  P        +V   N    D   S   +D           L +    +   K     NA++G   + V    KN  S  A             D  + ++ T +  P++  FDI   SITD SW PDG  L V S D   +   FE  ELG+   L
Sbjct:   20 IYTVDV---SHDGKRLATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDLQMPLCSMSRHTGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKLKRFDVHQSLVKGVVFDPANKYFATTSDDRTMKIFRYHKTGDISFTIEHIITEPFKESPLTTYFRRPSWSPDGQHIAVPNATNGPVSSVAIVNRGTWDTNVSLIGHDAPTEVARFNPRLFERNAGVKQKKDDDPENALVGQNDDKVHHFDKNIDSVVA---------TAGQDKSLAVWSTSRPRPILVAFDIANKSITDMSWNPDGSLLFVASLDSSITLFKFENNELGKPIPL 396          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Yeast
Match: CIA1 (Component of cytosolic iron-sulfur protein assembly (CIA) machinery; acts at late step of Fe-S cluster assembly; forms CIA targeting complex with Cia2p and Met18p that directs Fe-S cluster incorporation into subset of proteins involved in methionine biosynthesis, DNA replication and repair, transcription, telomere maintenance; contains WD40 repeats; human homolog CIAO1 can complement yeast cia1 null mutant [Source:SGD;Acc:S000002675])

HSP 1 Score: 54.6842 bits (130), Expect = 1.303e-8
Identity = 43/169 (25.44%), Postives = 79/169 (46.75%), Query Frame = 1
Query:  112 LATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNK----VIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYR 606
            LATG  D  ++L     V     DF  ++ V +   H+K +  V W P  ++LA+ S D  + +W K + A        D   E      +  H  +V  + WS +  +L + S D    +W+   + +    + +L++H Q V+ V W P + ++ + S D T+R+++
Sbjct:   27 LATGSTDRKIKL-----VSVKYDDFTLID-VLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESA--------DRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWK 181          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Yeast
Match: PRP4 (Splicing factor; component of the U4/U6-U5 snRNP complex [Source:SGD;Acc:S000006382])

HSP 1 Score: 55.0694 bits (131), Expect = 1.579e-8
Identity = 37/144 (25.69%), Postives = 67/144 (46.53%), Query Frame = 1
Query:  193 VEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKS--KEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTR 618
            +  + +L  HE+R++ V++ PSG  + SAS D    LW  S  +E + Q+  D  V                 + + +  + + + SG +D  ++LWD+++ +KV+ L  H + +  V W P    V T   D  + V+    R
Sbjct:  255 LRLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGV-----------------FSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDIRKR 381          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 54.6842 bits (130), Expect = 1.922e-8
Identity = 40/134 (29.85%), Postives = 58/134 (43.28%), Query Frame = 1
Query:  202 VANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVY 603
            +A +  H+K VN V +SP G  + SAS D  I LW           D  D    S    + R H   VY + WS +   L+S S D    +WD++     + L  HK  V  V W      V +   D+ +R++
Sbjct:  395 IARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW-----------DGRDGKFIS----TFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Nematostella
Match: EDO38692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC75])

HSP 1 Score: 289.656 bits (740), Expect = 4.466e-93
Identity = 157/408 (38.48%), Postives = 230/408 (56.37%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKI-DDDDVNLESWS-PRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWK-----------SGDS----KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKS---------SQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVY 1167
            MKL+TP + +H  EP+ + D   K   F RLA+ G D  +++W + C  NG+ +   ++F++NL RH K VNVVR+SP   +LASA DD ++ +W  +  +  Q I DD++ NLE+W+  + LR H  DVYD+ WS +   L+SGSVD  AI+WD     K+ ILKDHK +VQGV WDPL   V+T SSDR+ R+Y + +  C Y + K            G++    ++F D +   FFRR  F+PDG   + PAG  E +  V               H  +IF R++ SK    + + K   + VR  P  F L++           + S  KLPYR +F +   + VL+YDT+Q +P   + +IHY  I+D +W+ +G  L ++STDGYCS +YF+ GELG  Y
Sbjct:    1 MKLVTPEIAWHGKEPVLSVDF-CKIGAFSRLASAGADTDIKIWSVTCSENGSNN---LKFLSNLTRHTKAVNVVRFSPKEELLASAGDDSVVFIWKLTCSSEHQHILDDENDNLETWTVSKMLRGHIEDVYDLAWSPDGTQLLSGSVDNSAIIWDAIKGTKLTILKDHKHYVQGVCWDPLGQYVVTNSSDRSCRLYNSLSYRCCYNINKLSANVMSKNTEKGEAIKPTRMFHDEAMLTFFRRPTFTPDGTHFIVPAGKLELQNQV--------------VHTTYIFSRNSPSKPVCFLQSPKKPTVAVRCCPAVFELRDSKESDKENSGRNSSLSKLPYRMVFAVATLDAVLLYDTQQQVPFAYVSNIHYSGISDMAWSNNGSTLVISSTDGYCSMLYFKDGELGTPY 390          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Nematostella
Match: EDO37673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF18])

HSP 1 Score: 153.295 bits (386), Expect = 1.683e-39
Identity = 123/397 (30.98%), Postives = 191/397 (48.11%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGF--DCS-VRLWKLHCVHNGNKDF---LPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSK--EAVP--QKIDDDDVNLESWS-PRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVI-ILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDS--KLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYT 1170
            M+L+ P+ V H+ +PI++ DI     D  R A GG   +C  V +W +  + N   +    +P + +  ++ H   VN VRWS +G  LAS  DD +I++W  ++   A+P  +      +N+E W    +LR+H  DV D+ WS +++ L SGSVD    +W+ +   +VI I+K H   V+GVTWDP+   + +QS D+T+RV+R +        W+   S  + F + S      RL +SPDG  +V+             A+ +  S PV     A I  R    K  +     + A+  VRFNP  F  K     +  K  Y        D  + I+ T    P+V + D+   SI D SW+  G  L V S DG  ++  F   ELG+  +
Sbjct:    1 MRLLKPNWVSHDGKPIFSIDIH---PDGSRFAVGGQGDECGKVSIWNMAPIKNEEDEMNENVP-KLLCQMDNHLACVNCVRWSGNGKYLASGGDDNLIMIWQMARYLGAMPTFESGGGGKLNIEQWRCVHTLRQHSGDVLDLAWSPDDSFLASGSVDNTVTIWNAQKFPEVIQIIKGHTGLVKGVTWDPVGKYLASQSDDKTLRVWRTTD-------WQQETSVTEPFLECSGTTHVLRLSWSPDGHYVVS-------------AHAMNNSGPV-----AKILERDGW-KTKMDFVGHRKAITCVRFNPKLFVKKVNGDSTRLK-QYSCCAIGCRDRSLSIWLTSLKRPLVVVHDLFNHSIMDVSWSQSGFELLVCSWDGSIAYANFTSEELGKAMS 366          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Nematostella
Match: EDO33297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL6])

HSP 1 Score: 65.855 bits (159), Expect = 1.103e-11
Identity = 45/176 (25.57%), Postives = 80/176 (45.45%), Query Frame = 1
Query:  211 LNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPA 738
            L  H K V+ V++S +G  LAS+S D +I +W     A   K +           +++  H L + D+ WS +  HL+S S D    +WD      +  LK H  +V    ++P  N++++ S D ++R++   T  C+  +    D               + F+ DG L+V+ +
Sbjct:   61 LTGHNKAVSSVKFSHNGEWLASSSADKVIKIW----GAYDGKFE-----------KTITGHKLGISDVAWSTDSRHLVSASDDKTLKIWDFATGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDP-----------VTAVHFNRDGALIVSSS 210          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Nematostella
Match: EDO37328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG41])

HSP 1 Score: 59.6918 bits (143), Expect = 5.281e-10
Identity = 48/169 (28.40%), Postives = 73/169 (43.20%), Query Frame = 1
Query:  100 DFIRLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYR 606
            D+ R+ TGG D  V++W          D    + +  L  H+  +  V +S  G + ASA+ D ++++W    EA   K               L+ H   V   C+S N   L SGS D  AI+W LKN     +L  H+  +Q   +      V T S D T+R++ 
Sbjct:   10 DWTRVVTGGDDDLVKIW----------DSKTGKVLFTLEHHDGAIKCVCFSSDGKLFASAAYDHLVMVW----EAATGK-----------QVFCLQGHTHSVETCCFSPNGAFLCSGSWDNTAIIWSLKNGMPTYVLNKHRNVIQTCAFSHDSKTVATGSWDCTVRLWH 153          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Nematostella
Match: EDO44795 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR9])

HSP 1 Score: 58.5362 bits (140), Expect = 1.350e-9
Identity = 52/210 (24.76%), Postives = 90/210 (42.86%), Query Frame = 1
Query:  109 RLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPA 738
            ++ +G  DC++R+W          D      +A L+ H   V  VR SP G V+AS+S D  I LW  S E +                RSL  H   V  + +S N   L+S ++D    +WD+++ N +  L  H  +   + + P   ++ +  +D  + ++  ST  C  +      + +   G    +   + FS DG LL + +
Sbjct:    2 KIFSGSEDCTIRVW----------DSKTGALLAQLDGHAGAVTCVRVSPDGGVIASSSADKTIRLWNPSDEFL----------------RSLEGHEDRVTSLAFSKNGKRLVSVALDKKLKVWDVESGNLLDTLTGHDGYPVCLDFSPDGMLLASTGADSNVIIWDISTARCYMQ-----GTIIALLGGHSDWVMDVAFSSDGALLTSGS 180          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Medaka
Match: chaf1b (chromatin assembly factor 1 subunit B [Source:NCBI gene;Acc:101171709])

HSP 1 Score: 325.479 bits (833), Expect = 3.842e-104
Identity = 177/406 (43.60%), Postives = 240/406 (59.11%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFI-RLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILW----TKSKEAVPQKIDDDD--VNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWK--------SGDSK---LFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSA--------FKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELG 1158
            MK++T  + +HN EP+Y+ D Q  TD  I RLAT G D +VRLW+     +G      V+F++NL RH K VNVVR+SP+G++LAS  DD  I+LW    TK  E  P   +D+D  +N ESWS  ++LR H  DVYD+CW+ N N ++SGSVD  AI+WD+    K+ IL DHK +VQGVTWDPL   V T S DR +RVY   T+     V K         G++K   +FQD S + FFRRL F+PDG  L+TPAG  E  +N+           +N T   +IF R +L +    +P    A + VR  PV F L+ K  +          FKLPYR +F +  ++ + +YDT+Q LP   + +IHY +++D SW+ DG  L V+STDGYCSF+ F  GELG
Sbjct:    1 MKVVTCEIAWHNKEPVYSLDFQHSTDGRIHRLATAGVDTTVRLWRADMGPDGKAV---VDFLSNLARHTKAVNVVRFSPNGDLLASGGDDAAILLWKLNDTKEPEQAPVFQEDEDALLNKESWSVVKTLRGHIEDVYDVCWTRNGNFMVSGSVDNTAIMWDVSKGQKLCILNDHKSYVQGVTWDPLGQYVATLSCDRVLRVYSTHTKKKAVTVSKMSSGQPAEGGEAKQYRMFQDDSMRSFFRRLSFTPDGSFLITPAGCVEVGENI-----------INTT---YIFSRKSLKRPVAHLPCPSKATLAVRCCPVYFELRTKKGEDGSIQDLPNLFKLPYRMVFAVASEDSIFLYDTQQSLPFGLVSNIHYHTLSDLSWSADGSFLAVSSTDGYCSFLSFSPGELG 389          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Medaka
Match: chaf1b (chromatin assembly factor 1 subunit B [Source:NCBI gene;Acc:101171709])

HSP 1 Score: 325.479 bits (833), Expect = 3.842e-104
Identity = 177/406 (43.60%), Postives = 240/406 (59.11%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFI-RLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILW----TKSKEAVPQKIDDDD--VNLESWSP-RSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWK--------SGDSK---LFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSA--------FKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELG 1158
            MK++T  + +HN EP+Y+ D Q  TD  I RLAT G D +VRLW+     +G      V+F++NL RH K VNVVR+SP+G++LAS  DD  I+LW    TK  E  P   +D+D  +N ESWS  ++LR H  DVYD+CW+ N N ++SGSVD  AI+WD+    K+ IL DHK +VQGVTWDPL   V T S DR +RVY   T+     V K         G++K   +FQD S + FFRRL F+PDG  L+TPAG  E  +N+           +N T   +IF R +L +    +P    A + VR  PV F L+ K  +          FKLPYR +F +  ++ + +YDT+Q LP   + +IHY +++D SW+ DG  L V+STDGYCSF+ F  GELG
Sbjct:    1 MKVVTCEIAWHNKEPVYSLDFQHSTDGRIHRLATAGVDTTVRLWRADMGPDGKAV---VDFLSNLARHTKAVNVVRFSPNGDLLASGGDDAAILLWKLNDTKEPEQAPVFQEDEDALLNKESWSVVKTLRGHIEDVYDVCWTRNGNFMVSGSVDNTAIMWDVSKGQKLCILNDHKSYVQGVTWDPLGQYVATLSCDRVLRVYSTHTKKKAVTVSKMSSGQPAEGGEAKQYRMFQDDSMRSFFRRLSFTPDGSFLITPAGCVEVGENI-----------INTT---YIFSRKSLKRPVAHLPCPSKATLAVRCCPVYFELRTKKGEDGSIQDLPNLFKLPYRMVFAVASEDSIFLYDTQQSLPFGLVSNIHYHTLSDLSWSADGSFLAVSSTDGYCSFLSFSPGELG 389          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Medaka
Match: hira (protein HIRA [Source:NCBI gene;Acc:101162764])

HSP 1 Score: 142.124 bits (357), Expect = 2.491e-35
Identity = 122/452 (26.99%), Postives = 202/452 (44.69%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCV---HNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDD---VNLESWSPRS-LRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKN-TNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSAF-KLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYTLVGPQSMKNPLKTIE-NTVESDD-SKSDAIYNLKMNLPMLQLDPTEILRVSNQENIASDS 1344
            MKL+ P  V HN +PI++ DI      F     G     V +W +  V    +   D +P + +  ++ H   VN VRWS +G  LAS  DD ++++W ++    P  +        N+E W   + LR H  DV D+ WS ++  L S SVD   ++W+ +     V  L+ H   V+G+TWDP+   + +Q+ D +++V+    RT  +++  +  +K F +        RL +SPDG+ LV+                   ++ +N++      V  +  K  +     + AV  V+FNP  F  K K+  S     PY        D  + ++ T    P+V I D+   SI D SW   G  + V S DG  +++ F   ELG+            PL   E NT+  +   KS AI N++  L    ++  E+L+   +    + +
Sbjct:    1 MKLLKPSWVSHNGKPIFSVDIHPDGTKFATGGQGEDSGKVMIWNMAPVLREEDEKNDNIP-KMLCQMDNHLACVNCVRWSNNGLYLASGGDDKLVMVWKRAALIGPSTVFGSSTKLANVEQWRCVTILRNHTGDVMDVAWSPHDVWLASCSVDNTIVIWNARKFPEMVTCLRGHTGLVKGLTWDPVGKYIASQADDHSLKVW----RTVDWQM-DANITKPFTECGGTTHVLRLSWSPDGQYLVS-------------------AHAMNNSGPTAQIVERDGWKTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSSPKPSAPYCCCAVGSKDRSLSVWLTSLKRPLVVIHDLFDKSIMDISWTLTGLGMLVCSMDGTVAYLDFSLDELGD------------PLNEEEKNTIHQNIYGKSLAITNMEAQLSTTIIENPEMLKYQQERQTTTQA 415          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 68.5514 bits (166), Expect = 3.214e-12
Identity = 47/176 (26.70%), Postives = 83/176 (47.16%), Query Frame = 1
Query:  211 LNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPA 738
            L  H K V+ V++SPSG  LAS+S D +I +W     A   K +           +++  H L + D+ WS + N L+S S D    +WD+ +   +  LK H  +V    ++P  N++++ S D ++R++   T  C+  +    D               + F+ DG L+V+ +
Sbjct:   40 LAGHTKAVSSVKFSPSGEWLASSSADKLIKIWG----AYDGKFE-----------KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDP-----------VSAVHFNRDGSLIVSSS 189          
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 68.1662 bits (165), Expect = 4.002e-12
Identity = 47/176 (26.70%), Postives = 83/176 (47.16%), Query Frame = 1
Query:  211 LNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPA 738
            L  H K V+ V++SPSG  LAS+S D +I +W     A   K +           +++  H L + D+ WS + N L+S S D    +WD+ +   +  LK H  +V    ++P  N++++ S D ++R++   T  C+  +    D               + F+ DG L+V+ +
Sbjct:   41 LAGHTKAVSSVKFSPSGEWLASSSADKLIKIWG----AYDGKFE-----------KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDP-----------VSAVHFNRDGSLIVSSS 190          
BLAST of Chromatin assembly factor 1 subunit B vs. Planmine SMEST
Match: SMESG000042345.1 (SMESG000042345.1)

HSP 1 Score: 1011.91 bits (2615), Expect = 0.000e+0
Identity = 505/509 (99.21%), Postives = 507/509 (99.61%), Query Frame = 1
Query:   22 MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYTLVGPQSMKNPLKTIENTVESDDSKSDAIYNLKMNLPMLQLDPTEILRVSNQENIASDSDTDNCSNGXXXXXXXXXXXXXXXXEEPVGAIDNEQSGIKRRNTIREPDDNKNSEPEPKKRRLTFITLS 1548
            MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGN+LASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYD+CWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGV WDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYTLVGPQSMKNPLKTIENTVESDDSKSDAIYNLKMNLPMLQLDPTEILRVSNQENIASDSDTDNCSNGDVDDKDIQIISDDDVKEEP GAIDNEQSGIKRRNTIREPDDNKNSEPEPKKRRLTFITLS
Sbjct:    1 MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCVHNGNKDFLPVEFVANLNRHEKRVNVVRWSPSGNILASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDVCWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVAWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEEANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSLKNKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDASWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYTLVGPQSMKNPLKTIENTVESDDSKSDAIYNLKMNLPMLQLDPTEILRVSNQENIASDSDTDNCSNGDVDDKDIQIISDDDVKEEPAGAIDNEQSGIKRRNTIREPDDNKNSEPEPKKRRLTFITLS 509          
BLAST of Chromatin assembly factor 1 subunit B vs. Planmine SMEST
Match: SMESG000055036.1 (SMESG000055036.1)

HSP 1 Score: 73.559 bits (179), Expect = 1.606e-13
Identity = 56/168 (33.33%), Postives = 87/168 (51.79%), Query Frame = 1
Query:  253 PSGNVLASASDD---GIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHF--LDVYDICWSLNENHLISGSVDCCAILWDL-KNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQ--DGSWKYFFRRLEFSPDGKLLVT 732
            PSG   A++      GII +W  + + +  K  + D N     P+ L   +  L++ D+ WS +  +L SGSVD   I+W++ K   K  IL  H  F++GV WDP+   + +QS D T+R++R S        WK  ++KL    D +    F+RL +SPDG  +V 
Sbjct:   30 PSGKKFATSGGGDKYGIISIW--NMDPIRNKEKETDENC----PKILYTDYTHLNIVDLAWSPHGTYLCSGSVDNRIIIWNVDKFPEKTAILNGHNSFIKGVCWDPVGRYLASQSEDHTLRIWRTSD-------WKQ-ETKLCDEIDKNSSCSFQRLTWSPDGSNIVA 183          
BLAST of Chromatin assembly factor 1 subunit B vs. Planmine SMEST
Match: SMESG000004578.1 (SMESG000004578.1)

HSP 1 Score: 73.559 bits (179), Expect = 1.620e-13
Identity = 56/168 (33.33%), Postives = 87/168 (51.79%), Query Frame = 1
Query:  253 PSGNVLASASDD---GIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHF--LDVYDICWSLNENHLISGSVDCCAILWDL-KNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQ--DGSWKYFFRRLEFSPDGKLLVT 732
            PSG   A++      GII +W  + + +  K  + D N     P+ L   +  L++ D+ WS +  +L SGSVD   I+W++ K   K  IL  H  F++GV WDP+   + +QS D T+R++R S        WK  ++KL    D +    F+RL +SPDG  +V 
Sbjct:   30 PSGKKFATSGGGDKYGIISIW--NMDPIRNKEKETDENC----PKILYTDYTHLNIVDLAWSPHGTYLCSGSVDNRIIIWNVDKFPEKTAILNGHNSFIKGVCWDPVGRYLASQSEDHTLRIWRTSD-------WKQ-ETKLCDEIDKNSSCSFQRLTWSPDGSNIVA 183          
BLAST of Chromatin assembly factor 1 subunit B vs. Planmine SMEST
Match: SMESG000004578.1 (SMESG000004578.1)

HSP 1 Score: 73.559 bits (179), Expect = 1.707e-13
Identity = 56/168 (33.33%), Postives = 87/168 (51.79%), Query Frame = 1
Query:  253 PSGNVLASASDD---GIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHF--LDVYDICWSLNENHLISGSVDCCAILWDL-KNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQ--DGSWKYFFRRLEFSPDGKLLVT 732
            PSG   A++      GII +W  + + +  K  + D N     P+ L   +  L++ D+ WS +  +L SGSVD   I+W++ K   K  IL  H  F++GV WDP+   + +QS D T+R++R S        WK  ++KL    D +    F+RL +SPDG  +V 
Sbjct:   30 PSGKKFATSGGGDKYGIISIW--NMDPIRNKEKETDENC----PKILYTDYTHLNIVDLAWSPHGTYLCSGSVDNRIIIWNVDKFPEKTAILNGHNSFIKGVCWDPVGRYLASQSEDHTLRIWRTSD-------WKQ-ETKLCDEIDKNSSCSFQRLTWSPDGSNIVA 183          
BLAST of Chromatin assembly factor 1 subunit B vs. Planmine SMEST
Match: SMESG000004578.1 (SMESG000004578.1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.474e-13
Identity = 43/119 (36.13%), Postives = 67/119 (56.30%), Query Frame = 1
Query:  385 RRHFLDVYDICWSLNENHLISGSVDCCAILWDL-KNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQ--DGSWKYFFRRLEFSPDGKLLVT 732
            +  ++D+ D+ WS +  +L SGSVD   I+W++ K   K  IL  H  F++GV WDP+   + +QS D T+R++R S        WK  ++KL    D +    F+RL +SPDG  +V 
Sbjct:   14 KYKYIDIVDLAWSPHGTYLCSGSVDNRIIIWNVDKFPEKTAILNGHNSFIKGVCWDPVGRYLASQSEDHTLRIWRTSD-------WKQ-ETKLCDEIDKNSSCSFQRLTWSPDGSNIVA 124          
The following BLAST results are available for this feature:
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHAF1B4.988e-9842.21chromatin assembly factor 1 subunit B [Source:HGNC... [more]
HIRA6.509e-3730.41histone cell cycle regulator [Source:HGNC Symbol;A... [more]
HIRA1.732e-3630.41histone cell cycle regulator [Source:HGNC Symbol;A... [more]
WDR5B2.760e-1230.15WD repeat domain 5B [Source:HGNC Symbol;Acc:HGNC:1... [more]
NLE11.644e-1129.59notchless homolog 1 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chaf-27.736e-4128.78CHromatin Assembly Factor [Source:UniProtKB/TrEMB... [more]
chaf-22.088e-3928.64CHromatin Assembly Factor [Source:UniProtKB/TrEMB... [more]
hira-12.044e-1624.00pep chromosome:WBcel235:III:5191131:5196028:1 gene... [more]
W07E6.24.795e-928.87pep chromosome:WBcel235:II:480722:483104:-1 gene:W... [more]
W07E6.22.141e-825.26pep chromosome:WBcel235:II:480722:484386:-1 gene:W... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Caf1-1051.038e-8837.92gene:FBgn0033526 transcript:FBtr0088310[more]
Hira5.217e-3529.34gene:FBgn0022786 transcript:FBtr0071070[more]
wds5.298e-1226.44gene:FBgn0040066 transcript:FBtr0308566[more]
wds5.298e-1226.44gene:FBgn0040066 transcript:FBtr0070438[more]
CG16715.332e-1028.17gene:FBgn0033454 transcript:FBtr0088373[more]
back to top
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chaf1b1.260e-10037.84chromatin assembly factor 1, subunit B [Source:ZFI... [more]
hira1.602e-3529.05histone cell cycle regulator a [Source:ZFIN;Acc:ZD... [more]
wdr54.821e-1329.50WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
wdr54.184e-1226.70WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
nle11.078e-1031.14notchless homolog 1 (Drosophila) [Source:ZFIN;Acc:... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
avpi11.233e-10341.44arginine vasopressin induced 1 [Source:Xenbase;Acc... [more]
avpi11.776e-10341.75arginine vasopressin induced 1 [Source:Xenbase;Acc... [more]
HIRA1.457e-3529.82histone cell cycle regulator [Source:NCBI gene;Acc... [more]
HIRA3.750e-3429.46histone cell cycle regulator [Source:NCBI gene;Acc... [more]
HIRA8.821e-3228.94histone cell cycle regulator [Source:NCBI gene;Acc... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chaf1b8.235e-9740.00chromatin assembly factor 1, subunit B (p60) [Sour... [more]
Chaf1b8.235e-9740.00chromatin assembly factor 1, subunit B (p60) [Sour... [more]
Hira2.817e-3630.15histone cell cycle regulator [Source:MGI Symbol;Ac... [more]
Hira1.180e-3030.18histone cell cycle regulator [Source:MGI Symbol;Ac... [more]
Chaf1b1.043e-2148.96chromatin assembly factor 1, subunit B (p60) [Sour... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R1S9|CAF1B_CHICK3.657e-10343.95Chromatin assembly factor 1 subunit B OS=Gallus ga... [more]
sp|Q13112|CAF1B_HUMAN2.396e-9742.21Chromatin assembly factor 1 subunit B OS=Homo sapi... [more]
sp|Q9D0N7|CAF1B_MOUSE5.760e-9640.00Chromatin assembly factor 1 subunit B OS=Mus muscu... [more]
sp|Q9SXY1|FAS2_ARATH1.778e-7235.87Chromatin assembly factor 1 subunit FAS2 OS=Arabid... [more]
sp|Q6ZD63|FAS2_ORYSJ5.889e-6531.46Chromatin assembly factor 1 subunit FAS2 homolog O... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KQ461.142e-10336.17Chromatin assembly factor I P60 subunit,putative O... [more]
A0A091TY313.378e-10143.70Chromatin assembly factor 1 subunit B (Fragment) O... [more]
G1NNY24.046e-10144.20Chromatin assembly factor 1 subunit B OS=Meleagris... [more]
A0A087R9554.322e-10144.20Chromatin assembly factor 1 subunit B (Fragment) O... [more]
A8E5V85.494e-10141.44LOC100127620 protein (Fragment) OS=Xenopus tropica... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chaf1b2.158e-9838.53chromatin assembly factor 1 subunit B [Source:NCBI... [more]
ENSAMXT00000007962.22.010e-1230.22WD repeat-containing protein 5-like [Source:NCBI g... [more]
ENSAMXT00000052579.12.010e-1230.22WD repeat-containing protein 5-like [Source:NCBI g... [more]
ENSAMXT00000007963.22.026e-1227.59WD repeat-containing protein 5-like [Source:NCBI g... [more]
wdr52.834e-1226.70WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POC1A5.253e-1222.60POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
ciao11.506e-927.75cytosolic iron-sulfur assembly component 1 [Source... [more]
ENSPMAT00000004242.14.576e-826.90pep scaffold:Pmarinus_7.0:GL482741:5889:16850:1 ge... [more]
pafah1b1b4.675e-824.66platelet-activating factor acetylhydrolase 1b, reg... [more]
ENSPMAT00000003168.11.644e-733.02pep scaffold:Pmarinus_7.0:GL476396:632759:655100:1... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CAC25.611e-5730.82Subunit of chromatin assembly factor I (CAF-1), wi... [more]
HIR11.981e-3528.79Subunit of the HIR complex; HIR is a nucleosome as... [more]
CIA11.303e-825.44Component of cytosolic iron-sulfur protein assembl... [more]
PRP41.579e-825.69Splicing factor; component of the U4/U6-U5 snRNP c... [more]
RSA41.922e-829.85WD-repeat protein involved in ribosome biogenesis;... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO386924.466e-9338.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376731.683e-3930.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332971.103e-1125.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373285.281e-1028.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447951.350e-924.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chaf1b3.842e-10443.60chromatin assembly factor 1 subunit B [Source:NCBI... [more]
chaf1b3.842e-10443.60chromatin assembly factor 1 subunit B [Source:NCBI... [more]
hira2.491e-3526.99protein HIRA [Source:NCBI gene;Acc:101162764][more]
wdr53.214e-1226.70WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
wdr54.002e-1226.70WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042345.10.000e+099.21SMESG000042345.1[more]
SMESG000055036.11.606e-1333.33SMESG000055036.1[more]
SMESG000004578.11.620e-1333.33SMESG000004578.1[more]
SMESG000004578.11.707e-1333.33SMESG000004578.1[more]
SMESG000004578.14.474e-1336.13SMESG000004578.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003162 ID=SMED30003162|Name=Chromatin assembly factor 1 subunit B|organism=Schmidtea mediterranea sexual|type=transcript|length=1598bp
CTATATAAATCTTATATGTAAATGAAGTTGATAACTCCACACTTAGTTTA
TCATAATATTGAACCGATTTATACATGTGACATTCAAACCAAAACTGATG
ATTTTATTCGATTAGCCACTGGTGGCTTTGATTGTTCAGTTAGATTGTGG
AAACTTCATTGTGTTCATAATGGTAATAAGGATTTTTTACCGGTGGAATT
TGTTGCAAATCTTAATAGACATGAAAAGAGAGTTAATGTTGTGCGATGGT
CTCCCTCAGGCAATGTTCTTGCATCTGCCAGTGATGACGGTATTATTATA
CTGTGGACAAAAAGCAAGGAAGCTGTACCTCAAAAAATTGATGATGATGA
TGTTAATTTAGAGTCATGGTCACCGAGAAGTTTGAGACGACATTTTCTTG
ACGTTTATGATATTTGTTGGTCATTGAATGAGAATCATTTGATATCTGGT
TCTGTTGATTGTTGTGCGATTTTATGGGATTTAAAAAATACTAATAAAGT
TATTATTTTGAAAGACCATAAACAATTTGTCCAGGGAGTAACATGGGATC
CGTTGGACAATGTTGTCATTACACAGAGTTCCGATAGAACAATGCGAGTC
TATAGGGCTAGCACCAGAACCTGCATTTATAAAGTGTGGAAATCTGGAGA
TTCAAAATTATTTCAAGATGGGTCTTGGAAATATTTCTTCCGCCGATTAG
AGTTTAGTCCTGACGGCAAATTGCTCGTGACACCAGCTGGATTTTATGAG
AGAAAGAAAAACGTGGAAGAAGCGAATGACATTTATGCGTCAAATCCAGT
TAATGATACCCACGCGGCCCACATTTTCGTACGGCACAACCTGTCAAAGG
TCGCTGTCACTATTCCCACCGGTAAGAATGCCGTTATTGGGGTGAGATTC
AATCCGGTGCGATTCAGTTTGAAGAACAAATCGAGCCAATCAGCTTTCAA
ACTACCATATCGGTGGATATTTTGCCTGGTTTTGGACAATGGCGTGCTTA
TATATGACACCGAGCAGTGTTTACCCGTTGTTAAGATATTCGATATCCAC
TATTTGTCTATCACTGACGCGAGCTGGGCTCCTGATGGGCATTGCCTCAC
TGTCACCTCAACTGATGGATATTGCTCTTTTATTTATTTTGAAAAGGGCG
AGCTCGGTGAAGTTTATACGTTAGTTGGGCCTCAGTCAATGAAGAACCCA
CTGAAAACCATTGAGAATACCGTGGAATCCGATGATTCTAAATCCGATGC
GATCTATAATCTAAAGATGAATCTACCGATGCTTCAATTGGATCCAACGG
AAATATTGCGTGTCAGTAACCAGGAAAATATCGCGTCAGATTCTGATACA
GATAATTGCTCAAATGGCGATGTCGATGATAAAGATATTCAGATAATTTC
AGACGATGACGTTAAAGAAGAACCAGTGGGAGCTATTGACAACGAACAGA
GTGGTATCAAACGCAGAAATACTATCCGGGAGCCTGATGACAATAAGAAC
TCTGAACCCGAACCGAAGAAGAGGCGGCTTACATTTATTACGCTGTCATA
GGTCCTCTATTGGTCTAAATTTTTGTATAATAAATTTTATTAGTCGAA
back to top

protein sequence of SMED30003162-orf-1

>SMED30003162-orf-1 ID=SMED30003162-orf-1|Name=SMED30003162-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=510bp
MKLITPHLVYHNIEPIYTCDIQTKTDDFIRLATGGFDCSVRLWKLHCVHN
GNKDFLPVEFVANLNRHEKRVNVVRWSPSGNVLASASDDGIIILWTKSKE
AVPQKIDDDDVNLESWSPRSLRRHFLDVYDICWSLNENHLISGSVDCCAI
LWDLKNTNKVIILKDHKQFVQGVTWDPLDNVVITQSSDRTMRVYRASTRT
CIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPAGFYERKKNVEE
ANDIYASNPVNDTHAAHIFVRHNLSKVAVTIPTGKNAVIGVRFNPVRFSL
KNKSSQSAFKLPYRWIFCLVLDNGVLIYDTEQCLPVVKIFDIHYLSITDA
SWAPDGHCLTVTSTDGYCSFIYFEKGELGEVYTLVGPQSMKNPLKTIENT
VESDDSKSDAIYNLKMNLPMLQLDPTEILRVSNQENIASDSDTDNCSNGD
VDDKDIQIISDDDVKEEPVGAIDNEQSGIKRRNTIREPDDNKNSEPEPKK
RRLTFITLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000790nuclear chromatin
GO:0005654nucleoplasm
GO:0032991macromolecular complex
GO:0005634nucleus
GO:0033186CAF-1 complex
Vocabulary: biological process
TermDefinition
GO:0006335DNA replication-dependent nucleosome assembly
GO:0006260DNA replication
GO:0006281DNA repair
GO:0006334nucleosome assembly
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006974cellular response to DNA damage stimulus
GO:0007049cell cycle
GO:0031497chromatin assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0042393histone binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 114..153
e-value: 1.1E-4
score: 31.5
coord: 156..195
e-value: 0.0018
score: 27.5
coord: 6..44
e-value: 73.0
score: 5.3
coord: 333..372
e-value: 4.0
score: 13.2
coord: 57..96
e-value: 2.2E-8
score: 43.9
IPR001680WD40 repeatPFAMPF00400WD40coord: 64..95
e-value: 2.0E-4
score: 22.1
coord: 119..153
e-value: 0.024
score: 15.5
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 121..162
score: 10.041
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 64..95
score: 13.65
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 163..204
score: 10.508
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 14..119
e-value: 2.4E-16
score: 61.6
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 120..444
e-value: 8.3E-31
score: 109.4
NoneNo IPR availablePANTHERPTHR15271CHROMATIN ASSEMBLY FACTOR 1 SUBUNIT Bcoord: 210..459
coord: 1..197
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 140..154
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 31..204
score: 23.229
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 15..378