slc15a-1

Overview
Nameslc15a-1 (AKN21487.1)
Smed IDSMED30003156
Length (bp)2462
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc15a-1 (SMED30003156) t-SNE clustered cells

Violin plots show distribution of expression levels for slc15a-1 (SMED30003156) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc15a-1 (SMED30003156) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc15a-1 (SMED30003156) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003156

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003156SMESG000039777.1 SmedASXL_013413SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30003156SMESG000039777.1 dd_Smed_v4_6994_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003156SMESG000039777.1 dd_Smed_v4_6994_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30003156SMESG000039777.1 dd_Smed_v6_6994_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30003156SMESG000041249.1 SMESG000039777.1 SMESG000032342.1 OX_Smed_1.0.17674ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc15a-1 vs. Ensembl Human
Match: SLC15A2 (solute carrier family 15 member 2 [Source:HGNC Symbol;Acc:HGNC:10921])

HSP 1 Score: 333.183 bits (853), Expect = 5.510e-102
Identity = 243/730 (33.29%), Postives = 380/730 (52.05%), Query Frame = 2
Query:  212 CSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIP-----AINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFL--VNSHPCEVQMT-IGNA-YTLVSGGYKISQSS-------IDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGV-LAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRMQELTEHVE*LRNN 2344
            C S  ++P ++ FI++ E CERFSYYGM+ +LILY    L   E  + SIYH F SLCYFT I+G+ I+D++LGK++T++ L  +Y LG  + SL ++P      ++    +I L LIA GTGG+K CV   GGDQ           YFS+FY  IN G+L ST +TP+LR +V C G +DCY LAFG+P +LM +AL++  +G K Y   P   +I  +   C   A+ N ++ R    PK++  L++A+ +Y    I D++ + R+  LY+PLP++WAL +Q GSRWTLQA +M+  L    V+ PDQM +LN ++V++ IP+FD  IY +          LR+M +G+   CL+   A A   +I+  +  P   G   +FL  +N    EV++T +GN   +L+    K  Q +       +      ++  LKY   +L  +        + V ++N Y L   E+   IS       +     G    + V +            H    + L+   ++   +    S + T+ + G Y          P V   T   D   SLN   L+     +        +++ +N  Q +    +     + +SI WQ PQY L++ GE++ S+TGL FSY QAP  MKS++ A W L+ A GNIIV+VVA+   + + + E+++F+ L +V  +IF+ + YYY   K E  D      +H+  ++ N
Sbjct:   38 CGS--NYPLSIAFIVVNEFCERFSYYGMKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVYVLGHVIKSLGALPILGGQVVHTVLSLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEERTRYFSVFYLSINAGSLISTFITPMLRGDVQCFG-EDCYALAFGVPGLLMVIALVVFAMGSKIYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHWLDWAAEKYPKQLIMDVKALTRVLFLYIPLPMFWALLDQQGSRWTLQAIRMNRNLG-FFVLQPDQMQVLNPLLVLIFIPLFDFVIYRLVSKCGINFSSLRKMAVGMILACLA--FAVAAAVEIKINEMAPAQPGPQEVFLQVLNLADDEVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTE--------HSVQEKNWYSLVIREDGNSISSMMVKDTESRTTNGMTTVRFVNTL-----------HKDVNISLSTDTSLNVGEDYGVSAYRTVQR-GEY----------PAVHCRTE--DKNFSLNLGLLDFGAAYL--------FVITNNTNQGLQAWKIEDIPANKMSIAWQLPQYALVTAGEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTIAVGNIIVLVVAQFSGLVQWA-EFILFSCLLLVICLIFSIMGYYYVPVKTE--DMRGPADKHIPHIQGN 718          
BLAST of slc15a-1 vs. Ensembl Human
Match: SLC15A2 (solute carrier family 15 member 2 [Source:HGNC Symbol;Acc:HGNC:10921])

HSP 1 Score: 312.383 bits (799), Expect = 1.582e-94
Identity = 236/725 (32.55%), Postives = 365/725 (50.34%), Query Frame = 2
Query:  212 CSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFL--VNSHPCEVQMT-IGNA-YTLVSGGYKISQSS-------IDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGV-LAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRMQELTEHVE*LRNN 2344
            C S  ++P ++ FI++ E CERFSYYGM+ +LILY    L   E  + SIYH F SLCYFT I+G+ I+D++LGK++ L                           +I L LIA GTGG+K CV   GGDQ           YFS+FY  IN G+L ST +TP+LR +V C G +DCY LAFG+P +LM +AL++  +G K Y   P   +I  +   C   A+ N ++ R    PK++  L++A+ +Y    I D++ + R+  LY+PLP++WAL +Q GSRWTLQA +M+  L    V+ PDQM +LN ++V++ IP+FD  IY +          LR+M +G+   CL+   A A   +I+  +  P   G   +FL  +N    EV++T +GN   +L+    K  Q +       +      ++  LKY   +L  +        + V ++N Y L   E+   IS       +     G    + V +            H    + L+   ++   +    S + T+ + G Y          P V   T   D   SLN   L+     +        +++ +N  Q +    +     + +SI WQ PQY L++ GE++ S+TGL FSY QAP  MKS++ A W L+ A GNIIV+VVA+   + + + E+++F+ L +V  +IF+ + YYY   K E  D      +H+  ++ N
Sbjct:   38 CGS--NYPLSIAFIVVNEFCERFSYYGMKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKVL--------------------------SLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEERTRYFSVFYLSINAGSLISTFITPMLRGDVQCFG-EDCYALAFGVPGLLMVIALVVFAMGSKIYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHWLDWAAEKYPKQLIMDVKALTRVLFLYIPLPMFWALLDQQGSRWTLQAIRMNRNLG-FFVLQPDQMQVLNPLLVLIFIPLFDFVIYRLVSKCGINFSSLRKMAVGMILACLA--FAVAAAVEIKINEMAPAQPGPQEVFLQVLNLADDEVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTE--------HSVQEKNWYSLVIREDGNSISSMMVKDTESRTTNGMTTVRFVNTL-----------HKDVNISLSTDTSLNVGEDYGVSAYRTVQR-GEY----------PAVHCRTE--DKNFSLNLGLLDFGAAYL--------FVITNNTNQGLQAWKIEDIPANKMSIAWQLPQYALVTAGEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTIAVGNIIVLVVAQFSGLVQWA-EFILFSCLLLVICLIFSIMGYYYVPVKTE--DMRGPADKHIPHIQGN 687          
BLAST of slc15a-1 vs. Ensembl Human
Match: SLC15A1 (solute carrier family 15 member 1 [Source:HGNC Symbol;Acc:HGNC:10920])

HSP 1 Score: 280.796 bits (717), Expect = 1.234e-82
Identity = 155/385 (40.26%), Postives = 238/385 (61.82%), Query Frame = 2
Query:  209 RCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAI---NLSG-----------PIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRA-NVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPL 1312
            +  S F +P +++FI++ E CERFSYYGMR ILILY T  +   ++ + +IYH FV+LCY T I+G+ I+D++LGK++T+V L  +YT+G  + S++SI  +   N  G            +I L LIA GTGG+K CV   GGDQ    ++   + +FS+FY  IN G+L STI+TP+LR      +    CYPLAFG+PA LM VAL++ +LG   Y     + +I  K   C   A+KN +R R  + PK+E  L++A  +YD   I+ ++ + R+  LY+PLP++WAL++Q GSRWTLQA  M G++   L I PDQM  +N I++++++PIFD+ +YP+          L++M +G+    ++F  A  +Q +I+   P+
Sbjct:    5 KSHSFFGYPLSIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFVALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVTSVSSINDLTDHNHDGTPDSLPVHVVLSLIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTIITPMLRVQQCGIHSKQACYPLAFGVPAALMAVALIVFVLGSGMYKKFKPQGNIMGKVAKCIGFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMVTRVMFLYIPLPMFWALFDQQGSRWTLQATTMSGKIG-ALEIQPDQMQTVNAILIVIMVPIFDAVLYPLIAKCGFNFTSLKKMAVGMVLASMAFVVAAIVQVEIDKTLPV 388          

HSP 2 Score: 93.2041 bits (230), Expect = 7.793e-19
Identity = 46/96 (47.92%), Postives = 66/96 (68.75%), Query Frame = 2
Query: 1985 NGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            + +T+++  Q PQY L++ GE++ S+TGL FSY QAP  MKS++ A W L+ A GNIIV++VA      KQ  EY++FA L +V  VIFA +A +Y
Sbjct:  575 SANTVNMALQIPQYFLLTCGEVVFSVTGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVCVIFAIMARFY 670          
BLAST of slc15a-1 vs. Ensembl Human
Match: SLC15A2 (solute carrier family 15 member 2 [Source:HGNC Symbol;Acc:HGNC:10921])

HSP 1 Score: 119.013 bits (297), Expect = 1.960e-30
Identity = 61/135 (45.19%), Postives = 84/135 (62.22%), Query Frame = 2
Query:  341 ESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIP-----AINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNG 730
            E  + SIYH F SLCYFT I+G+ I+D++LGK++T++ L  +Y LG  + SL ++P      ++    +I L LIA GTGG+K CV   GGDQ           YFS+FY  IN G+L ST +TP+LR +V C G
Sbjct:   17 EDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVYVLGHVIKSLGALPILGGQVVHTVLSLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEERTRYFSVFYLSINAGSLISTFITPMLRGDVQCFG 151          
BLAST of slc15a-1 vs. Ensembl Human
Match: SLC15A4 (solute carrier family 15 member 4 [Source:HGNC Symbol;Acc:HGNC:23090])

HSP 1 Score: 89.7373 bits (221), Expect = 6.397e-18
Identity = 94/393 (23.92%), Postives = 177/393 (45.04%), Query Frame = 2
Query:  251 IIITELCERFSYYGMRXXXXXXXXXXXXXKE-SNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPA-----------INLSGP-------------IISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIY--MKTISCFITAVKNWYRERHN----------SPKKELLEYASSEYDAAF----INDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQ-----MSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQ 1291
            +++TEL ER ++YG+ + L+L+L       E + A     +F+ L Y  +  G +++D  LG+ R +++  +LY LG     L + PA           +N + P                L+L+  G   VKA + P G DQ+          +F+ FY+ INLGA+ S      ++ NV+       +   + IP + +G+A ++ L G   ++  P   S +  M  I  +    +    ER +          S K+ L +     +   F    + D++ +++I  ++L L  YW +Y QM + + LQ+  +     +N+   P       +++ + +++++LIP+ D  + PI          L+R+ +G+ F   S FAA  L+ +
Sbjct:   40 VLLTELLERAAFYGITSNLVLFLNGAPFCWEGAQASEALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGMLAFPLLAAPATRAALCGSARLLNCTAPGPDAAARCCSPATFAGLVLVGLGVATVKANITPFGADQVKDRGPEATRRFFNWFYWSINLGAILSLGGIAYIQQNVS-------FVTGYAIPTVCVGLAFVVFLCGQSVFITKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEGIGVFQQSSKQSLFDSCKMSHGGPFTEEKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYVLQSLHLRIPEISNITTTPHTLPAAWLTMFDAVLILLLIPLKDKLVDPILRRHGLLPSSLKRIAVGMFFVMCSAFAAGILESK 425          

HSP 2 Score: 51.9878 bits (123), Expect = 3.724e-6
Identity = 26/57 (45.61%), Postives = 37/57 (64.91%), Query Frame = 2
Query: 1949 EQTV-ITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLV 2116
            E+T+  TI  ++ + + +S+ WQ PQYLLI I EI  SI GL F+Y  AP  M+S +
Sbjct:  432 EKTINQTIGNVVYHAADLSLWWQVPQYLLIGISEIFASIAGLEFAYSAAPKSMQSAI 488          
BLAST of slc15a-1 vs. Ensembl Celegans
Match: pept-3 (Peptide transporter 3 [Source:UniProtKB/Swiss-Prot;Acc:O01840])

HSP 1 Score: 301.597 bits (771), Expect = 8.259e-91
Identity = 214/710 (30.14%), Postives = 359/710 (50.56%), Query Frame = 2
Query:  197 EDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSGPIIS------LLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFY-VHVPIRDSIYMKTISCFITAVKNWY-RERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDG--TYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNV-----PSNT-SKWD--GVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            E++        +P AV+F++  E CERFS+YGM+TIL +YL        S A  IYH+F  + Y T +IGS ++D+  G+++ ++   S+Y +G  L+SL ++P   LS PI S      L +IAF TG +K CV     DQ    +K L   +FS FYF IN G+L + I+TPILR  V C G   C+PLAFG+P +LM +AL++ L+G   Y  H P ++++  K ++   T+++        + P    L++A+ E+    I+  R +L +A+++ PL  +WAL++Q GS W LQA ++DG +  +  ILP+Q+  +N + V++L+PIF+  +YP    I+ ++ PLR+M +G   T  SF  A  LQ ++      P ++G   L  V +          +   L+  G  + +   +L  G  T+N  LK       +QE      I++      Y+++       + V  F    +    G    ++   TA  +    +   +  G + +S                 +K+G Y+  +   +  PNV     P N+ S  D    ++LN     V+ + I  S     + +L  P              +++SI+W  PQY++I++GE+L+S+TGL F+Y QA   MKS++ A W L+   GN+I M+++   L+   + E+  ++ L ++   +F  LA  Y
Sbjct:    2 EEKSLLQKLRSYPPAVFFMLGNEFCERFSFYGMKTILFIYLITEHEFSPSKATFIYHLFTCIAYLTPLIGSIMADSVFGRFKVILYGSSIYVVGHVLLSLGAVPF--LSYPIRSSLDFSGLFVIAFATGCIKPCVSAFAADQFTEDQKDLRSQFFSFFYFAINGGSLFAIIITPILRGRVQCFGNAHCFPLAFGVPGVLMLLALILFLMGWSMYKKHPPSKENVGSKVVAVIYTSLRKMVGGASRDKPVTHWLDHAAPEHSQKMIDSTRGLLNVAVIFCPLIFFWALFDQQGSTWVLQARRLDGRVG-HFSILPEQIHAINPVCVLILVPIFEGWVYPALRKIT-RVTPLRKMAVGGLLTAFSFAIAGVLQLKVNETMEFPPSLGRIYLQRVGNESLISDFRYKSDGRLIGDGM-LPKGRTELDAGIYTFNTGLKNE-----SQE------IDISTPNKGYVMAVFRLKDAVEVVKFDYKVEKTDNGA--TRVFVVTAREDADTLVYAINKKGKILSSCE---------------LKSGSYVDVIPGIISDPNVRLYWGPKNSCSGVDCPNTVTLNAQMGAVHVLHIHPSTTEGDFNLLVRP--------------NSVSILWSLPQYIIITLGEVLLSVTGLEFAYSQAAPNMKSVLTAMWLLTVFAGNLIDMMISGTRLIPHPALEFFFYSTLMVIVMGVFILLAMQY 664          
BLAST of slc15a-1 vs. Ensembl Celegans
Match: pept-1 (Peptide transporter family 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21219])

HSP 1 Score: 261.151 bits (666), Expect = 6.952e-75
Identity = 153/415 (36.87%), Postives = 237/415 (57.11%), Query Frame = 2
Query:  227 HFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSI--------PAINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAA----------------------FINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTI 1381
            H+P+    I+  E CERFSYYGMRT+L  YL   L   +S +   ++ F  LCY T ++GS ++D Y+GK+ T+  +  LY +G  +++L S         P ++LSG    LL+IAFGTGG+K CV   GGDQ    ++ +L  +FSMFYF IN G++ ST ++PI R+   C G D CYP+AFGIPAILM VA L+ + G  +Y   P +D+++ +       AV N  +   ++PK+  L +  + +D A                      FI+D+R++LR+ +++LP+P++WALY+Q GS W +QA QMD  L++ L++LPDQM  LN +++++ IP+F   IYP++     +L PLR+M  G     L+F     +Q Q+    P     G + +   N    +  +T+
Sbjct:   43 HWPKTTLCIVSNEFCERFSYYGMRTVLTFYLLNVLKFTDSQSTIFFNGFTVLCYTTPLLGSIVADGYIGKFWTIFSVSILYAIGQVVLALASTKNFQSSVHPWMDLSG----LLIIAFGTGGIKPCVSAFGGDQFELGQERMLSLFFSMFYFSINAGSMISTFISPIFRSQ-PCLGQDSCYPMAFGIPAILMIVATLVFMGGSFWYKKNPPKDNVFGEVSRLMFRAVGNKMKSG-STPKEHWLLHYLTTHDCALDAKCLELQAEKRNKNLCQKKKFIDDVRSLLRVLVMFLPVPMFWALYDQQGSVWLIQAIQMDCRLSDTLLLLPDQMQTLNAVLILLFIPLFQVIIYPVAAKCV-RLTPLRKMVTGGLLASLAFLITGFVQLQVNTTLPTLPEEGEASISFWNQFETDCTITV 450          

HSP 2 Score: 77.0258 bits (188), Expect = 3.437e-14
Identity = 41/124 (33.06%), Postives = 72/124 (58.06%), Query Frame = 2
Query: 1898 RITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYY 2269
            R+    V I+ +  +     +  + ++ +N  ++SI+WQ PQ ++I+  EIL SITG  F+Y Q+   MK+LV A W L+ A G+ I++V+  ++L E  + E+ ++A    V   IFA L+ +
Sbjct:  664 RVKQGGVFIYALTGTYENPKIHELQIVQSN--SVSILWQIPQIVVITAAEILFSITGYEFAYSQSAPSMKALVQALWLLTTAAGDSIIVVITILNLFENMAVEFFVYAAAMFVVIAIFALLSIF 785          
BLAST of slc15a-1 vs. Ensembl Celegans
Match: pept-2 (Peptide transporter family 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17758])

HSP 1 Score: 233.802 bits (595), Expect = 1.903e-65
Identity = 148/405 (36.54%), Postives = 228/405 (56.30%), Query Frame = 2
Query:  230 FPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSI-PAINLSGP---IISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAA----------------FINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHP-CEVQMTI 1381
            +P+  + I+  ELCERFS+YGMR +L LY    L   +S +  ++H F  +CY + ++GS ++D Y+GK+ T+  +   Y  G  L++ +SI P+ +   P   ++ LL++  GTGG+K CV   GGDQ PAH   ++  +FSMFYF IN G+L S  LTP  R+ ++C G D CYPLAFGIPAILM VA L+ + G  +Y  VP +++I  K I    TA++          +   LEY+   +D A                +I D++ + R+ ++ +P+P++WALY+Q GS W LQA  MD ++     ILPDQM +LN  +++  IPIF S +YP    +  ++  LR+M  G   T +SFF    +Q  +    P       + L ++N+ P C+  + I
Sbjct:   30 WPKQTFLIVGNELCERFSFYGMRAVLTLYFFNILNFSQSFSTVLFHAFTVICYSSPLLGSILADGYIGKFWTIFFISIFYACGQILLAFSSIAPSGSSHHPLLDLLGLLIVGLGTGGIKPCVSAFGGDQFPAHYTRMISLFFSMFYFSINAGSLISMWLTPYFRS-MSCFGHDSCYPLAFGIPAILMIVATLVFMAGSFWYKKVPPKENIIFKVIGTITTALRKKASSSSTHQRSHWLEYSLDGHDCALSTECKNLHGNCAQRRYIEDIKRLFRVIVMMIPVPMFWALYDQQGSTWVLQAVGMDAKVF-GFEILPDQMGVLNAFLILFFIPIFQSIVYPTIEKLGFQMTMLRKMAGGGILTAVSFFVCGIVQLFVNPTLPYIPMANEAHLTIINTIPSCDFNVLI 432          

HSP 2 Score: 74.3294 bits (181), Expect = 2.181e-13
Identity = 34/93 (36.56%), Postives = 60/93 (64.52%), Query Frame = 2
Query: 1997 ISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFA--ILCIVFNVIFAGLAYY 2269
            +SI+WQ PQY++++ GE+L SITGL F+Y +A   +KS+V A W  + A G++IV+V+  +++    + +  +F   +L ++F  I   + YY
Sbjct:  668 VSILWQIPQYVILTAGEVLFSITGLEFAYTEASPQLKSVVQALWLFTTAIGDLIVVVIFMLNIFSDVAVQMFVFGGIMLFVIFVFILLAVFYY 760          
BLAST of slc15a-1 vs. Ensembl Celegans
Match: pept-2 (Peptide transporter family 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17758])

HSP 1 Score: 233.802 bits (595), Expect = 1.903e-65
Identity = 148/405 (36.54%), Postives = 228/405 (56.30%), Query Frame = 2
Query:  230 FPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSI-PAINLSGP---IISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAA----------------FINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHP-CEVQMTI 1381
            +P+  + I+  ELCERFS+YGMR +L LY    L   +S +  ++H F  +CY + ++GS ++D Y+GK+ T+  +   Y  G  L++ +SI P+ +   P   ++ LL++  GTGG+K CV   GGDQ PAH   ++  +FSMFYF IN G+L S  LTP  R+ ++C G D CYPLAFGIPAILM VA L+ + G  +Y  VP +++I  K I    TA++          +   LEY+   +D A                +I D++ + R+ ++ +P+P++WALY+Q GS W LQA  MD ++     ILPDQM +LN  +++  IPIF S +YP    +  ++  LR+M  G   T +SFF    +Q  +    P       + L ++N+ P C+  + I
Sbjct:   30 WPKQTFLIVGNELCERFSFYGMRAVLTLYFFNILNFSQSFSTVLFHAFTVICYSSPLLGSILADGYIGKFWTIFFISIFYACGQILLAFSSIAPSGSSHHPLLDLLGLLIVGLGTGGIKPCVSAFGGDQFPAHYTRMISLFFSMFYFSINAGSLISMWLTPYFRS-MSCFGHDSCYPLAFGIPAILMIVATLVFMAGSFWYKKVPPKENIIFKVIGTITTALRKKASSSSTHQRSHWLEYSLDGHDCALSTECKNLHGNCAQRRYIEDIKRLFRVIVMMIPVPMFWALYDQQGSTWVLQAVGMDAKVF-GFEILPDQMGVLNAFLILFFIPIFQSIVYPTIEKLGFQMTMLRKMAGGGILTAVSFFVCGIVQLFVNPTLPYIPMANEAHLTIINTIPSCDFNVLI 432          

HSP 2 Score: 74.3294 bits (181), Expect = 2.181e-13
Identity = 34/93 (36.56%), Postives = 60/93 (64.52%), Query Frame = 2
Query: 1997 ISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFA--ILCIVFNVIFAGLAYY 2269
            +SI+WQ PQY++++ GE+L SITGL F+Y +A   +KS+V A W  + A G++IV+V+  +++    + +  +F   +L ++F  I   + YY
Sbjct:  668 VSILWQIPQYVILTAGEVLFSITGLEFAYTEASPQLKSVVQALWLFTTAIGDLIVVVIFMLNIFSDVAVQMFVFGGIMLFVIFVFILLAVFYY 760          
BLAST of slc15a-1 vs. Ensembl Fly
Match: CG2930 (gene:FBgn0028491 transcript:FBtr0070608)

HSP 1 Score: 362.459 bits (929), Expect = 1.299e-112
Identity = 234/732 (31.97%), Postives = 407/732 (55.60%), Query Frame = 2
Query:  140 EMDTDSNHNEESKLIKDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINL---SGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKV-LLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHP-CEVQMTIG----NAYTLVSGGYKISQSSIDLPDG----TYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHA-FQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAASVTVEGNQS-VFQSDWITLMKTGRYIWNVKS-PVLPPNVPS-NTSKWDGVLSLNGNNLEVNPIRITSSEVI---IFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYR 2275
            E D +     E+   K+ +E E +      +P++V+FII  E CERF+YYGMRT+L+LYL++ L   +  A  ++H+F    YF  + G+ ISD++LGK++T++ L  +Y  GS L++L +I  +NL   +  ++ L LIA G+GG+K CV   GGDQ    ++V  + S+FS+FYF IN G+L ST +TPILR +V+C    +CYPLAFG+PA+LM V+++I +LG   Y   P   ++ +   S   TA+    +E+  +P++  L+YA  +YD   I+D++ ++R+  LYLPLPV+WAL++Q GSRWT QA +MDG++  +  I PDQ+ +LN +++++ IP++D  +YP +  +    RPL+++T+G     ++F  +  ++  +E   PL  + GN++L + +  P C+ + +       ++TL    +  S S     DG    TY ++     C ++                           Q++   T H+ F + +                        H+ T         + N+S  F  +   L+ T R +W   S   +  ++P+ N   ++  LS  G N++V    +TS E+    ++ +++     T ++  + + + +++ ++W  PQY+++++GE++ S+TGL FSY Q+P  MKS++ A W L+ AFGN+IV+VVA++   + Q+ E+ +FA L  V  ++F  +AYYY+
Sbjct:   95 EPDQNGKELAETNDFKNVSETEGQQKK-LPYPKSVFFIISNEFCERFNYYGMRTVLVLYLSRVLGYSDDTATVVFHIFTMFVYFLCVFGAIISDSWLGKFKTILYLSLVYICGSVLLTLGAIGPLNLPMETFTMLGLALIALGSGGIKPCVSAFGGDQFKVPEQVKQITSFFSLFYFSINAGSLISTTVTPILREDVSCFDDINCYPLAFGVPAVLMIVSVIIFVLGRSLYKMKPPAGNMVVLVSSTIWTALTTKCKEKKTNPREHWLDYADKKYDRQLIDDVKVLMRVLFLYLPLPVFWALFDQQGSRWTFQATRMDGDMG-SWDIKPDQLQVLNPLLILIFIPLYDVALYP-ALKLVGIRRPLQKLTMGGILAGIAFIISGVVELSLEHTYPLIPSSGNTQLRVFSGIPDCDYRFSTNLGARESFTLRGLDFYYSGSVATNTDGIFQLTYTVESLTEGCAILEG-----------------------GTQQLYEATAHSLFLRPS------------------------HAITKFWYEDEVQKSNRSWAFVRNLANLLATTRVVWREDSGDTVALDLPARNHDLYE--LSTGGYNVQVADHNLTSIELRAGGVYALLIGQSHGTFVSRIIEVTSPNSMHMLWLVPQYVVMTLGEVMFSVTGLEFSYSQSPPSMKSVLQACWLLTVAFGNVIVVVVAELKFFDSQASEFFLFAGLMFVDMLVFMFVAYYYK 774          
BLAST of slc15a-1 vs. Ensembl Fly
Match: CG2930 (gene:FBgn0028491 transcript:FBtr0340201)

HSP 1 Score: 282.337 bits (721), Expect = 1.284e-82
Identity = 164/435 (37.70%), Postives = 266/435 (61.15%), Query Frame = 2
Query:  140 EMDTDSNHNEESKLIKDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINL---SGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKV-LLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQP-LP---------INVGNSRLFLVNSHPCEVQMTIG--NAYT 1396
            E D +     E+   K+ +E E +      +P++V+FII  E CERF+YYGMRT+L+LYL++ L   +  A  ++H+F    YF  + G+ ISD++LGK++T++ L  +Y  GS L++L +I  +NL   +  ++ L LIA G+GG+K CV   GGDQ    ++V  + S+FS+FYF IN G+L ST +TPILR +V+C    +CYPLAFG+PA+LM V+++I +LG   Y   P   ++ +   S   TA+    +E+  +P++  L+YA  +YD   I+D++ ++R+  LYLPLPV+WAL++Q GSRWT QA +MDG++  +  I PDQ+ +LN +++++ IP++D  +YP +  +    RPL+++T+G     ++F  +  ++  +E   P LP          N  N   F  ++ P    +T+   NAYT
Sbjct:  100 EPDQNGKELAETNDFKNVSETEGQQKK-LPYPKSVFFIISNEFCERFNYYGMRTVLVLYLSRVLGYSDDTATVVFHIFTMFVYFLCVFGAIISDSWLGKFKTILYLSLVYICGSVLLTLGAIGPLNLPMETFTMLGLALIALGSGGIKPCVSAFGGDQFKVPEQVKQITSFFSLFYFSINAGSLISTTVTPILREDVSCFDDINCYPLAFGVPAVLMIVSVIIFVLGRSLYKMKPPAGNMVVLVSSTIWTALTTKCKEKKTNPREHWLDYADKKYDRQLIDDVKVLMRVLFLYLPLPVFWALFDQQGSRWTFQATRMDGDMG-SWDIKPDQLQVLNPLLILIFIPLYDVALYP-ALKLVGIRRPLQKLTMGGILAGIAFIISGVVELSLEKTYPDLPYSQNIQLRIFNADNCDYFFTSNIPGAENVTVTSLNAYT 531          

HSP 2 Score: 100.523 bits (249), Expect = 2.495e-21
Identity = 47/109 (43.12%), Postives = 73/109 (66.97%), Query Frame = 2
Query: 1991 STISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRMQELT 2317
            +++ I+W  PQY+++++GE++ S+TGL FSY QAP  MKS++ A W L+ AFGN+IV+V+A+  L E Q+ E+ +FA L     +IF  +AYYY  +     +  Q LT
Sbjct:  683 NSVKILWLVPQYVVMTLGEVMFSVTGLEFSYAQAPPSMKSVLQACWLLTVAFGNVIVVVIAEAALFESQASEFFLFAGLMFADMLIFMVMAYYYVPNDPNKVEEAQPLT 791          
BLAST of slc15a-1 vs. Ensembl Fly
Match: CG2930 (gene:FBgn0028491 transcript:FBtr0070609)

HSP 1 Score: 281.952 bits (720), Expect = 1.706e-82
Identity = 164/435 (37.70%), Postives = 266/435 (61.15%), Query Frame = 2
Query:  140 EMDTDSNHNEESKLIKDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINL---SGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKV-LLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQP-LP---------INVGNSRLFLVNSHPCEVQMTIG--NAYT 1396
            E D +     E+   K+ +E E +      +P++V+FII  E CERF+YYGMRT+L+LYL++ L   +  A  ++H+F    YF  + G+ ISD++LGK++T++ L  +Y  GS L++L +I  +NL   +  ++ L LIA G+GG+K CV   GGDQ    ++V  + S+FS+FYF IN G+L ST +TPILR +V+C    +CYPLAFG+PA+LM V+++I +LG   Y   P   ++ +   S   TA+    +E+  +P++  L+YA  +YD   I+D++ ++R+  LYLPLPV+WAL++Q GSRWT QA +MDG++  +  I PDQ+ +LN +++++ IP++D  +YP +  +    RPL+++T+G     ++F  +  ++  +E   P LP          N  N   F  ++ P    +T+   NAYT
Sbjct:   95 EPDQNGKELAETNDFKNVSETEGQQKK-LPYPKSVFFIISNEFCERFNYYGMRTVLVLYLSRVLGYSDDTATVVFHIFTMFVYFLCVFGAIISDSWLGKFKTILYLSLVYICGSVLLTLGAIGPLNLPMETFTMLGLALIALGSGGIKPCVSAFGGDQFKVPEQVKQITSFFSLFYFSINAGSLISTTVTPILREDVSCFDDINCYPLAFGVPAVLMIVSVIIFVLGRSLYKMKPPAGNMVVLVSSTIWTALTTKCKEKKTNPREHWLDYADKKYDRQLIDDVKVLMRVLFLYLPLPVFWALFDQQGSRWTFQATRMDGDMG-SWDIKPDQLQVLNPLLILIFIPLYDVALYP-ALKLVGIRRPLQKLTMGGILAGIAFIISGVVELSLEKTYPDLPYSQNIQLRIFNADNCDYFFTSNIPGAENVTVTSLNAYT 526          

HSP 2 Score: 100.138 bits (248), Expect = 2.821e-21
Identity = 47/109 (43.12%), Postives = 73/109 (66.97%), Query Frame = 2
Query: 1991 STISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRMQELT 2317
            +++ I+W  PQY+++++GE++ S+TGL FSY QAP  MKS++ A W L+ AFGN+IV+V+A+  L E Q+ E+ +FA L     +IF  +AYYY  +     +  Q LT
Sbjct:  678 NSVKILWLVPQYVVMTLGEVMFSVTGLEFSYAQAPPSMKSVLQACWLLTVAFGNVIVVVIAEAALFESQASEFFLFAGLMFADMLIFMVMAYYYVPNDPNKVEEAQPLT 786          
BLAST of slc15a-1 vs. Ensembl Fly
Match: CG2930 (gene:FBgn0028491 transcript:FBtr0070610)

HSP 1 Score: 281.952 bits (720), Expect = 1.706e-82
Identity = 164/435 (37.70%), Postives = 266/435 (61.15%), Query Frame = 2
Query:  140 EMDTDSNHNEESKLIKDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINL---SGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKV-LLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQP-LP---------INVGNSRLFLVNSHPCEVQMTIG--NAYT 1396
            E D +     E+   K+ +E E +      +P++V+FII  E CERF+YYGMRT+L+LYL++ L   +  A  ++H+F    YF  + G+ ISD++LGK++T++ L  +Y  GS L++L +I  +NL   +  ++ L LIA G+GG+K CV   GGDQ    ++V  + S+FS+FYF IN G+L ST +TPILR +V+C    +CYPLAFG+PA+LM V+++I +LG   Y   P   ++ +   S   TA+    +E+  +P++  L+YA  +YD   I+D++ ++R+  LYLPLPV+WAL++Q GSRWT QA +MDG++  +  I PDQ+ +LN +++++ IP++D  +YP +  +    RPL+++T+G     ++F  +  ++  +E   P LP          N  N   F  ++ P    +T+   NAYT
Sbjct:   95 EPDQNGKELAETNDFKNVSETEGQQKK-LPYPKSVFFIISNEFCERFNYYGMRTVLVLYLSRVLGYSDDTATVVFHIFTMFVYFLCVFGAIISDSWLGKFKTILYLSLVYICGSVLLTLGAIGPLNLPMETFTMLGLALIALGSGGIKPCVSAFGGDQFKVPEQVKQITSFFSLFYFSINAGSLISTTVTPILREDVSCFDDINCYPLAFGVPAVLMIVSVIIFVLGRSLYKMKPPAGNMVVLVSSTIWTALTTKCKEKKTNPREHWLDYADKKYDRQLIDDVKVLMRVLFLYLPLPVFWALFDQQGSRWTFQATRMDGDMG-SWDIKPDQLQVLNPLLILIFIPLYDVALYP-ALKLVGIRRPLQKLTMGGILAGIAFIISGVVELSLEKTYPDLPYSQNIQLRIFNADNCDYFFTSNIPGAENVTVTSLNAYT 526          

HSP 2 Score: 100.138 bits (248), Expect = 2.821e-21
Identity = 47/109 (43.12%), Postives = 73/109 (66.97%), Query Frame = 2
Query: 1991 STISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRMQELT 2317
            +++ I+W  PQY+++++GE++ S+TGL FSY QAP  MKS++ A W L+ AFGN+IV+V+A+  L E Q+ E+ +FA L     +IF  +AYYY  +     +  Q LT
Sbjct:  678 NSVKILWLVPQYVVMTLGEVMFSVTGLEFSYAQAPPSMKSVLQACWLLTVAFGNVIVVVIAEAALFESQASEFFLFAGLMFADMLIFMVMAYYYVPNDPNKVEEAQPLT 786          
BLAST of slc15a-1 vs. Ensembl Fly
Match: CG2930 (gene:FBgn0028491 transcript:FBtr0340202)

HSP 1 Score: 281.952 bits (720), Expect = 1.706e-82
Identity = 164/435 (37.70%), Postives = 266/435 (61.15%), Query Frame = 2
Query:  140 EMDTDSNHNEESKLIKDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINL---SGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKV-LLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQP-LP---------INVGNSRLFLVNSHPCEVQMTIG--NAYT 1396
            E D +     E+   K+ +E E +      +P++V+FII  E CERF+YYGMRT+L+LYL++ L   +  A  ++H+F    YF  + G+ ISD++LGK++T++ L  +Y  GS L++L +I  +NL   +  ++ L LIA G+GG+K CV   GGDQ    ++V  + S+FS+FYF IN G+L ST +TPILR +V+C    +CYPLAFG+PA+LM V+++I +LG   Y   P   ++ +   S   TA+    +E+  +P++  L+YA  +YD   I+D++ ++R+  LYLPLPV+WAL++Q GSRWT QA +MDG++  +  I PDQ+ +LN +++++ IP++D  +YP +  +    RPL+++T+G     ++F  +  ++  +E   P LP          N  N   F  ++ P    +T+   NAYT
Sbjct:   95 EPDQNGKELAETNDFKNVSETEGQQKK-LPYPKSVFFIISNEFCERFNYYGMRTVLVLYLSRVLGYSDDTATVVFHIFTMFVYFLCVFGAIISDSWLGKFKTILYLSLVYICGSVLLTLGAIGPLNLPMETFTMLGLALIALGSGGIKPCVSAFGGDQFKVPEQVKQITSFFSLFYFSINAGSLISTTVTPILREDVSCFDDINCYPLAFGVPAVLMIVSVIIFVLGRSLYKMKPPAGNMVVLVSSTIWTALTTKCKEKKTNPREHWLDYADKKYDRQLIDDVKVLMRVLFLYLPLPVFWALFDQQGSRWTFQATRMDGDMG-SWDIKPDQLQVLNPLLILIFIPLYDVALYP-ALKLVGIRRPLQKLTMGGILAGIAFIISGVVELSLEKTYPDLPYSQNIQLRIFNADNCDYFFTSNIPGAENVTVTSLNAYT 526          

HSP 2 Score: 100.138 bits (248), Expect = 2.821e-21
Identity = 47/109 (43.12%), Postives = 73/109 (66.97%), Query Frame = 2
Query: 1991 STISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRMQELT 2317
            +++ I+W  PQY+++++GE++ S+TGL FSY QAP  MKS++ A W L+ AFGN+IV+V+A+  L E Q+ E+ +FA L     +IF  +AYYY  +     +  Q LT
Sbjct:  678 NSVKILWLVPQYVVMTLGEVMFSVTGLEFSYAQAPPSMKSVLQACWLLTVAFGNVIVVVIAEAALFESQASEFFLFAGLMFADMLIFMVMAYYYVPNDPNKVEEAQPLT 786          
BLAST of slc15a-1 vs. Ensembl Zebrafish
Match: slc15a1b (solute carrier family 15 member 1b [Source:ZFIN;Acc:ZDB-GENE-030131-4661])

HSP 1 Score: 298.13 bits (762), Expect = 3.722e-89
Identity = 165/437 (37.76%), Postives = 268/437 (61.33%), Query Frame = 2
Query:  185 KDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAI--------------NLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACN--GTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDL 1441
            K+ ++ ++  +SCF +P +++FI++ E CERFSYYGM+ +L+LY    +   +  + +IYH FV+LCY T I+G+ I+D++LGK++T+V L  +YT+G  +M++++I  I              ++S  ++ L+LIA GTGG+K CV   GGDQ   H++    ++FS+FY  IN G+L ST++TPILR+   C       CYPLAFG+PA LM VAL++ ++GHK Y+    + +I ++ I+C   A+ N +R R    PK+E  +++A  +YD   I  ++ ++++  LY+PLP++WAL++Q GSRWT+QA  MDG      VI PDQM I+N I++++++PI DS IYP+         PLR+MT+G+    L+F AA  LQ QI+   P   +   ++L  +N     + + +      +  G+  S   + L
Sbjct:    4 KEGHKQKKERASCFGYPVSIFFIVVNEFCERFSYYGMKAVLVLYFKYFIGWDDDLSTTIYHTFVALCYLTPIMGAIIADSWLGKFKTIVYLSIVYTIGQVIMAISAIHDITDANRDGKPDNKTLHISLSMLGLILIALGTGGIKPCVAAFGGDQFEDHQEKQRSTFFSIFYLSINAGSLLSTLITPILRSQ-ECGIYAKQSCYPLAFGVPAALMVVALIVFVIGHKMYIMESPKGNILLQVINCIGFALNNRFRHRGKQYPKREHWMDWAEEKYDKLLIAQVKMVVKVLFLYIPLPMFWALFDQQGSRWTIQATTMDGNFG-GFVIQPDQMQIVNPILIVIMVPIMDSAIYPLIKLCRINFTPLRKMTVGMVLAALAFVAAALLQLQIDETMPKFPSTSQTQLKFLNVESTSLPVVVEGQDQFMVPGFNASSEYLTL 438          

HSP 2 Score: 93.5893 bits (231), Expect = 3.822e-19
Identity = 48/107 (44.86%), Postives = 70/107 (65.42%), Query Frame = 2
Query: 1997 ISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYR-MSKKETYDRMQEL 2314
            I + WQ  QY L++ GE++ S+TGL FSY QAP  MKS++ A W L+ A GNIIV++VA+   +  Q  EYL+FA L +  ++IFA +AY+Y  +   E   + +EL
Sbjct:  579 IHMAWQVIQYFLLTCGEVVYSVTGLDFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAEAGSLPDQWAEYLLFASLLVAVSIIFAIMAYFYTYIDPNEIEAKFKEL 685          
BLAST of slc15a-1 vs. Ensembl Zebrafish
Match: slc15a2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:556684])

HSP 1 Score: 274.633 bits (701), Expect = 1.507e-80
Identity = 144/370 (38.92%), Postives = 228/370 (61.62%), Query Frame = 2
Query:  182 IKDDNEDEER----------CSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIP-----AINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKK-ELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGI 1243
            +KD + D E+          C +  ++P ++ FI++ E CERFSYYGM+ +L LY   +L   ++ + +IYH F  LCYFT ++G+ I+D++LGK++T++ L  +Y +G  + S+ +IP      ++++  ++ L LIA GTGG+K CV   GGDQ           +FS+FY  IN G++ STI+TPILR +V C G  DCY LAFG+PA LM +AL++ + G   Y   P   ++ ++   C   A+ N +     SPK+   L++A  +Y    I +++ + R+ +LY+PLP++WAL++Q GSRWTLQA +M+ +     +I PDQM +LN ++++V IPIFD  IYP+      KL PL++M  G+
Sbjct:    4 MKDKDVDAEKYEKAQRSPKLCGT--NYPVSIAFIVVNEFCERFSYYGMKAVLTLYFMNYLHWDKNLSTAIYHAFSGLCYFTPLLGALIADSWLGKFKTIIYLSIVYVIGHVVKSVGAIPDVGDSTVHIALSMVGLGLIALGTGGIKPCVAAFGGDQFDEDNIDERRKFFSIFYMSINAGSVLSTIITPILRGDVQCFG-GDCYALAFGVPAALMVIALVVFISGSGLYKKSPPEGNVLVRVCKCIGFAISNRWTNSKKSPKRSHWLDWAEEKYSKRLIQEIKMVCRVLVLYIPLPMFWALFDQQGSRWTLQATRMNMDFGGGFIIKPDQMQMLNALLILVFIPIFDMGIYPLVGLCRIKLTPLKKMATGM 370          

HSP 2 Score: 96.2857 bits (238), Expect = 5.097e-20
Identity = 46/108 (42.59%), Postives = 73/108 (67.59%), Query Frame = 2
Query: 1985 NGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSW-EYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRM 2305
              + I I WQ PQY+ ++ GE++ SITGL FSY QAP  MKS++ A W ++ AFGN+IV++VA+   +E+  W E+L+FA L +  ++IF+ +AY+Y     +  D++
Sbjct:  585 QANNIHIGWQIPQYVFLTAGEVMFSITGLEFSYSQAPASMKSVLQAGWLMTVAFGNVIVLIVAEGAGMEQ--WVEFLLFAALLVAVSIIFSIMAYFYTYVDPDQLDKL 690          
BLAST of slc15a-1 vs. Ensembl Zebrafish
Match: slc15a1a (solute carrier family 15 member 1a [Source:ZFIN;Acc:ZDB-GENE-091204-9])

HSP 1 Score: 265.388 bits (677), Expect = 7.695e-77
Identity = 160/473 (33.83%), Postives = 259/473 (54.76%), Query Frame = 2
Query:  215 SSCFHFPRAVYFIIITELCERFSYYGMRXXXXX-------------------------XXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAI--------------NLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRAN-VACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHN-SPKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEIS 1507
            + C  +P +++FI++ E CERFSYYGMR +L+L                                        IYH FV+LCY T I+G+ I+D++LGK++T++ L  +Y +G  +M++++I  I              +++  ++ L+LIA GTGG+K CV   GGDQ   H+   L+++FS+FY  IN G+L ST++TP+LRA     +    CYPLAFG+PA LM V+L++ + G   Y       +I      C   A+ N +R R +  PK+E  +++A  +YD   I  ++ +L++  LY+PLP++W L++Q GSRWTLQA  M G+     V+ PDQM  +N I+++ L+PI D  I+P+         PL+RMT+G+ F   +F AA  +Q +I+   P   +   S+L +VN H   + +T+ +   L+ G ++ S   I       +I+L +     IN+++S
Sbjct:   17 AECCGYPISIFFIVVNEFCERFSYYGMRAVLVLYFRYFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYHAFVALCYLTPILGAIIADSWLGKFKTIIYLSIVYAVGQVVMAVSTIHDITDANRDGTPDNFTLHIALSMLGLVLIALGTGGIKPCVAAFGGDQFQEHQSRQLNTFFSVFYLCINAGSLLSTLITPVLRAQECGIHTQQQCYPLAFGVPAALMVVSLVVFIAGSGMYTKTAPEGNIMGSVCKCIWFALNNRFRHRSDIYPKREHWMDWAEEKYDKLLIAQIKMVLKVLFLYIPLPMFWTLFDQKGSRWTLQATTMTGDFG-GFVLQPDQMQTVNPILILTLVPIMDRIIFPLIKKCGLNFSPLKRMTVGMLFAATAFIAAALVQMEIDKTLPNFPSSSESQLKVVNMHSESLIVTVPSQEPLLIGSFESSPDYITF--DQQDIRLAFNTTPEINKDLS 486          

HSP 2 Score: 97.4413 bits (241), Expect = 2.745e-20
Identity = 44/94 (46.81%), Postives = 68/94 (72.34%), Query Frame = 2
Query: 1991 STISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            +++ +  Q PQY LI+ GE++ S+TGL FSY QAP  MKS++ A W  +NA GNIIV++VA++  + KQ  EY++FA L +  ++IF+ +AY+Y
Sbjct:  604 NSVHMALQIPQYFLITTGEVMFSVTGLQFSYSQAPKNMKSVLQAGWLCTNAVGNIIVLIVAELGKLPKQWAEYVLFASLLVAVSIIFSIMAYFY 697          
BLAST of slc15a-1 vs. Ensembl Zebrafish
Match: slc15a1a (solute carrier family 15 member 1a [Source:ZFIN;Acc:ZDB-GENE-091204-9])

HSP 1 Score: 265.003 bits (676), Expect = 1.420e-76
Identity = 154/448 (34.38%), Postives = 249/448 (55.58%), Query Frame = 2
Query:  215 SSCFHFPRAVYFIIITELCERFSYYGMRXXXXX-------------------------XXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAI--------------NLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRAN-VACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHN-SPKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSS 1432
            + C  +P +++FI++ E CERFSYYGMR +L+L                                        IYH FV+LCY T I+G+ I+D++LGK++T++ L  +Y +G  +M++++I  I              +++  ++ L+LIA GTGG+K CV   GGDQ   H+   L+++FS+FY  IN G+L ST++TP+LRA     +    CYPLAFG+PA LM V+L++ + G   Y       +I      C   A+ N +R R +  PK+E  +++A  +YD   I  ++ +L++  LY+PLP++W L++Q GSRWTLQA  M G+     V+ PDQM  +N I+++ L+PI D  I+P+         PL+RMT+G+ F   +F AA  +Q +I+   P   +   S+L +VN H   + +T+ +   L+ G +++  +S
Sbjct:   17 AECCGYPISIFFIVVNEFCERFSYYGMRAVLVLYFRYFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYHAFVALCYLTPILGAIIADSWLGKFKTIIYLSIVYAVGQVVMAVSTIHDITDANRDGTPDNFTLHIALSMLGLVLIALGTGGIKPCVAAFGGDQFQEHQSRQLNTFFSVFYLCINAGSLLSTLITPVLRAQECGIHTQQQCYPLAFGVPAALMVVSLVVFIAGSGMYTKTAPEGNIMGSVCKCIWFALNNRFRHRSDIYPKREHWMDWAEEKYDKLLIAQIKMVLKVLFLYIPLPMFWTLFDQKGSRWTLQATTMTGDFG-GFVLQPDQMQTVNPILILTLVPIMDRIIFPLIKKCGLNFSPLKRMTVGMLFAATAFIAAALVQMEIDKTLPNFPSSSESQLKVVNMHSESLIVTVPSQEPLLIGSFEVQHTS 463          

HSP 2 Score: 97.4413 bits (241), Expect = 2.857e-20
Identity = 44/94 (46.81%), Postives = 68/94 (72.34%), Query Frame = 2
Query: 1991 STISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            +++ +  Q PQY LI+ GE++ S+TGL FSY QAP  MKS++ A W  +NA GNIIV++VA++  + KQ  EY++FA L +  ++IF+ +AY+Y
Sbjct:  630 NSVHMALQIPQYFLITTGEVMFSVTGLQFSYSQAPKNMKSVLQAGWLCTNAVGNIIVLIVAELGKLPKQWAEYVLFASLLVAVSIIFSIMAYFY 723          
BLAST of slc15a-1 vs. Ensembl Zebrafish
Match: slc15a1a (solute carrier family 15 member 1a [Source:ZFIN;Acc:ZDB-GENE-091204-9])

HSP 1 Score: 242.276 bits (617), Expect = 8.684e-70
Identity = 142/413 (34.38%), Postives = 229/413 (55.45%), Query Frame = 2
Query:  194 NEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXX-------------------------XXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAI--------------NLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRAN-VACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHN-SPKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQ 1306
            +E +++   C  +P +++FI++ E CERFSYYGMR +L+L                                        IYH FV+LCY T I+G+ I+D++LGK++T++ L  +Y +G  +M++++I  I              +++  ++ L+LIA GTGG+K CV   GGDQ   H+   L+++FS+FY  IN G+L ST++TP+LRA     +    CYPLAFG+PA LM V+L++ + G   Y       +I      C   A+ N +R R +  PK+E  +++A  +YD   I  ++ +L++  LY+PLP++W L++Q GSRWTLQA  M G+    L +       +N I+++ L+PI D  I+P+         PL+RMT+G+ F   +F AA  +Q +I+ R+
Sbjct:    2 DETKKKKKKCCGYPISIFFIVVNEFCERFSYYGMRAVLVLYFRYFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYHAFVALCYLTPILGAIIADSWLGKFKTIIYLSIVYAVGQVVMAVSTIHDITDANRDGTPDNFTLHIALSMLGLVLIALGTGGIKPCVAAFGGDQFQEHQSRQLNTFFSVFYLCINAGSLLSTLITPVLRAQECGIHTQQQCYPLAFGVPAALMVVSLVVFIAGSGMYTKTAPEGNIMGSVCKCIWFALNNRFRHRSDIYPKREHWMDWAEEKYDKLLIAQIKMVLKVLFLYIPLPMFWTLFDQKGSRWTLQATTMTGDFVLRLFL----RQTVNPILILTLVPIMDRIIFPLIKKCGLNFSPLKRMTVGMLFAATAFIAAALVQMEIDMRK 410          

HSP 2 Score: 96.2857 bits (238), Expect = 3.678e-20
Identity = 44/94 (46.81%), Postives = 68/94 (72.34%), Query Frame = 2
Query: 1991 STISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            +++ +  Q PQY LI+ GE++ S+TGL FSY QAP  MKS++ A W  +NA GNIIV++VA++  + KQ  EY++FA L +  ++IF+ +AY+Y
Sbjct:  450 NSVHMALQIPQYFLITTGEVMFSVTGLQFSYSQAPKNMKSVLQAGWLCTNAVGNIIVLIVAELGKLPKQWAEYVLFASLLVAVSIIFSIMAYFY 543          
BLAST of slc15a-1 vs. Ensembl Xenopus
Match: SLC15A2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:100493689])

HSP 1 Score: 254.603 bits (649), Expect = 1.151e-73
Identity = 163/441 (36.96%), Postives = 252/441 (57.14%), Query Frame = 2
Query:  227 HFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPA-----INLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINV---GNSRLF-------------LVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAK 1480
            ++P ++ FI++ E CERFSYYGM+ +L LY   +L   E+ + ++YH F  LCYFT +IG+ I+D +LGK+ T+  L  LY +G  + S+ +IP      ++++  II L+ IAFGTGG+K CV   GGDQ           +FS+FY  IN G+L ST +TP+LR +V C G  DCY LAFG+PA LM VAL++ + G   Y   P + +I      C   A+KN +R R    PK+E  L++A  ++    I +++ + ++  LY+PLP++WAL++Q GSRWTLQA +M+ +     V+ PDQ+ ILN +++++LIPIFD CIYP+        + + +M IG+    L+F  A  ++ +I A     + V   G +RL               +N    ++ +TIG +     G   +S   I +  G Y   L+Y +
Sbjct:   46 NYPLSIMFIVVNEFCERFSYYGMKAVLTLYFLNYLHWDENLSTTVYHAFSGLCYFTPLIGAPIADAWLGKFNTIFYLSILYVIGHVIKSVGAIPTVGSTEVHVALSIIGLIAIAFGTGGIKPCVAAFGGDQFEEEHAQERSKFFSIFYLSINAGSLISTFVTPVLRGDVKCFG-GDCYALAFGVPAALMFVALIVFVAGSGMYKKYPPQGNILASVFRCIGFALKNRWRHRSKQYPKREHWLDWAEEKFQKRLITEVKMVTKVLFLYIPLPMFWALFDQQGSRWTLQATRMNSDFG-GFVLQPDQIQILNPLLILILIPIFDLCIYPLVRCCKIDFKAIPKMAIGMILAALAFAVATVVEIKINAVIEFWVQVWAWGAARLCRNHWGAHYDSIYRFINMLNRDINVTIGESTVSAKGNNGVS-PYITVKRGKYVSPLRYPQ 483          

HSP 2 Score: 85.8853 bits (211), Expect = 1.087e-16
Identity = 39/96 (40.62%), Postives = 66/96 (68.75%), Query Frame = 2
Query: 1985 NGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            + ++  + WQ PQY+L+S GE++ S+TGL FSY QAP  MKS++ A W  + A GN+IV++VA+   + + + E+++FA L +   +IF+ + Y+Y
Sbjct:  514 SANSFHVAWQVPQYVLLSAGEVMFSVTGLEFSYSQAPISMKSVLQAGWLFTIAIGNVIVLIVAQAGSLAQWA-EFILFAALLVAVCIIFSIMGYFY 608          
BLAST of slc15a-1 vs. Ensembl Xenopus
Match: SLC15A2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:100493689])

HSP 1 Score: 251.906 bits (642), Expect = 3.407e-73
Identity = 156/391 (39.90%), Postives = 235/391 (60.10%), Query Frame = 2
Query:  218 SCFHFPRA----VYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPA-----INLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKKE-LLEYASSEY---DAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINV---GNSRL 1339
            SCF  P++    + FI++ E CERFSYYGM+ +L LY   +L   E+ + ++YH F  LCYFT +IG+ I+D +LGK+ T+  L  LY +G  + S+ +IP      ++++  II L+ IAFGTGG+K CV   GGDQ           +FS+FY  IN G+L ST +TP+LR +V C G  DCY LAFG+PA LM VAL++ + G   Y   P + +I      C   A+KN +R R    PK+E  L++A  ++   D   I +++ + ++  LY+PLP++WAL++Q GSRWTLQA +M+ +     V+ PDQ+ ILN +++++LIPIFD CIYP+        + + +M IG+    L+F  A  ++ +I A     + V   G +RL
Sbjct:    1 SCFDPPKSTPPYIMFIVVNEFCERFSYYGMKAVLTLYFLNYLHWDENLSTTVYHAFSGLCYFTPLIGAPIADAWLGKFNTIFYLSILYVIGHVIKSVGAIPTVGSTEVHVALSIIGLIAIAFGTGGIKPCVAAFGGDQFEEEHAQERSKFFSIFYLSINAGSLISTFVTPVLRGDVKCFG-GDCYALAFGVPAALMFVALIVFVAGSGMYKKYPPQGNILASVFRCIGFALKNRWRHRSKQYPKREHWLDWAEEKFQVSDKRLITEVKMVTKVLFLYIPLPMFWALFDQQGSRWTLQATRMNSDF-GGFVLQPDQIQILNPLLILILIPIFDLCIYPLVRCCKIDFKAIPKMAIGMILAALAFAVATVVEIKINAVIEFWVQVWAWGAARL 389          

HSP 2 Score: 85.8853 bits (211), Expect = 1.103e-16
Identity = 39/96 (40.62%), Postives = 66/96 (68.75%), Query Frame = 2
Query: 1985 NGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            + ++  + WQ PQY+L+S GE++ S+TGL FSY QAP  MKS++ A W  + A GN+IV++VA+   + + + E+++FA L +   +IF+ + Y+Y
Sbjct:  465 SANSFHVAWQVPQYVLLSAGEVMFSVTGLEFSYSQAPISMKSVLQAGWLFTIAIGNVIVLIVAQAGSLAQWA-EFILFAALLVAVCIIFSIMGYFY 559          
BLAST of slc15a-1 vs. Ensembl Xenopus
Match: SLC15A2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:100493689])

HSP 1 Score: 254.988 bits (650), Expect = 5.108e-73
Identity = 150/371 (40.43%), Postives = 229/371 (61.73%), Query Frame = 2
Query:  227 HFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPA-----INLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQI-EARQPLP 1315
            ++P ++ FI++ E CERFSYYGM+ +L LY   +L   E+ + ++YH F  LCYFT +IG+ I+D +LGK+ T+  L  LY +G  + S+ +IP      ++++  II L+ IAFGTGG+K CV   GGDQ           +FS+FY  IN G+L ST +TP+LR +V C G  DCY LAFG+PA LM VAL++ + G   Y   P + +I      C   A+KN +R R    PK+E  L++A  ++    I +++ + ++  LY+PLP++WAL++Q GSRWTLQA +M+ +     V+ PDQ+ ILN +++++LIPIFD CIYP+        + + +M IG+    L+F  A  ++ +I E   P+P
Sbjct:   42 NYPLSIMFIVVNEFCERFSYYGMKAVLTLYFLNYLHWDENLSTTVYHAFSGLCYFTPLIGAPIADAWLGKFNTIFYLSILYVIGHVIKSVGAIPTVGSTEVHVALSIIGLIAIAFGTGGIKPCVAAFGGDQFEEEHAQERSKFFSIFYLSINAGSLISTFVTPVLRGDVKCFG-GDCYALAFGVPAALMFVALIVFVAGSGMYKKYPPQGNILASVFRCIGFALKNRWRHRSKQYPKREHWLDWAEEKFQKRLITEVKMVTKVLFLYIPLPMFWALFDQQGSRWTLQATRMNSDFG-GFVLQPDQIQILNPLLILILIPIFDLCIYPLVRCCKIDFKAIPKMAIGMILAALAFAVATVVEIKINETLPPVP 410          

HSP 2 Score: 86.6557 bits (213), Expect = 8.795e-17
Identity = 39/96 (40.62%), Postives = 66/96 (68.75%), Query Frame = 2
Query: 1985 NGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            + ++  + WQ PQY+L+S GE++ S+TGL FSY QAP  MKS++ A W  + A GN+IV++VA+   + + + E+++FA L +   +IF+ + Y+Y
Sbjct:  598 SANSFHVAWQVPQYVLLSAGEVMFSVTGLEFSYSQAPISMKSVLQAGWLFTIAIGNVIVLIVAQAGSLAQWA-EFILFAALLVAVCIIFSIMGYFY 692          
BLAST of slc15a-1 vs. Ensembl Xenopus
Match: SLC15A2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:100493689])

HSP 1 Score: 248.054 bits (632), Expect = 1.086e-71
Identity = 148/367 (40.33%), Postives = 224/367 (61.04%), Query Frame = 2
Query:  227 HFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPA-----INLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPL----RRMTIGIAFTCLSFFAAFALQKQI 1294
            ++P ++ FI++ E CERFSYYGM+ +L LY   +L   E+ + ++YH F  LCYFT +IG+ I+D +LGK+ T+  L  LY +G  + S+ +IP      ++++  II L+ IAFGTGG+K CV   GGDQ           +FS+FY  IN G+L ST +TP+LR +V C G  DCY LAFG+PA LM VAL++ + G   Y   P + +I      C   A+KN +R R    PK+E  L++A  ++    I +++ + ++  LY+PLP++WAL++Q GSRWTLQA +M+ +     V+ PDQ+ ILN +++++LIPIFD CIYP+         P+      M IG+    L+F  A  ++ +I
Sbjct:   10 NYPLSIMFIVVNEFCERFSYYGMKAVLTLYFLNYLHWDENLSTTVYHAFSGLCYFTPLIGAPIADAWLGKFNTIFYLSILYVIGHVIKSVGAIPTVGSTEVHVALSIIGLIAIAFGTGGIKPCVAAFGGDQFEEEHAQERSKFFSIFYLSINAGSLISTFVTPVLRGDVKCFG-GDCYALAFGVPAALMFVALIVFVAGSGMYKKYPPQGNILASVFRCIGFALKNRWRHRSKQYPKREHWLDWAEEKFQKRLITEVKMVTKVLFLYIPLPMFWALFDQQGSRWTLQATRMNSDF-GGFVLQPDQIQILNPLLILILIPIFDLCIYPLVRCCKIDFNPMGGTNTTMAIGMILAALAFAVATVVEIKI 374          

HSP 2 Score: 85.8853 bits (211), Expect = 1.034e-16
Identity = 39/96 (40.62%), Postives = 66/96 (68.75%), Query Frame = 2
Query: 1985 NGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            + ++  + WQ PQY+L+S GE++ S+TGL FSY QAP  MKS++ A W  + A GN+IV++VA+   + + + E+++FA L +   +IF+ + Y+Y
Sbjct:  467 SANSFHVAWQVPQYVLLSAGEVMFSVTGLEFSYSQAPISMKSVLQAGWLFTIAIGNVIVLIVAQAGSLAQWA-EFILFAALLVAVCIIFSIMGYFY 561          
BLAST of slc15a-1 vs. Ensembl Xenopus
Match: SLC15A2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:100493689])

HSP 1 Score: 240.736 bits (613), Expect = 5.110e-69
Identity = 175/538 (32.53%), Postives = 285/538 (52.97%), Query Frame = 2
Query:  227 HFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPA-----INLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELA-------NNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQI-EARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGV-LAASVTVEGNQSVFQSDWITLMKTGRYI 1792
            ++P ++ FI++ E CERFSYYGM+ +L LY   +L   E+ + ++YH F  LCYFT +IG+ I+D +LGK+ T+  L  LY +G  + S+ +IP      ++++  II L+ IAFGTGG+K CV   GGDQ           +FS+FY  IN G+L ST +TP+LR +V C G  DCY LAFG+PA LM VAL++ + G   Y   P + +I      C   A+KN +R R    PK+E  L++A  ++    I +++ + ++  LY+PLP++WAL++Q GSRWTLQA +M+ +         ++ ++    + ILN +++++LIPIFD   +P+ +N     R + +M IG+    L+F  A  ++ +I E   P+P     S L ++N    +V + I        G   I Q S+   +   +    +A    +   +  L+   L P ++       +  + +S  +FH           +A  V    LL+  +  +  S TG+  + S      +SV Q+ W+  +  G  I
Sbjct:    8 NYPLSIMFIVVNEFCERFSYYGMKAVLTLYFLNYLHWDENLSTTVYHAFSGLCYFTPLIGAPIADAWLGKFNTIFYLSILYVIGHVIKSVGAIPTVGSTEVHVALSIIGLIAIAFGTGGIKPCVAAFGGDQFEEEHAQERSKFFSIFYLSINAGSLISTFVTPVLRGDVKCFG-GDCYALAFGVPAALMFVALIVFVAGSGMYKKYPPQGNILASVFRCIGFALKNRWRHRSKQYPKREHWLDWAEEKFQKRLITEVKMVTKVLFLYIPLPMFWALFDQQGSRWTLQATRMNSDFVSIGADNQDSTIMFSFHLQILNPLLILILIPIFDLSTFPLFFN----FRAIPKMAIGMILAALAFAVATVVEIKINETLPPVP-KAQVSYLQVLNLAGGDVDVDI-------PGFEIIKQPSLYGANALVSTAPCWANARPLGFWVHRLLVAPLFPAQDLGDTIEFKKTEDVSANSFH-----------VAWQVPQYVLLSAGE--VMFSVTGLEFSYSQAPISMKSVLQAGWLFTIAIGNVI 519          

HSP 2 Score: 85.8853 bits (211), Expect = 1.003e-16
Identity = 39/96 (40.62%), Postives = 66/96 (68.75%), Query Frame = 2
Query: 1985 NGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            + ++  + WQ PQY+L+S GE++ S+TGL FSY QAP  MKS++ A W  + A GN+IV++VA+   + + + E+++FA L +   +IF+ + Y+Y
Sbjct:  462 SANSFHVAWQVPQYVLLSAGEVMFSVTGLEFSYSQAPISMKSVLQAGWLFTIAIGNVIVLIVAQAGSLAQWA-EFILFAALLVAVCIIFSIMGYFY 556          
BLAST of slc15a-1 vs. Ensembl Mouse
Match: Slc15a2 (solute carrier family 15 (H+/peptide transporter), member 2 [Source:MGI Symbol;Acc:MGI:1890457])

HSP 1 Score: 344.354 bits (882), Expect = 3.153e-106
Identity = 245/722 (33.93%), Postives = 379/722 (52.49%), Query Frame = 2
Query:  230 FPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAI--NLSGPIISLL---LIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRER-HNSPKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEAR-QPLPINVGNSRLFL--VNSHPCEVQMTI-GN--------AYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTAL-----LNKYQFI-IKHSTTGV-LAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQT--VITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRMQE 2311
            +P ++ FI++ E CERFSYYGM+ +L LY    L   E  + S+YH F SLCYFT I+G+ I+D++LGK++T++ L  +Y LG    SL +IP +   +   I+SL+   LIA GTGG+K CV   GGDQ           YFS+FY  IN G+L S  +TP+LR +V C G +DCY LAFGIP +LM +AL++  +G K Y   P   +I  +   C   A+ N +R R  + PK++  L++A+ +Y    I D++ + RI  LY+PLP++WAL +Q GSRWTLQA +MDG+L    V+ PDQM +LN  +V+V IP+FD  IY +          LR+M +G+   CL+F  A  ++ +I     P P    +  +FL  +N    E+++T+ GN        + +        S+  ++      +  LKY   ++ N+          V ++N Y L   EN + +S                 + LV  T +     +   +FI   H    + L A+  +   +    S++ T+ + G+Y          P V   T   D V SLN   L+       ++ + +   + +   Q      IP      + +SI WQ PQY+L++  E++ S+TGL FSY QAP  MKS++ A W L+ A GNIIV++VA+   + + + E+++F+ L +V  +IF+ + YYY   K E      E
Sbjct:   53 YPLSIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVYVLGHVFKSLGAIPILGGKMLHTILSLVGLSLIALGTGGIKPCVAAFGGDQFEEEHAEARTRYFSVFYLSINAGSLISMFITPMLRGDVKCFG-EDCYALAFGIPGLLMVLALVVFAMGSKMYRKPPPEGNIVAQVTKCIWFAICNRFRNRSEDIPKRQHWLDWAAEKYPKHLIMDVKALTRILFLYIPLPMFWALLDQQGSRWTLQANKMDGDLG-FFVLQPDQMQVLNPFLVLVFIPLFDLVIYRLISKCGVNFSSLRKMAVGMILACLAFAVAALVEIKINGMIHPQP---ASQEIFLQVLNLADGEIEVTVQGNRNNPLLVESISSFQNTTHYSKLRLETKSQDLHFHLKYNNLSVHNEYS--------VEEKNCYQLVVHENGESLS-----------------SMLVKDTGIKPANGMTAIRFINTLHKDMNISLDANAPLSVGKDYGVSEYRTVQR-GKY----------PAVHCETE--DNVFSLNLGQLDFG-----TTYLFVITNITNRGLQAWKAEDIP-----ANKLSIAWQLPQYVLVTAAEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTVAVGNIIVLIVAQFSGLVQWA-EFVLFSCLLLVVCLIFSVMGYYYVPLKSEGIHEATE 720          
BLAST of slc15a-1 vs. Ensembl Mouse
Match: Slc15a2 (solute carrier family 15 (H+/peptide transporter), member 2 [Source:MGI Symbol;Acc:MGI:1890457])

HSP 1 Score: 322.783 bits (826), Expect = 1.875e-98
Identity = 236/722 (32.69%), Postives = 365/722 (50.55%), Query Frame = 2
Query:  230 FPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRER-HNSPKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEAR-QPLPINVGNSRLFL--VNSHPCEVQMTI-GN--------AYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTAL-----LNKYQFI-IKHSTTGV-LAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKE-TYDRMQELTEHVE 2329
            +P ++ FI++ E CERFSYYGM+ +L LY    L   E  + S+YH F SLCYFT I+G+ I+D++LGK++ L                           ++ L LIA GTGG+K CV   GGDQ           YFS+FY  IN G+L S  +TP+LR +V C G +DCY LAFGIP +LM +AL++  +G K Y   P   +I  +   C   A+ N +R R  + PK++  L++A+ +Y    I D++ + RI  LY+PLP++WAL +Q GSRWTLQA +MDG+L    V+ PDQM +LN  +V+V IP+FD  IY +          LR+M +G+   CL+F  A  ++ +I     P P    +  +FL  +N    E+++T+ GN        + +        S+  ++      +  LKY   ++ N+          V ++N Y L   EN + +S                 + LV  T +     +   +FI   H    + L A+  +   +    S++ T+ + G+Y          P V   T   D V SLN   L+     +    VI               IP      + +SI WQ PQY+L++  E++ S+TGL FSY QAP  MKS++ A W L+ A GNIIV++VA+   + + + E+++F+ L +V  +IF+ + YYY   K E  ++  ++   H++
Sbjct:   53 YPLSIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIADSWLGKFKIL--------------------------SLVGLSLIALGTGGIKPCVAAFGGDQFEEEHAEARTRYFSVFYLSINAGSLISMFITPMLRGDVKCFG-EDCYALAFGIPGLLMVLALVVFAMGSKMYRKPPPEGNIVAQVTKCIWFAICNRFRNRSEDIPKRQHWLDWAAEKYPKHLIMDVKALTRILFLYIPLPMFWALLDQQGSRWTLQANKMDGDLG-FFVLQPDQMQVLNPFLVLVFIPLFDLVIYRLISKCGVNFSSLRKMAVGMILACLAFAVAALVEIKINGMIHPQP---ASQEIFLQVLNLADGEIEVTVQGNRNNPLLVESISSFQNTTHYSKLRLETKSQDLHFHLKYNNLSVHNEYS--------VEEKNCYQLVVHENGESLS-----------------SMLVKDTGIKPANGMTAIRFINTLHKDMNISLDANAPLSVGKDYGVSEYRTVQR-GKY----------PAVHCETE--DNVFSLNLGQLDFGTTYLF---VITNITNRGLQAWKAEDIP-----ANKLSIAWQLPQYVLVTAAEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTVAVGNIIVLIVAQFSGLVQWA-EFVLFSCLLLVVCLIFSVMGYYYVPLKSEGIHEATEKQIPHIQ 696          
BLAST of slc15a-1 vs. Ensembl Mouse
Match: Slc15a1 (solute carrier family 15 (oligopeptide transporter), member 1 [Source:MGI Symbol;Acc:MGI:1861376])

HSP 1 Score: 281.182 bits (718), Expect = 5.294e-83
Identity = 157/417 (37.65%), Postives = 256/417 (61.39%), Query Frame = 2
Query:  209 RCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIP--------------AINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRA-NVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTI---GNAYTL 1399
            +   CF +P +++FI++ E CERFSYYGMR +L+LY    L   ++ + +IYH FV+LCY T I+G+ I+D++LGK++T+V L  +YT+G  ++S++SI                ++++  ++ L LIA GTGG+K CV   GGDQ    ++   + +FS+FY  IN G+L STI+TPILR      +    CYPLAFG+PA LM VAL++ +LG   Y     + +I  K   C   A+KN +R R  + PK+E  L++A  +YD   I+ ++ + ++  LY+PLP++WAL++Q GSRWTLQA  M+G++   + I PDQM  +N I++++++PI D+ +YP+          L++MT+G+    ++F  A  +Q +I+  + LP+  G +++ +   +     MT+   GN+ TL
Sbjct:    5 KSRGCFGYPLSIFFIVVNEFCERFSYYGMRALLVLYFRNFLGWDDNLSTAIYHTFVALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVISVSSINDLTDHDHNGSPDSLPVHVALSMVGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINGGSLLSTIITPILRVQQCGIHSQQACYPLAFGVPAALMAVALIVFVLGSGMYKKFQPQGNIMGKVAKCIGFAIKNRFRHRSKAYPKREHWLDWAKEKYDERLISQIKMVTKVMFLYIPLPMFWALFDQQGSRWTLQATTMNGKIG-AIEIQPDQMQTVNAILIVIMVPIVDAVVYPLIAKCGFNFTSLKKMTVGMFLASMAFVVAAIVQVEID--KTLPVFPGGNQVQIKVLNIGNNNMTVHFPGNSVTL 418          

HSP 2 Score: 91.6633 bits (226), Expect = 1.400e-18
Identity = 46/94 (48.94%), Postives = 65/94 (69.15%), Query Frame = 2
Query: 1991 STISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            +T+++  Q PQY L++ GE++ S+TGL FSY QAP  MKS++ A W L+ A GNIIV++VA      KQ  EY++FA L +V  VIFA +A +Y
Sbjct:  578 NTVNMALQIPQYFLLTCGEVVFSVTGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGHFPKQWAEYILFASLLLVVCVIFAIMARFY 671          
BLAST of slc15a-1 vs. Ensembl Mouse
Match: Slc15a2 (solute carrier family 15 (H+/peptide transporter), member 2 [Source:MGI Symbol;Acc:MGI:1890457])

HSP 1 Score: 162.54 bits (410), Expect = 1.503e-44
Identity = 87/184 (47.28%), Postives = 118/184 (64.13%), Query Frame = 2
Query:  230 FPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAIN--LSGPIISLL---LIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIP 766
            +P ++ FI++ E CERFSYYGM+ +L LY    L   E  + S+YH F SLCYFT I+G+ I+D++LGK++T++ L  +Y LG    SL +IP +   +   I+SL+   LIA GTGG+K CV   GGDQ           YFS+FY  IN G+L S  +TP+LR +V C G +DCY LAFGIP
Sbjct:   53 YPLSIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVYVLGHVFKSLGAIPILGGKMLHTILSLVGLSLIALGTGGIKPCVAAFGGDQFEEEHAEARTRYFSVFYLSINAGSLISMFITPMLRGDVKCFG-EDCYALAFGIP 235          
BLAST of slc15a-1 vs. Ensembl Mouse
Match: Slc15a2 (solute carrier family 15 (H+/peptide transporter), member 2 [Source:MGI Symbol;Acc:MGI:1890457])

HSP 1 Score: 114.39 bits (285), Expect = 1.168e-28
Identity = 61/130 (46.92%), Postives = 86/130 (66.15%), Query Frame = 2
Query:  230 FPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAIN--LSGPIISLL---LIAFGTGGVKACVGPLGGDQ 604
            +P ++ FI++ E CERFSYYGM+ +L LY    L   E  + S+YH F SLCYFT I+G+ I+D++LGK++T++ L  +Y LG    SL +IP +   +   I+SL+   LIA GTGG+K CV   GGDQ
Sbjct:   53 YPLSIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVYVLGHVFKSLGAIPILGGKMLHTILSLVGLSLIALGTGGIKPCVAAFGGDQ 182          
BLAST of slc15a-1 vs. UniProt/SwissProt
Match: sp|Q9ES07|S15A2_MOUSE (Solute carrier family 15 member 2 OS=Mus musculus OX=10090 GN=Slc15a2 PE=1 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 4.589e-106
Identity = 246/729 (33.74%), Postives = 386/729 (52.95%), Query Frame = 2
Query:  230 FPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAI--NLSGPIISLL---LIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRER-HNSPKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEAR-QPLPINVGNSRLFL--VNSHPCEVQMTI-GN--------AYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTAL-----LNKYQFI-IKHSTTGV-LAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQT--VITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKE-TYDRMQELTEHVE 2329
            +P ++ FI++ E CERFSYYGM+ +L LY    L   E  + S+YH F SLCYFT I+G+ I+D++LGK++T++ L  +Y LG    SL +IP +   +   I+SL+   LIA GTGG+K CV   GGDQ           YFS+FY  IN G+L ST +TP+LR +V C G +DCY LAFGIP +LM +AL++  +G K Y   P   +I  +   C   A+ N +R R  + PK++  L++A+ +Y    I D++ + RI  LY+PLP++WAL +Q GSRWTLQA +MDG+L    V+ PDQM +LN  +V+V IP+FD  IY +          LR+M +G+   CL+F  A  ++ +I     P P    +  +FL  +N    E+++T+ GN        + +        S+  ++      +  LKY   ++ N+          V ++N Y L   EN + +S                 + LV  T +     +   +FI   H    + L A+  +   +    S++ T+ + G+Y          P V   T   D V SLN   L+       ++ + +   + +   Q      IP      + +SI WQ PQY+L++  E++ S+TGL FSY QAP  MKS++ A W L+ A GNIIV++VA+   + + + E+++F+ L +V  +IF+ + YYY   K E  ++  ++   H++
Sbjct:   42 YPLSIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVYVLGHVFKSLGAIPILGGKMLHTILSLVGLSLIALGTGGIKPCVAAFGGDQFEEEHAEARTRYFSVFYLSINAGSLISTFITPMLRGDVKCFG-EDCYALAFGIPGLLMVLALVVFAMGSKMYRKPPPEGNIVAQVTKCIWFAICNRFRNRSEDIPKRQHWLDWAAEKYPKHLIMDVKALTRILFLYIPLPMFWALLDQQGSRWTLQANKMDGDLG-FFVLQPDQMQVLNPFLVLVFIPLFDLVIYRLISKCGVNFSSLRKMAVGMILACLAFAVAALVEIKINGMIHPQP---ASQEIFLQVLNLADGEIEVTVQGNRNNPLLVESISSFQNTTHYSKLRLETKSQDLHFHLKYNNLSVHNEYS--------VEEKNCYQLVVHENGESLS-----------------SMLVKDTGIKPANGMTAIRFINTLHKDMNISLDANAPLSVGKDYGVSEYRTVQR-GKY----------PAVHCETE--DNVFSLNLGQLDFG-----TTYLFVITNITNRGLQAWKAEDIP-----ANKLSIAWQLPQYVLVTAAEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTVAVGNIIVLIVAQFSGLVQWA-EFVLFSCLLLVVCLIFSVMGYYYVPLKSEGIHEATEKQIPHIQ 716          
BLAST of slc15a-1 vs. UniProt/SwissProt
Match: sp|P46029|S15A2_RABIT (Solute carrier family 15 member 2 OS=Oryctolagus cuniculus OX=9986 GN=SLC15A2 PE=1 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 7.429e-103
Identity = 233/709 (32.86%), Postives = 377/709 (53.17%), Query Frame = 2
Query:  212 CSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIP-----AINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRER-HNSPKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTI--GNAYTLVSGGYKISQSS-------IDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKE 2290
            C S  ++P ++ FI++ E CERFSYYGM+ +L LY    L   E  + S+YH F SLCYFT I+G+ I+D++LGK++T++ L  +  LG  + SL++ P      ++    ++ L LIA GTGG+K CV   GGDQ           YFS FY  IN G+L ST +TP+LR +V C G +DCY LAFG+P +LM +AL++  +G K Y   P   +I  + + C   A+ N ++ R  + PK++  L++A+ +Y    I D++T+ R+  LY+PLP++WAL +Q GSRWTLQA +M+G L    V+ PDQM +LN ++V++ IP+FD  IY +          LR+M +G+   CL+F AA  ++ +I    P         L ++N    EV++T+   N  +L++   K  Q +       ++     +   LKY   ++  +        + V +RN Y L   E+ + IS       +     G    + + +          ++ +    L   +++   ++   S + T+ + G Y          P V   T   D   SLN   L+     +        +++ ++ +Q +    +     + +SI WQ PQY L++ GE++ S+TGL FSY QAP  MKS++ A W L+ A GNIIV+VVA+   + + + E+++F+ L +V  +IF+ + YYY   K E
Sbjct:   38 CGS--NYPLSIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVNVLGHVIKSLSAFPILGGKVVHTVLSLVGLCLIALGTGGIKPCVAAFGGDQFEEKHAEERTRYFSGFYLAINAGSLISTFITPMLRGDVQCFG-EDCYALAFGVPGLLMVIALVVFAMGSKMYKKPPPEGNIVAQVVKCIWFAISNRFKNRSEDIPKRQHWLDWAAEKYPKQLIMDVKTLTRVLFLYIPLPMFWALLDQQGSRWTLQATKMNGNLG-FFVLQPDQMQVLNPLLVLIFIPLFDLVIYRLISKCGINFTSLRKMAVGMVLACLAFAAAATVEIKINEMAPPQPGSQEILLQVLNLADDEVKLTVLGNNNNSLLADSIKSFQKTPHYSKIHLNTKSQDFYFHLKYHNLSIYTE--------HSVEERNWYSLIIREDGKSISSIMVKDMENETTYGMTAIRFINT----------LQENVNISLGTDISLNVGENYGVSAYRTVQR-GEY----------PAVHCKTEDKD--FSLNLGLLDFGASYL--------FVITNSTKQGLQAWKMEDIPANKVSIAWQLPQYALVTAGEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTVAIGNIIVLVVAQFSGLVQWA-EFVLFSCLLLVVCLIFSIMGYYYIPIKSE 702          
BLAST of slc15a-1 vs. UniProt/SwissProt
Match: sp|Q16348|S15A2_HUMAN (Solute carrier family 15 member 2 OS=Homo sapiens OX=9606 GN=SLC15A2 PE=1 SV=2)

HSP 1 Score: 333.183 bits (853), Expect = 2.646e-101
Identity = 243/730 (33.29%), Postives = 380/730 (52.05%), Query Frame = 2
Query:  212 CSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIP-----AINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFL--VNSHPCEVQMT-IGNA-YTLVSGGYKISQSS-------IDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGV-LAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRMQELTEHVE*LRNN 2344
            C S  ++P ++ FI++ E CERFSYYGM+ +LILY    L   E  + SIYH F SLCYFT I+G+ I+D++LGK++T++ L  +Y LG  + SL ++P      ++    +I L LIA GTGG+K CV   GGDQ           YFS+FY  IN G+L ST +TP+LR +V C G +DCY LAFG+P +LM +AL++  +G K Y   P   +I  +   C   A+ N ++ R    PK++  L++A+ +Y    I D++ + R+  LY+PLP++WAL +Q GSRWTLQA +M+  L    V+ PDQM +LN ++V++ IP+FD  IY +          LR+M +G+   CL+   A A   +I+  +  P   G   +FL  +N    EV++T +GN   +L+    K  Q +       +      ++  LKY   +L  +        + V ++N Y L   E+   IS       +     G    + V +            H    + L+   ++   +    S + T+ + G Y          P V   T   D   SLN   L+     +        +++ +N  Q +    +     + +SI WQ PQY L++ GE++ S+TGL FSY QAP  MKS++ A W L+ A GNIIV+VVA+   + + + E+++F+ L +V  +IF+ + YYY   K E  D      +H+  ++ N
Sbjct:   38 CGS--NYPLSIAFIVVNEFCERFSYYGMKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVYVLGHVIKSLGALPILGGQVVHTVLSLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEERTRYFSVFYLSINAGSLISTFITPMLRGDVQCFG-EDCYALAFGVPGLLMVIALVVFAMGSKIYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHWLDWAAEKYPKQLIMDVKALTRVLFLYIPLPMFWALLDQQGSRWTLQAIRMNRNLG-FFVLQPDQMQVLNPLLVLIFIPLFDFVIYRLVSKCGINFSSLRKMAVGMILACLA--FAVAAAVEIKINEMAPAQPGPQEVFLQVLNLADDEVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTE--------HSVQEKNWYSLVIREDGNSISSMMVKDTESRTTNGMTTVRFVNTL-----------HKDVNISLSTDTSLNVGEDYGVSAYRTVQR-GEY----------PAVHCRTE--DKNFSLNLGLLDFGAAYL--------FVITNNTNQGLQAWKIEDIPANKMSIAWQLPQYALVTAGEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTIAVGNIIVLVVAQFSGLVQWA-EFILFSCLLLVICLIFSIMGYYYVPVKTE--DMRGPADKHIPHIQGN 718          
BLAST of slc15a-1 vs. UniProt/SwissProt
Match: sp|O01840|PEPT3_CAEEL (Peptide transporter 3 OS=Caenorhabditis elegans OX=6239 GN=pept-3 PE=1 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 1.051e-89
Identity = 214/710 (30.14%), Postives = 359/710 (50.56%), Query Frame = 2
Query:  197 EDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSGPIIS------LLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFY-VHVPIRDSIYMKTISCFITAVKNWY-RERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDG--TYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNV-----PSNT-SKWD--GVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            E++        +P AV+F++  E CERFS+YGM+TIL +YL        S A  IYH+F  + Y T +IGS ++D+  G+++ ++   S+Y +G  L+SL ++P   LS PI S      L +IAF TG +K CV     DQ    +K L   +FS FYF IN G+L + I+TPILR  V C G   C+PLAFG+P +LM +AL++ L+G   Y  H P ++++  K ++   T+++        + P    L++A+ E+    I+  R +L +A+++ PL  +WAL++Q GS W LQA ++DG +  +  ILP+Q+  +N + V++L+PIF+  +YP    I+ ++ PLR+M +G   T  SF  A  LQ ++      P ++G   L  V +          +   L+  G  + +   +L  G  T+N  LK       +QE      I++      Y+++       + V  F    +    G    ++   TA  +    +   +  G + +S                 +K+G Y+  +   +  PNV     P N+ S  D    ++LN     V+ + I  S     + +L  P              +++SI+W  PQY++I++GE+L+S+TGL F+Y QA   MKS++ A W L+   GN+I M+++   L+   + E+  ++ L ++   +F  LA  Y
Sbjct:    2 EEKSLLQKLRSYPPAVFFMLGNEFCERFSFYGMKTILFIYLITEHEFSPSKATFIYHLFTCIAYLTPLIGSIMADSVFGRFKVILYGSSIYVVGHVLLSLGAVPF--LSYPIRSSLDFSGLFVIAFATGCIKPCVSAFAADQFTEDQKDLRSQFFSFFYFAINGGSLFAIIITPILRGRVQCFGNAHCFPLAFGVPGVLMLLALILFLMGWSMYKKHPPSKENVGSKVVAVIYTSLRKMVGGASRDKPVTHWLDHAAPEHSQKMIDSTRGLLNVAVIFCPLIFFWALFDQQGSTWVLQARRLDGRVG-HFSILPEQIHAINPVCVLILVPIFEGWVYPALRKIT-RVTPLRKMAVGGLLTAFSFAIAGVLQLKVNETMEFPPSLGRIYLQRVGNESLISDFRYKSDGRLIGDGM-LPKGRTELDAGIYTFNTGLKNE-----SQE------IDISTPNKGYVMAVFRLKDAVEVVKFDYKVEKTDNGA--TRVFVVTAREDADTLVYAINKKGKILSSCE---------------LKSGSYVDVIPGIISDPNVRLYWGPKNSCSGVDCPNTVTLNAQMGAVHVLHIHPSTTEGDFNLLVRP--------------NSVSILWSLPQYIIITLGEVLLSVTGLEFAYSQAAPNMKSVLTAMWLLTVFAGNLIDMMISGTRLIPHPALEFFFYSTLMVIVMGVFILLAMQY 664          
BLAST of slc15a-1 vs. UniProt/SwissProt
Match: sp|P36836|S15A1_RABIT (Solute carrier family 15 member 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC15A1 PE=2 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 1.796e-83
Identity = 156/382 (40.84%), Postives = 236/382 (61.78%), Query Frame = 2
Query:  218 SCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPA--------------INLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRA-NVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKK-ELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPL 1312
            SCF +P +++FI++ E CERFSYYGMR +LILY    +   ++ +  IYH FV+LCY T I+G+ I+D +LGK++T+V L  +YT+G  + SL+S+                ++++  +I LLLIA GTGG+K CV   GGDQ    ++   + +FS+FY  IN G+L STI+TP++R      +    CYPLAFGIPAILM V+L++ ++G   Y     + +I  K + C   A+KN +R R    PK+   L++A  +YD   I  ++ + R+  LY+PLP++WAL++Q GSRWTLQA  M G +   L I PDQM  +N I++I+L+PI D+ +YP+          L++MTIG+    ++F AA  LQ +I+   P+
Sbjct:    8 SCFGYPLSIFFIVVNEFCERFSYYGMRALLILYFRNFIGWDDNLSTVIYHTFVALCYLTPILGALIADAWLGKFKTIVWLSIVYTIGQAVTSLSSVNELTDNNHDGTPDSLPVHVAVCMIGLLLIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTIITPMVRVQQCGIHVKQACYPLAFGIPAILMAVSLIVFIIGSGMYKKFKPQGNILSKVVKCICFAIKNRFRHRSKQFPKRAHWLDWAKEKYDERLIAQIKMVTRVLFLYIPLPMFWALFDQQGSRWTLQATTMSGRIG-ILEIQPDQMQTVNTILIIILVPIMDAVVYPLIAKCGLNFTSLKKMTIGMFLASMAFVAAAILQVEIDKTLPV 388          

HSP 2 Score: 99.3673 bits (246), Expect = 3.916e-20
Identity = 49/94 (52.13%), Postives = 67/94 (71.28%), Query Frame = 2
Query: 1991 STISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            +T+++ WQ PQY LI+ GE++ SITGL FSY QAP  MKS++ A W L+ A GNIIV++VA    + KQ  EY++FA L +V  VIFA +A +Y
Sbjct:  576 NTMNMAWQIPQYFLITSGEVVFSITGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQINKQWAEYILFAALLLVVCVIFAIMARFY 669          
BLAST of slc15a-1 vs. TrEMBL
Match: A0A0H3YF86 (Slc15a-1 OS=Schmidtea mediterranea OX=79327 GN=slc15a-1 PE=2 SV=1)

HSP 1 Score: 1439.86 bits (3726), Expect = 0.000e+0
Identity = 729/729 (100.00%), Postives = 729/729 (100.00%), Query Frame = 2
Query:  143 MDTDSNHNEESKLIKDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRMQELTEHVE 2329
            MDTDSNHNEESKLIKDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRTILILYLTQHLLLKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPAILMGVALLILLLGHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRMQELTEHVE
Sbjct:    1 MDTDSNHNEESKLIKDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRTILILYLTQHLLLKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPAILMGVALLILLLGHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRMQELTEHVE 729          
BLAST of slc15a-1 vs. TrEMBL
Match: B0W8F3 (Oligopeptide transporter OS=Culex quinquefasciatus OX=7176 GN=6034706 PE=4 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 1.146e-120
Identity = 239/727 (32.87%), Postives = 411/727 (56.53%), Query Frame = 2
Query:  152 DSNHNEESKLIKDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSGPIIS---LLLIAFGTGGVKACVGPLGGDQ--IPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCE--VQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCN---LINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDR 2302
            + +  EE      + +D E       +PRA+ FII  E CERF+YYGMRTIL+LYLT+ L   +  A  +YH F +L YF  +IG+ ISD++LGK+RT++ L  +Y  GSTL++L +IP  ++   I++   LLLIA G+GG+K CV   GG+Q  +P   K L   +FSMFYF +N G+  ST+LTPILR +V C G DDC+ LAFG+P +LM  +++I LLG   Y  V    +++MK   C  TA++   +E+  +P++  L+Y+   +    +++ R +L +  LY+PLPV+WAL++Q GSRWT QA +MDG+L     I PDQM ++N ++++V IP+++   YP+   I  + RPL+++T+G  F  +SF  +  ++ Q+E    +    G S+L + N   C+  V+ ++ +  T V    ++ +       G  +    ++  +     N EIS   ++    K+ +Y ++N  +   +++  +      + KG+PL +++ +TA           +TT V          + +   D       G +++++        V S  S+++  + ++G   +   +R+      ++ +++        T  +++   ++++++W  PQY+++++GE++ SITGL FS+ QAP+ MKS++   W L+ A GN+IV++VA+    + Q WE+++FA+L  V   IFA LAYYY+    + YD 
Sbjct:    2 EDSKKEEVASTSGEVKDVEGEPKKLKYPRAIPFIISNEFCERFNYYGMRTILVLYLTRKLDYDDDTATVLYHSFTTLVYFMCVIGAIISDSWLGKFRTILYLSLVYVGGSTLIALGAIPTWDVDARIMTIFGLLLIAIGSGGIKPCVAAFGGEQFKMPEQAKYLA-VFFSMFYFAVNSGSFVSTMLTPILREDVKCFGDDDCFSLAFGVPGMLMITSIIIFLLGKPLYKIVAPAGNMFMKVSKCIWTAIRTRSKEKSVNPREHWLDYSEKRWGQQLVDETRILLNVLRLYIPLPVFWALFDQQGSRWTFQATRMDGDLG-FWTIKPDQMQVINPLLILVFIPLYEVAFYPLLSMIGIR-RPLQKLTLGGIFAGVSFVISAIIEMQLEDTYAVLPKAGESQLRIFNGMNCDYNVETSLADHATFVLKAKEMFEEKYVRVSGQQSFTYNFSSNSNDPACNAEISGQFAME-EHKQISYFVNN-RDGSALNLMRYEDETDKSSKGYPLFRVLGNTA----------QNTTIVF---------KDLDSGDLFNRHTNGTFVYDI--------VDSYPSRYE--ILVDGKPTKEYTLRLGG----VYAIIVGEEGNDYWTEAIVVTEPNSVNMLWLVPQYVVMTLGEVMFSITGLEFSFTQAPESMKSVLQGCWQLTVAIGNLIVVIVAEAKFFDAQKWEFIMFAVLMFVDMGIFAVLAYYYKAIPLKNYDE 690          
BLAST of slc15a-1 vs. TrEMBL
Match: A0A369SE25 (Solute carrier family 15 member 1 OS=Trichoplax sp. H2 OX=287889 GN=TrispH2_002939 PE=4 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 1.227e-120
Identity = 261/740 (35.27%), Postives = 400/740 (54.05%), Query Frame = 2
Query:  146 DTDSNHNEESKLIKDDNEDEERCSSCF-HFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAIN---LSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINV----GN-SRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKY-AKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGRYI---WNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRMQELTEHV 2326
            D  S   E+ K+        +  +SC    P+++YFI+  E CERFSYYGMR IL+LY T    L ++ A ++YH FV LCYFT ++G+ ++D +LGKYRT++ +  +Y +G+T+++LT+IP ++   L+GPII L+LI FGTGG+K CV   GGDQI  ++  LL+ +FS+FYF IN G++ STI TPILR NV C    DCY LAFGIPAILM VA+ +  +G   Y   P   +I          A+ N    + + P    L+ AS  +    + D++ +LR+ ++++PLP++W L++Q GSRWTLQA +M G L     + PDQM   N +++I+LIP+F+S IYP+   +   +RPL+RM  GI F   +F  A  LQ QIEA   L ++     GN +R  LVN+ PC +      A   ++  Y  S S I  P G   + +     C+L  Q+        L    ++        NQ+I  Q   A   + PK        A   + N ++  I          ++T   N+   +  +I  M+   Y    ++  S  +     SN +         GNN          +  +     +S+P + V+T  + +   S I I+WQ PQY++++ GE++ SITGL F+Y QAP  MKS + A W L+ AFGN+IV++VA+   +  Q+ E+  FA L     VIF  ++++Y+  + E  ++  EL++ V
Sbjct:   13 DGQSTDVEDRKISGKAWGRVKNFTSCISDLPKSIYFIVGNEFCERFSYYGMRAILVLYFTNFYGLDKNTATALYHAFVMLCYFTPLLGAMLADGWLGKYRTILYVSLIYAIGNTVVTLTAIPPLSHKSLAGPIIGLMLIGFGTGGIKPCVSAFGGDQINPNQHKLLERFFSIFYFSINAGSVLSTIFTPILRGNVHC-FHGDCYALAFGIPAILMVVAIFVFWMGRPLYKRNPPTGNILADVCKAICHAIGN---RKSDIPANHWLDKASDRFSPKLLEDIKAMLRVLVMFIPLPIFWTLFDQQGSRWTLQAEEMSGNLGPLGKMQPDQMQAANPVLIIILIPVFESLIYPLLRKLKIPMRPLQRMCTGIIFASFAFVIAGLLQLQIEA---LDVDRTHPEGNLTRFSLVNNIPCNLNFVQKQAGVALNLNYTQSNSYITAPSGPMTLTVTANNSCSLFKQK-----KFQLHLSESSSSYVLSYQNQQIFSQKVKA-NVTRPKSD-----RAIIRIFNTWKKSINF--------TLTAATNKKQHKISFIEPMQVYNYTVVYYDTYSYSIIDEDGSNPNPTKNPTVEFGNN---------GAYTVYVQPSVSDPNKVVVTNHVDIQPNS-IPILWQAPQYIVMTAGEVMFSITGLEFAYSQAPASMKSCLQAGWLLTVAFGNLIVVIVAEARFIPDQAAEFFFFAGLSACIFVIFVIMSHFYKYVRHEEVEK--ELSDTV 714          
BLAST of slc15a-1 vs. TrEMBL
Match: A0A1Q3FLX2 (Putative peptide transporter family 1 OS=Culex tarsalis OX=7177 PE=4 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 3.204e-118
Identity = 240/727 (33.01%), Postives = 401/727 (55.16%), Query Frame = 2
Query:  152 DSNHNEESKLIKDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSG---PIISLLLIAFGTGGVKACVGPLGGDQ--IPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCE--VQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKS---NPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDR 2302
            + +  EE      D +D E       +PRA+ FII  E CERF+YYGMRTIL+LYLT+ L   +  A  +YH F +L YF  +IG+ ISD++LGK+RT++ L  +Y  GSTL++L +IP  ++      I  LLLIA G+GG+K CV   GG+Q  +P   K L   +FSMFYF +N G+  ST+LTPILR +V C G DDC+ LAFG+P +LM  ++LI LLG   Y  V    +++MK   C  TA++   +E+  +P+   L+Y+   +    +++ R +L +  LY+PLPV+WAL++Q GSRWT QA +MDG+L     I PDQM ++N ++++V IP+++   YP+   I  + RPL+++T+G  F  +SF  +  ++ Q+E    +    G S+L + N   C+  VQ  + +  + V    ++ +       G  +    +   +  N ++  +          +  +S   NN+  S      ++     + KG+PL +++ +TA           +TT V          + +   D       G +++++        V S  S+++  + ++G       +R+      ++ +++        T P+++   ++++++W  PQY+++++GE++ SITGL FS+ QAP+ MKS++   W L+ A GN+IV++VA+    + Q WE+++FA+L  V   IFA LAYYY+    + YD 
Sbjct:    2 EDSKKEEVASTSGDVKDVEGEPKKLKYPRAIPFIISNEFCERFNYYGMRTILVLYLTRKLDYDDDTATVLYHSFTTLVYFMCVIGAIISDSWLGKFRTILYLSLVYVGGSTLIALGAIPTWDVDARAMTICGLLLIAIGSGGIKPCVAAFGGEQFKMPEQAKYLA-VFFSMFYFAVNSGSFVSTMLTPILREDVKCFGDDDCFSLAFGVPGMLMITSILIFLLGKPLYKIVAPAGNMFMKVSKCIWTAIRTRSKEKSVNPRDHWLDYSEKRWGQQLVDETRILLNVLRLYIPLPVFWALFDQQGSRWTFQATRMDGDLG-FWTIKPDQMQVINPLLILVFIPLYEVAFYPLLSLIGIR-RPLQKLTLGGVFAGVSFVISAIIEMQLEDTYAILPKAGESQLRIFNGMNCDYNVQTNLPDHASFVLKAKEMFEEKYVRVSGKQSFTYTFTSSS--NGQLCNVPINGQFAMEEHKQISFFVNNRDGSAPDLMRYEDETDKSSKGYPLFRVLGNTA----------QNTTIVF---------KDLDSGDPFNRHTNGTFVYDI--------VDSYPSRYE--ILVDGKPTLEYTLRLGG----VYAILVGEEGNDYWTAPIVVTEPNSVNMLWLVPQYVVMTLGEVMFSITGLEFSFTQAPESMKSVLQGCWQLTVAVGNLIVVIVAEAKFFDAQKWEFVMFAVLMFVDMGIFAVLAYYYKSIPLKNYDE 690          
BLAST of slc15a-1 vs. TrEMBL
Match: T2MCC7 (Solute carrier family 15 member 2 OS=Hydra vulgaris OX=6087 GN=SLC15A2 PE=2 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 2.322e-117
Identity = 255/742 (34.37%), Postives = 406/742 (54.72%), Query Frame = 2
Query:  182 IKDDNEDEERCSSC------FHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAI----NLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQP---LPINVGNSRLFLVNSHPCEV-----QMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLN---NGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRM----SKKETYDRMQELTEHVE 2329
            +++ +E+EE           F +P  V FI+  E CERFSYYGM  IL++YLT  L + + +A ++YH F  LCYF+ I G+ I+D++ GKY+T++ +  +Y +G+ ++S+T++P++      +GP I L+LIA GTGG+K CV   GGDQ  A +   L S+FS+FYF IN G+L +T+LTP+LR +V C G D CYPLAFG+PAILM VALL+ L G   Y  VP   ++ ++  S   +A+KN      +  KK+  +++A  EY    I+D++ + ++  ++LPLPV+W L++Q GSRWTLQA +M+G++     + PDQM  LN + V++LIP  ++ +YP+        +PL+RM  G+A T +SF  A  LQ ++EA+     LP   G +    VN+ PCE+      M I N    VS GY+       +P    +I +       +N E +  +      ++ +Y +    N+ +++V          P GH             K +F+      G ++  VTV  N+++   D +   K   YI          N+ + T K     +   N L +  I   +  +   Y ++  P + +  + +L     +   I+I+WQ PQY++I++GE++ SITGL F+Y Q+P  MKS + A W L+ + GN++V+++A + L +  + E+  FAIL  V  VIFA +AY+Y      S +ET       TE  E
Sbjct:    9 VEEQSENEEAVKVAPKQKLIFGYPVQVLFILGNEFCERFSYYGMHAILVIYLTTMLNMSKDDATAVYHAFNMLCYFSPIFGAIIADSFWGKYKTIMYVSVIYAVGNIVVSVTAVPSVLHELKFAGPAIGLVLIALGTGGIKPCVSAFGGDQFEAGQDDKLRSFFSIFYFSINFGSLIATLLTPVLRGDVQCFGYD-CYPLAFGVPAILMVVALLLFLAGSSLYKKVPPEGNVVVEVSSAVGSALKNRIANCGSGTKKDHWMDWAGQEYSPVLISDIKALFKVLFMFLPLPVFWTLFDQQGSRWTLQAMEMNGDIGYLGTVKPDQMQALNPVFVMILIPFVEAVVYPLGRKCRFLTKPLQRMGFGMALTAISFVVAGFLQIKMEAKSSVADLPAT-GFANYRFVNTVPCEIDIYGPDMVITN----VSVGYQQGTEYFAIPITINSIYISTDCPPKMNAEPNIYVE-----EKGSYTMVIGANHSRLAVMQLADDITPLPHGH------------AKVRFL---HAGGSVSDKVTVHMNKTL-SIDLLPFTKP-DYI----------NIVAKTYKVRVAPTGTVNALALRSISFGNGGI---YTVVIQPNKKLQGLKMLEYADLSPRPINILWQIPQYIIITLGEVMFSITGLEFAYSQSPPSMKSCIMAAWLLTVSVGNLLVVILAGVKLTDDMAEEFFFFAILLAVVTVIFAIMAYFYTYIYYGSSRETDPNPNGCTEATE 709          
BLAST of slc15a-1 vs. Ensembl Cavefish
Match: slc15a1a (solute carrier family 15 member 1a [Source:ZFIN;Acc:ZDB-GENE-091204-9])

HSP 1 Score: 300.442 bits (768), Expect = 2.416e-90
Identity = 211/718 (29.39%), Postives = 359/718 (50.00%), Query Frame = 2
Query:  185 KDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCY---FTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIP--------------AINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRAN-VACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALL--NKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            ++D++ + +   C ++P +++FI++ E CERFSYYGMR                  V + H +   CY   +   +  F S       RT++ L  +Y +G  +M++++I               ++++   ++ L LIA GTGG+K CV   GGDQ   H+     ++FS+FY  IN G+L ST++TPILR      +    CYPLAFG+PA LM V+L++ + G   Y+    + +I M   +C   A+ N +R R +  PK+E  L++A  +YD   I  ++ + R+  LY+PLP++W L++Q GSRWTLQA  MDG   + LV+ PDQM  +N I+++ L+PI D  +YP+         PL+RMT+G+    ++F +A  +Q QI+  + LP+    S          E Q+ I N   + SG   I+      P   + +  + A   L    ++ ++S+N  P   N+ L+  + N  I          ++P    + + + S      N  +F+   S+      +++  GN   F +     +  G  I+ + + +        +  +       G    + P  +  +E         N    ++ +  +  N  T+ +  Q PQY LI+ GE++ S+TGL FSY QAP  MK+++ A W  + A GN IV++VA++  + +Q  EY++FA L +   +IF+ +AY+Y
Sbjct:    6 RNDDKSKPKKVECCNYPVSIFFIVVNEFCERFSYYGMR---------------GKCVCLNH-YNKWCYCICYNLALNIFPS-------RTIIYLSIVYAIGQIVMAVSAINDLTDADRDGTPDNMSVHVGLAMLGLFLIALGTGGIKPCVSAFGGDQFDDHQTRQRSTFFSVFYLCINGGSLLSTLITPILRGQECGIHTQQKCYPLAFGVPAALMVVSLIVFIAGSGMYIKAKPKGNIMMDVCNCIGFAINNRFRHRSSKYPKREHWLDWADEKYDKLLIAQIKMVCRVLFLYIPLPMFWTLFDQKGSRWTLQATTMDGTFGS-LVLQPDQMQTVNPILILTLVPIMDRVVYPLIKKCGFNFTPLKRMTVGMFLAAMAFVSAALVQIQID--ETLPVFPSAS----------ESQLKIVN---MASGQMNITIP----PQQPFALGSEQASDYLTFSNMNIMVSLNNPPISKNFSLTVKKRNTLII--------PADPNTMYMTQDITSKPEQGSNAVRFVNGLSS----EVNMSYAGNDKQFPALEYVYLPQGERIFTITNGI-------QSCSFSRKFGFGGAYTFLIPSTLLWTE---------NCGNAIVEVEDIKPN--TVHMALQIPQYFLITAGEVVFSVTGLEFSYSQAPSNMKAVLQAGWLFTVAVGNFIVLIVAELAKLPQQWAEYVLFASLLVAVCIIFSIMAYFY 650          
BLAST of slc15a-1 vs. Ensembl Cavefish
Match: SLC15A1 (solute carrier family 15 member 1 [Source:HGNC Symbol;Acc:HGNC:10920])

HSP 1 Score: 296.975 bits (759), Expect = 2.968e-89
Identity = 157/392 (40.05%), Postives = 241/392 (61.48%), Query Frame = 2
Query:  185 KDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSG--------------PIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRAN-VACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQP 1309
            K+    ++  S C  +P +++FI++ E CERFSYYGMR +L+LY    L   +  A +IYH FV+LCY T I+G+ ++D++LGK++T+V L  +YT+G  +M++++I  I  S                ++ L LIA GTGG+K CV   GGDQ   H++    ++FS+FY  IN G+L ST++TPILRA     N    CYPLAFG+PA LM VAL++ + G   Y     + +I ++   C   A+KN +  R    PK+E  +++A+ +Y+   I  ++ +L++  LY+PLP++WAL++Q GSRWTLQA  MDG      ++ PDQM  +N I+++V++PI DS +YP+         PL+RMT+G+    L+F AA  +Q QI+ R P
Sbjct:   16 KEQGRTKKSKSQCCGYPLSIFFIVVNEFCERFSYYGMRAVLVLYFRYFLRWDDDLATTIYHTFVALCYLTPILGAIVADSWLGKFKTIVYLSIVYTIGQAVMAVSAIHDITDSNQDGTPDNMTLHVALSMLGLFLIAVGTGGIKPCVAAFGGDQFQDHQEKQRSTFFSIFYLSINAGSLLSTLITPILRAQECGINSQQKCYPLAFGVPAALMAVALVVFIAGSSMYTKAAPKGNIMLEVCKCIGFAIKNRFNHRSKVYPKREHWMDWANEKYNKLLIAQVKMVLKVLFLYIPLPMFWALFDQQGSRWTLQATTMDGNFG-AFIVQPDQMQTVNPILILVMVPIVDSVVYPLIKKCGLNFTPLKRMTVGMFMAGLAFVAAALVQVQIDVRNP 406          

HSP 2 Score: 95.1301 bits (235), Expect = 1.085e-19
Identity = 45/94 (47.87%), Postives = 67/94 (71.28%), Query Frame = 2
Query: 1991 STISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            +TI + WQ PQY L++ GE++ S+TGL FSY QAP  MKS++ A W L+ A GNIIV++VA+   + +Q  EY++FA L +   +IF+ +AY+Y
Sbjct:  539 NTIHMAWQIPQYFLMTSGEVVFSVTGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAEAGQLPEQWAEYVLFASLLMCVCIIFSIMAYFY 632          
BLAST of slc15a-1 vs. Ensembl Cavefish
Match: SLC15A1 (solute carrier family 15 member 1 [Source:HGNC Symbol;Acc:HGNC:10920])

HSP 1 Score: 294.664 bits (753), Expect = 1.738e-88
Identity = 158/399 (39.60%), Postives = 243/399 (60.90%), Query Frame = 2
Query:  164 NEESKLIKDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSG--------------PIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRAN-VACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQP 1309
             E+ +  K  ++ E     C  +P +++FI++ E CERFSYYGMR +L+LY    L   +  A +IYH FV+LCY T I+G+ ++D++LGK++T+V L  +YT+G  +M++++I  I  S                ++ L LIA GTGG+K CV   GGDQ   H++    ++FS+FY  IN G+L ST++TPILRA     N    CYPLAFG+PA LM VAL++ + G   Y     + +I ++   C   A+KN +  R    PK+E  +++A+ +Y+   I  ++ +L++  LY+PLP++WAL++Q GSRWTLQA  MDG      ++ PDQM  +N I+++V++PI DS +YP+         PL+RMT+G+    L+F AA  +Q QI+ R P
Sbjct:   16 KEQGRTKKSKSQVE-----CCGYPLSIFFIVVNEFCERFSYYGMRAVLVLYFRYFLRWDDDLATTIYHTFVALCYLTPILGAIVADSWLGKFKTIVYLSIVYTIGQAVMAVSAIHDITDSNQDGTPDNMTLHVALSMLGLFLIAVGTGGIKPCVAAFGGDQFQDHQEKQRSTFFSIFYLSINAGSLLSTLITPILRAQECGINSQQKCYPLAFGVPAALMAVALVVFIAGSSMYTKAAPKGNIMLEVCKCIGFAIKNRFNHRSKVYPKREHWMDWANEKYNKLLIAQVKMVLKVLFLYIPLPMFWALFDQQGSRWTLQATTMDGNFG-AFIVQPDQMQTVNPILILVMVPIVDSVVYPLIKKCGLNFTPLKRMTVGMFMAGLAFVAAALVQVQIDVRNP 408          

HSP 2 Score: 95.1301 bits (235), Expect = 8.811e-20
Identity = 45/94 (47.87%), Postives = 67/94 (71.28%), Query Frame = 2
Query: 1991 STISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            +TI + WQ PQY L++ GE++ S+TGL FSY QAP  MKS++ A W L+ A GNIIV++VA+   + +Q  EY++FA L +   +IF+ +AY+Y
Sbjct:  531 NTIHMAWQIPQYFLMTSGEVVFSVTGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAEAGQLPEQWAEYVLFASLLMCVCIIFSIMAYFY 624          
BLAST of slc15a-1 vs. Ensembl Cavefish
Match: slc15a2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:103032564])

HSP 1 Score: 292.352 bits (747), Expect = 3.959e-87
Identity = 151/379 (39.84%), Postives = 240/379 (63.32%), Query Frame = 2
Query:  167 EESKLIKDDNEDEER----CSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSG-----PIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAA 1273
            +++ + K  +  ++R    C +  ++P ++ FI++ E CERFSYYGM+ +L LY  ++L   E+ + ++YH F  LCYFT I+G+ I+D++LGK++T++ L  +Y +G  + S+ +IP +  S       ++ L+LIAFGTGG+K CV   GGDQ           +FS+FY  IN G++ STI+TPILR +V C G  DCY LAFG+PA LM VAL++ + G   Y   P + ++ +    C   A+ N ++   NSPK++  L++A  +Y    I +++ +LR+ +LY+PLP++WAL++Q GSRWTLQA +M+ +     V+ PDQM +LN ++++V +PIFD  +YP+      KL PLR+M  G+    L+F AA
Sbjct:    5 QDNDMEKSTSNKQQRSPKICGT--NYPVSIAFIVVNEFCERFSYYGMKAVLTLYFIRYLHWNENLSTAVYHAFSGLCYFTPILGAIIADSWLGKFKTIIYLSIVYVIGHVIKSVGAIPDVGDSTTHVALSVLGLVLIAFGTGGIKPCVAAFGGDQFEEEHIDERRKFFSIFYMSINAGSVLSTIITPILRGDVQCFG-GDCYALAFGVPAALMVVALVVFIAGSGLYEKTPPQGNVLLNVCKCIGFAISNRWKRPRNSPKRQHWLDWAEEKYSKRLIQEIKMVLRVLLLYIPLPMFWALFDQQGSRWTLQATRMNMDFGGGFVVKPDQMQMLNALLILVFVPIFDMGVYPLVGLCRIKLTPLRKMATGMILAALAFCAA 380          

HSP 2 Score: 97.8265 bits (242), Expect = 1.488e-20
Identity = 49/119 (41.18%), Postives = 81/119 (68.07%), Query Frame = 2
Query: 1997 ISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDR--MQELTEHVE*LRNNK 2347
            + I WQ PQY+LI+ GE++ SITGL FSY QAP  MKS++ A W L+ AFGN+IV++VA+   +E+ + E+++FA L +  ++IF+ +AY+Y     +  D+    E  ++++ L+ +K
Sbjct:  585 VHIAWQVPQYVLITAGEVMFSITGLEFSYSQAPASMKSVLQAGWLLTVAFGNVIVLIVAEGAGLEQWT-EFVLFAALLVGVSIIFSIMAYFYTYVDPDQLDKEFRDENKDNMDDLKKDK 702          
BLAST of slc15a-1 vs. Ensembl Cavefish
Match: slc15a1a (solute carrier family 15 member 1a [Source:ZFIN;Acc:ZDB-GENE-091204-9])

HSP 1 Score: 237.269 bits (604), Expect = 3.396e-67
Identity = 155/459 (33.77%), Postives = 242/459 (52.72%), Query Frame = 2
Query:  239 AVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCY---FTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIP--------------AINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRAN-VACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYIL 1555
            +++FI++ E CERFSYYGMR                  V + H +   CY   +   +  F S       RT++ L  +Y +G  +M++++I               ++++   ++ L LIA GTGG+K CV   GGDQ   H+     ++FS+FY  IN G+L ST++TPILR      +    CYPLAFG+PA LM V+L++ + G   Y+    + +I M   +C   A+ N +R R +  PK+E  L++A  +YD   I  ++ + R+  LY+PLP++W L++Q GSRWTLQA  MDG    +LV+ PDQM  +N I+++ L+PI D  +YP+         PL+RMT+G+    ++F +A  +Q QI+   P+  +   S+L +VN    ++ +TI        G     Q+S  L     NI +     +L N  IS   S+  V KRN  I+
Sbjct:   21 SIFFIVVNEFCERFSYYGMR---------------GKCVCLNH-YNKWCYCICYNLALNIFPS-------RTIIYLSIVYAIGQIVMAVSAINDLTDADRDGTPDNMSVHVGLAMLGLFLIALGTGGIKPCVSAFGGDQFDDHQTRQRSTFFSVFYLCINGGSLLSTLITPILRGQECGIHTQQKCYPLAFGVPAALMVVSLIVFIAGSGMYIKAKPKGNIMMDVCNCIGFAINNRFRHRSSKYPKREHWLDWADEKYDKLLIAQIKMVCRVLFLYIPLPMFWTLFDQKGSRWTLQATTMDGTFG-SLVLQPDQMQTVNPILILTLVPIMDRVVYPLIKKCGFNFTPLKRMTVGMFLAAMAFVSAALVQIQIDETLPVFPSASESQLKIVNMASGQMNITIPPQQPFALGS---EQASDYLTFSNMNIMV-----SLNNPPISKNFSLT-VKKRNTLII 446          

HSP 2 Score: 89.3521 bits (220), Expect = 6.618e-18
Identity = 41/94 (43.62%), Postives = 65/94 (69.15%), Query Frame = 2
Query: 1991 STISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            +T+ +  Q PQY LI+ GE++ S+TGL FSY QAP  MK+++ A W  + A GN IV++VA++  + +Q  EY++FA L +   +IF+ +AY+Y
Sbjct:  550 NTVHMALQIPQYFLITAGEVVFSVTGLEFSYSQAPSNMKAVLQAGWLFTVAVGNFIVLIVAELAKLPQQWAEYVLFASLLVAVCIIFSIMAYFY 643          
BLAST of slc15a-1 vs. Ensembl Sea Lamprey
Match: slc15a1b (solute carrier family 15 member 1b [Source:ZFIN;Acc:ZDB-GENE-030131-4661])

HSP 1 Score: 332.413 bits (851), Expect = 4.240e-103
Identity = 240/706 (33.99%), Postives = 368/706 (52.12%), Query Frame = 2
Query:  230 FPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAIN----------LSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKN-WYRERHNSPKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVIL-PDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVN--SHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQ---EISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQT-------VITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            +P ++ FI++ E CERFSYYGM+ +L+LY    L    + A S+YH F  LCYFT ++G+ I+D++LGK++T++ L  +Y LG  + S+ ++P +           +   ++ L LIA GTGG+K CV   GGDQ           +FS+FY  IN G+L ST +TPILR +V C G  DCY LAFG+PAILM +AL++ + G   Y   P   ++ +   +C   A+KN W       PK++  L++A   Y+   I +++ +LR+  LY+PLP++WAL++Q GSRWTLQA  M G+      +L PDQM  +N I+++VLIPIFD  IYP+         PLRRM +G+    L+F AA  +Q +I+   P   + G   L ++N  +HP  +Q          +  + ++  S+     T++  L Y  C  I     + S   S N+V K   + +    N       +F+A +                        ++     G +AA   V GN        I  +  G Y     SPV   NV  + S  D  L   G       I++       + ++L    +T       ++ I  L  N  +I++ WQ PQY L++  E++ S+TGL FSY QAP  MKS++ A W L+ AFGN+IV++VA+   +E Q  E+++FA L  V  +IF+ +AY+Y
Sbjct:    1 YPISIAFIVVNEFCERFSYYGMKAVLVLYFRYFLHWNNNTATSVYHAFSGLCYFTPVLGAIIADSWLGKFKTIIYLSIIYVLGHVVKSIGALPDVGGHTVNVILIVMVLAMVGLGLIALGTGGIKPCVAAFGGDQFHPGMDHERGKFFSIFYLSINAGSLISTFVTPILRDDVQCFGA-DCYALAFGVPAILMVLALVVFIGGSSTYTKNPPEGNVLVNVSNCIGFAIKNRWNHRGKQFPKRDHWLDWAKGNYNDDLIMEVKMVLRVLFLYIPLPMFWALFDQQGSRWTLQATTMTGDFFQGAFVLKPDQMQTINPILILVLIPIFDVAIYPLIRKCGINFSPLRRMAVGMILAALAFVAAALVQLEIDKTLPDFPSSGEFSLRVINAGAHPLNIQFE--------NDQFDVANMSV---YSTFSTVL-YFICKDIYTVFLQASVHKSFNIVAKEKPFQIVAFRNGTMFPC-SFNAEEND----------------------LVSKPEEG-MAAVRFVGGNSE------IETVNIGTY-----SPV---NVSGDYSFTDYQLVFRGKKETCKKIKVFLDFGAAYTILLKPISKTLQQDEFGILMIQDLPEN--SINLAWQVPQYFLLTAAEVMFSVTGLEFSYSQAPTSMKSVLQAGWLLTVAFGNVIVLIVAEGANME-QWVEFILFACLLFVVFIIFSIMAYFY 652          
BLAST of slc15a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005298.1 (pep scaffold:Pmarinus_7.0:GL477384:58393:77162:-1 gene:ENSPMAG00000004819.1 transcript:ENSPMAT00000005298.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 2.346e-6
Identity = 19/44 (43.18%), Postives = 29/44 (65.91%), Query Frame = 2
Query: 1985 NGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLV 2116
              + +++ WQ PQ+LL+ + E+L SI GL F+Y  AP  M+S V
Sbjct:  121 EAARLTVWWQLPQFLLVGLSELLTSIGGLEFAYSAAPKHMQSAV 164          
BLAST of slc15a-1 vs. Ensembl Yeast
Match: PTR2 (Integral membrane peptide transporter; mediates transport of di- and tri-peptides; conserved protein that contains 12 transmembrane domains; PTR2 expression is regulated by the N-end rule pathway via repression by Cup9p [Source:SGD;Acc:S000001801])

HSP 1 Score: 112.464 bits (280), Expect = 3.173e-26
Identity = 104/388 (26.80%), Postives = 175/388 (45.10%), Query Frame = 2
Query:  233 PRAVYFIIITELCERFSYYG--------MRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAIN-----LSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHK----------KVLLDS------YFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQP 1309
            P   + I I EL ERFSYYG        M           L L    A  + + F   CY T + G +++D + GKY T+    ++Y  G  ++ +TSIP++      + G I +++LI   TG +KA +  L  DQ+P  K          +V++DS       F  FYF IN+G+L S + T  L  +         +  A+ +P     +A++ L+ G K Y+  PI D +  K+        KN  +   N+ K  +    +  ++  F+++++  L    +++  P+YW  Y  M S +  QA+ M+     N     D +   + I +I+ IPIF+  +YP     +P L+P+ ++  G  F   +   A  LQ  +    P
Sbjct:   79 PMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSL-SLMATTELEYHKG-------FWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSFKVCWILTKN--KFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGIPN-----DFLQAFDSIALIIFIPIFEKFVYPFIRRYTP-LKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGP 450          

HSP 2 Score: 71.2478 bits (173), Expect = 3.324e-13
Identity = 34/94 (36.17%), Postives = 55/94 (58.51%), Query Frame = 2
Query: 1970 PLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIF 2251
            PL  N  + + + WQ P Y+LIS  EI  SITGL ++Y +AP  MKS + + + L+NAFG+ I   ++ + +  K +W +   A+ C +   +F
Sbjct:  455 PLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLF 548          
BLAST of slc15a-1 vs. Ensembl Nematostella
Match: EDO33075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST97])

HSP 1 Score: 368.622 bits (945), Expect = 3.511e-117
Identity = 235/696 (33.76%), Postives = 391/696 (56.18%), Query Frame = 2
Query:  230 FPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAI----NLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSF-FAAF---ALQK-QIEARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSSI--DLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGR--YIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYR 2275
            +P +V++I+  E CERFSYYGM  IL++YLT  L + + +A ++YH F  LCYF+ ++G+ ++D++LGKYRT++ +  +Y  G+ ++++TSIPAI     L+G +I LLLIA GTGG+K CV   GGDQ  A ++ LL S+FS+FYF INLG+L S I+TPILR +V C G ++CYPLAFG+PAILM  ++ +   G K Y  +P   ++ ++       A+KN +R +  S KK+  +++A ++Y A  I+D++ + ++  ++LP+PV+W L++Q GSRWTLQA +MDG+L     + PDQ+  +N + +++LIP+F+  IYP+    +  ++PL+RM  G+    +SF FAAF   A+QK ++   +P P    N R  ++N+ PC ++++ G  +        + ++S+   +P    N++++   C++   E + L+ I+      N  +   +N + + ++     Q   P  H              ++  +K          V    N S+ Q    ++   GR  ++W VK                           V P+++  S        L     T +  P+      +IS++WQ PQY++++ GE+L SITGL F+Y Q+P  MKS + A W L+ + GN IV+V A+  +    + E+  FA L  V  +IF  ++YYY+
Sbjct:    7 YPISVWYILGNEFCERFSYYGMHAILVIYLTHMLKMDDDSATAVYHAFNMLCYFSPLLGAILADSWLGKYRTILYVSMIYAFGNIVVAITSIPAILAKVKLTGVMIGLLLIAIGTGGIKPCVSAFGGDQFSAAQENLLQSFFSIFYFAINLGSLLSMIVTPILRGDVNCFG-NNCYPLAFGVPAILMITSVGLFWCGRKKYKKIPPEGNVVLQVTCAVGCAIKNRFRNKDPSVKKDHWMDWAENDYGAKMISDIKALFKVLFMFLPMPVFWTLFDQQGSRWTLQAEEMDGDLGAFGTLKPDQVQAMNPVFILILIPLFEYAIYPLLSKCNLLVKPLQRMCAGMLLAAISFVFAAFLHIAIQKSRLHVVEP-PNGFANLR--VINAAPCPLKVS-GFGF---DTSLAVDKASVYAHVPITLTNLKVESQNCSVAVPEKNFLLKIS--EHEVNTFVIGTKNKELVGLKV---RQVKRPHNH-------------SFKVRVKRPHNHSFKVRVKRPHNYSLKQGRIGSVTTGGREYFLWAVKV------------------------CRVGPLQVVCS------FQLEMIRYTDVR-PM------SISMLWQLPQYIVLTSGEVLFSITGLEFAYSQSPVSMKSCIMAAWLLTVSIGNAIVVVFAEARITNNMATEFFFFAGLLAVVMLIFMFMSYYYK 639          
BLAST of slc15a-1 vs. Ensembl Nematostella
Match: EDO33176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSZ4])

HSP 1 Score: 137.502 bits (345), Expect = 3.918e-34
Identity = 103/380 (27.11%), Postives = 184/380 (48.42%), Query Frame = 2
Query:  251 IIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMS---LTSIPAINLSGP--------------IISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKEL-------LEYASSEYDAAF----INDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQ 1306
            I++TELCER ++YG+   L+ +    L  K     ++  +F   CYF  + G +++D ++G+Y  +   C +Y  G+ L +    T+   +N+ G               I++L++IAFGTGG+KA V P G DQ+       +  +F+ FY+ IN+G+  S  L   ++           +   + + AI M +  ++ + G  +YV  P   S+   T      A+K     RH S  K L       L+ A   Y  AF    + ++++++R+  ++    +YW LY QM + + +QA  M   L   + +    +SI +++ V++LIP+ D  +YP+      +  PLRR+ +G+ F   S   A A   +IE ++
Sbjct:   49 ILLTELCERLTFYGITANLVPFCEDSLGFKRPMPSTVNLLFQGTCYFIPVFGGWLADTFMGRYNVIYGSCLVYFFGTVLFAAGACTTGDILNIFGKQTKYLSSSLRKASSIVALVVIAFGTGGIKANVSPFGADQVQGKGPRAVQKFFNWFYWFINIGSFLSFTLIVWVQQKYT-------FFYGYAVTAISMMIGTVVFMTGRNWYVVRPPGGSVLTDTYRVVKLAIK-----RHWSSDKNLQSEGIHWLDRAKESYGGAFSYHRVENVKSLIRLLPVFAMFIIYWTLYSQMQTSYLIQAEYM--MLDYGIQLPAASLSIFDIVCVLLLIPLMDKVVYPLLRYCGVRFTPLRRVGVGMLFAAAS--VAVAGLVEIERKR 412          

HSP 2 Score: 55.8398 bits (133), Expect = 5.601e-8
Identity = 26/74 (35.14%), Postives = 43/74 (58.11%), Query Frame = 2
Query: 1982 NNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSW 2203
            +N S +SI +Q PQ++LI   E+  SITGL F+Y QAP  ++ LV   + +++  GN +   +  +     +SW
Sbjct:  429 HNVSDMSIFYQVPQFMLIGTSEVFTSITGLEFAYSQAPRCLQGLVMGIFLVTSGLGNYLASALTNIVTSVDKSW 502          
BLAST of slc15a-1 vs. Ensembl Nematostella
Match: EDO28569 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T640])

HSP 1 Score: 127.102 bits (318), Expect = 1.955e-33
Identity = 77/204 (37.75%), Postives = 115/204 (56.37%), Query Frame = 2
Query:  149 TDSNHNEESKLIKDDNEDEERCSSC-------FHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLS---GPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNG 730
            T+SN   E        ED  R S C         FP+A + I++ E  ERFSYYG++T+L+LYLT+ L+  +    +IYH F  + YFT +IG+ ++D++LGKY+T+     +Y L   L++ TS   I      GP+I L L+A   G +K C+   GGDQ    +  LL+ +F+MFY  +N+GA+      PI+R +V C G
Sbjct:    6 TESNIKYEPA----SEEDAARGSVCERTKGWFTQFPKATWPILVAEFGERFSYYGIKTVLVLYLTKDLMFNKDKGKAIYHAFSMVSYFTGVIGAMMADSFLGKYKTIAYTLFVYCLSEILLTATSADDIGQRSSIGPLIGLFLMAIACGNIKPCLAAFGGDQFKVEQSHLLELFFAMFYASVNVGAVLCMYFIPIVRTDVQCYG 205          
BLAST of slc15a-1 vs. Ensembl Nematostella
Match: EDO29495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3H0])

HSP 1 Score: 80.4925 bits (197), Expect = 4.168e-18
Identity = 36/96 (37.50%), Postives = 64/96 (66.67%), Query Frame = 2
Query: 1985 NGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
             G+ +S + Q PQY++I+  E++ S+TGL F+Y QAP+ MKS++ +FW L+ AFG++IV++++    V+    E  ++  L  V  +IF  ++Y+Y
Sbjct:    9 EGTIVSRLLQIPQYVVITAAEVMFSVTGLGFAYSQAPNSMKSVLQSFWLLTVAFGDLIVVILSSAKPVKGVEKEMFLYGGLMGVICIIFGIMSYFY 104          
BLAST of slc15a-1 vs. Ensembl Nematostella
Match: EDO37372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFZ9])

HSP 1 Score: 75.8702 bits (185), Expect = 2.759e-14
Identity = 84/395 (21.27%), Postives = 165/395 (41.77%), Query Frame = 2
Query:  251 IIITELCERFSYYG------------MRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLM------------SLTSIPAINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS--------------PKKELLEYASSEYDAAFIN----DLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDG-ELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQ 1306
            II+  L ER +YYG            M          +  +     VS++  +  + +F + +G FI D+Y G Y  +     +Y LGS  +            SL     +++   I +LL+++ G G  KA +   G +Q+ +        +F+ +Y+ IN+ +  + +L   ++ N         +   + I    + +A ++  +    Y   P   +I  K        ++  YR R                 P +  L+ A  +Y   F++    +++T+ +I++++L    YW +Y QM S +  Q   M+  +++    I    +++ +VI V++LIP+ D  IYP       ++  L R++IG  F      AA  +   +E ++
Sbjct:   11 IILAVLLERTTYYGILSNLVVFLTTEMDFAFGSLGVGNSTISNGIIVSVFA-YTGMAWFMSTVGGFIGDSYSGHYNAIYGSLLIYILGSGSLFMITVLLKYSSSSLNDYKELSVGLTIGTLLVLSIGEGTYKANISAFGAEQLSSDDSKTYRQFFNWYYWAINVASFLAYMLLAYIQVNWG-------FFYGYLISLCCILLACVLFCIPQSHYNIKPASGNILKKVCG----VIREAYRLRKGRTENRYTIVILEEFLPIQSWLDRAMIKYGGTFLDTDVEEVKTLRKISLIFLAQIPYWMIYFQMNSTFLNQGLHMNLIDISEGSHIPAAWLTVTDVIFVLLLIPVMDKLIYPWLDRRGLRVSVLMRISIGFLFAV----AAMVVAGGVEYKR 389          

HSP 2 Score: 50.8322 bits (120), Expect = 1.747e-6
Identity = 21/56 (37.50%), Postives = 36/56 (64.29%), Query Frame = 2
Query: 1991 STISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNII 2158
            + +SIM+Q PQY LI + E+  S+ GL F+Y +AP  M+S V   ++   + G+++
Sbjct:  410 ADLSIMYQIPQYGLIGVSEVFASVGGLEFAYREAPPSMQSFVMGLFFFVQSIGSLL 465          
BLAST of slc15a-1 vs. Ensembl Medaka
Match: slc15a2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:101160202])

HSP 1 Score: 297.36 bits (760), Expect = 4.009e-89
Identity = 161/437 (36.84%), Postives = 257/437 (58.81%), Query Frame = 2
Query:  227 HFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAI-----NLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKN-WYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGN------AYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQE 1501
            ++P ++ FI++ E CERFSYYGM+ +L LY   +L   +  + +IYH F  LCYFT I+G+ I+D++LGK+RT++ L  +Y +G  + S+ +IP +     +++  ++ L+LIA GTGG+K CV   GGDQ           +FS+FY  IN G+L ST++TP+LR +V C G  DCY LAFG+PA LM VAL++ + G   Y   P + +I ++   C   A+KN W   +H S +K  L++A  +Y    I +++ +LR+ +LY+PLP++WAL++Q GSRWTLQA +M+    N+  I PDQM +LN +++++ +PIFD  IYP+      K  PLR+M  G+ F  L+F AA  ++  +      P   G   L ++N    ++ + I N      A   +    K     ++      NI++ ++   ++ QE
Sbjct:    9 NYPLSICFIVVNEFCERFSYYGMKALLTLYFVTYLKWDKDLSTAIYHAFSGLCYFTPILGAIIADSWLGKFRTIIYLSIVYVIGHVVKSVGAIPTVGNTDVHIALSMVGLILIAIGTGGIKPCVAAFGGDQFDEEHVSERQKFFSIFYMSINAGSLLSTLITPVLRGDVQCFG-GDCYALAFGVPAALMIVALVVFIAGSSLYKRNPPQGNILLQVCKCIGFAIKNRWRNSKHESKRKHWLDWAEEKYSKRLIQEVKMVLRVLVLYIPLPMFWALFDQQGSRWTLQATRMNMAFGNSFNIKPDQMQMLNALLILLFVPIFDLVIYPLVRLCRVKTTPLRKMATGMIFAALAFVAATLVEINVVKTVVDPAPEGKCLLQVINLAQGDISVKIPNNDLFPDAIAYLQDPPKYEMLELEAARMELNIEVSFSGSKVVCQE 444          

HSP 2 Score: 94.7449 bits (234), Expect = 1.359e-19
Identity = 45/107 (42.06%), Postives = 74/107 (69.16%), Query Frame = 2
Query: 1985 NGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRM 2305
              +++ I WQ PQY+L++ GE++ SITGL FSY QAP  MKS++ A W L+ AFGN+IV++VA+   +E Q  E+++FA L +   +IF+ ++ +Y+  + E  D++
Sbjct:  566 KANSVHIAWQIPQYVLLTAGEVMFSITGLEFSYSQAPSNMKSVLQAGWLLTVAFGNVIVLIVAEGAGLE-QWKEFVLFAALLLGVCIIFSVMSIFYKYVEPENMDKI 671          
BLAST of slc15a-1 vs. Ensembl Medaka
Match: slc15a2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:101160202])

HSP 1 Score: 296.59 bits (758), Expect = 9.830e-89
Identity = 161/437 (36.84%), Postives = 257/437 (58.81%), Query Frame = 2
Query:  227 HFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAI-----NLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKN-WYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGN------AYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQE 1501
            ++P ++ FI++ E CERFSYYGM+ +L LY   +L   +  + +IYH F  LCYFT I+G+ I+D++LGK+RT++ L  +Y +G  + S+ +IP +     +++  ++ L+LIA GTGG+K CV   GGDQ           +FS+FY  IN G+L ST++TP+LR +V C G  DCY LAFG+PA LM VAL++ + G   Y   P + +I ++   C   A+KN W   +H S +K  L++A  +Y    I +++ +LR+ +LY+PLP++WAL++Q GSRWTLQA +M+    N+  I PDQM +LN +++++ +PIFD  IYP+      K  PLR+M  G+ F  L+F AA  ++  +      P   G   L ++N    ++ + I N      A   +    K     ++      NI++ ++   ++ QE
Sbjct:   26 NYPLSICFIVVNEFCERFSYYGMKALLTLYFVTYLKWDKDLSTAIYHAFSGLCYFTPILGAIIADSWLGKFRTIIYLSIVYVIGHVVKSVGAIPTVGNTDVHIALSMVGLILIAIGTGGIKPCVAAFGGDQFDEEHVSERQKFFSIFYMSINAGSLLSTLITPVLRGDVQCFG-GDCYALAFGVPAALMIVALVVFIAGSSLYKRNPPQGNILLQVCKCIGFAIKNRWRNSKHESKRKHWLDWAEEKYSKRLIQEVKMVLRVLVLYIPLPMFWALFDQQGSRWTLQATRMNMAFGNSFNIKPDQMQMLNALLILLFVPIFDLVIYPLVRLCRVKTTPLRKMATGMIFAALAFVAATLVEINVVKTVVDPAPEGKCLLQVINLAQGDISVKIPNNDLFPDAIAYLQDPPKYEMLELEAARMELNIEVSFSGSKVVCQE 461          

HSP 2 Score: 94.7449 bits (234), Expect = 1.252e-19
Identity = 45/107 (42.06%), Postives = 74/107 (69.16%), Query Frame = 2
Query: 1985 NGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRM 2305
              +++ I WQ PQY+L++ GE++ SITGL FSY QAP  MKS++ A W L+ AFGN+IV++VA+   +E Q  E+++FA L +   +IF+ ++ +Y+  + E  D++
Sbjct:  583 KANSVHIAWQIPQYVLLTAGEVMFSITGLEFSYSQAPSNMKSVLQAGWLLTVAFGNVIVLIVAEGAGLE-QWKEFVLFAALLLGVCIIFSVMSIFYKYVEPENMDKI 688          
BLAST of slc15a-1 vs. Ensembl Medaka
Match: slc15a1a (solute carrier family 15 member 1 [Source:NCBI gene;Acc:101165016])

HSP 1 Score: 291.582 bits (745), Expect = 2.616e-87
Identity = 160/422 (37.91%), Postives = 248/422 (58.77%), Query Frame = 2
Query:  191 DNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSG--------------PIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACN--GTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS--PKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLV 1402
            +N  E+R      +P +++FI++ E CERFSYYGMR +L+LY    L   +  A SIYH FV+LCY T I+G+ ++D++LGK++T++ L  +Y +G   M++++I  I  S                ++ L LIA GTGG+K CV   GGDQ   H++    ++FS+FY  IN G+L STI+TPILR    C       CY LAFG+PA LM V+L++ ++G   Y       +I +    C   A+KN YR R  +   +K  +++A  +YD   I  ++ +L++  LY+PLP++W L++Q GSRWTLQA  MDG     LVI PDQM   N I+++ L+PI +S +YP+         PL+RMT+G+    L+F  A  +Q QI+   P+  +   S+L L+N    ++++ + N +T++
Sbjct:    2 ENVKEKRSKVVCGYPISIFFIVVNEFCERFSYYGMRAVLVLYFKYFLQWDDDLATSIYHTFVALCYLTPILGAIVADSWLGKFKTIIYLSIVYAIGQVAMAVSAIHDITDSDRDGTPNNMTFHVVLSMVGLFLIALGTGGIKPCVAAFGGDQFDDHQEKQRRTFFSVFYLCINGGSLLSTIITPILRGQ-TCGIYSQQKCYALAFGVPAALMVVSLVVFIVGSGMYYKAKPEGNIMLSVCKCIGFAIKNRYRHRSKAYPKRKHWMDWAEEKYDRLLIAQIKMVLKVLFLYIPLPMFWTLFDQKGSRWTLQATTMDGNFG-QLVIQPDQMQTFNPILILTLVPIMESVVYPLIKKCGFNFTPLKRMTVGMFLAALAFVCAGVVQLQIDKTLPIFPSTSESQLKLLNMGNNQLEVHLPNNFTIL 421          

HSP 2 Score: 88.1965 bits (217), Expect = 1.553e-17
Identity = 41/94 (43.62%), Postives = 65/94 (69.15%), Query Frame = 2
Query: 1991 STISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            +++ +  Q PQY LI+ GE++ S+TGL FSY QAP  MK+++ A W L+ A GN IV++VA++  + K+  E+ +FA L +   VIF+ +AY+Y
Sbjct:  516 NSVHMALQIPQYFLITAGEVMFSVTGLEFSYSQAPSNMKAVLQAGWLLTVAVGNFIVLIVAEIAKLPKKWAEFFLFASLLVAVCVIFSIMAYFY 609          
BLAST of slc15a-1 vs. Ensembl Medaka
Match: SLC15A1 (solute carrier family 15 member 1 [Source:NCBI gene;Acc:101167350])

HSP 1 Score: 288.5 bits (737), Expect = 1.559e-85
Identity = 172/446 (38.57%), Postives = 263/446 (58.97%), Query Frame = 2
Query:  230 FPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAI--------------NLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRAN-VACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS-PKKE-LLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIG-------------------NAYTLVSGGYKISQSSIDLPDGTYN 1459
            +P +++FI+I E CERFSYYGMR +L+LY    L   +  A +IYH FV+LCY T I+G+ I+D++LGK++T+V L  +YTLG  ++++++I  I              +++  ++ LLLIA GTGG+K CV   GGDQ   H++    ++FS+FY  IN G+L STI+TPILR      +    CYPLAFG+PA LM VAL++ ++G   Y     + +I +K   C   A+KN +R R +  PK+E  +++A  +YD   I  ++ +L++  LY+PLP++WAL++Q GSRWTLQA  MDG+    L I PDQM  +N I++++L+PI D+ IYP+         PLRR+T+G+ F  ++F AA  +Q QI+   P   +    ++  +N+   EV +T G                   N + L  G Y   + ++  P GT N
Sbjct:   20 YPISIFFIVINEFCERFSYYGMRAVLVLYFKYFLRWDDDFATTIYHTFVALCYLTPILGAIIADSWLGKFKTIVYLSIVYTLGQVVLAISAIHDITDTNKDGTPDNMTFHVALSMVGLLLIALGTGGIKPCVAAFGGDQFEDHQEKQRGTFFSIFYLSINAGSLLSTIITPILRGQECGIHTQQQCYPLAFGVPAALMAVALIVFIVGSGMYHKTAPQGNIMVKVTKCIGFAIKNRFRHRSSQYPKREHWMDWADEKYDKLLIAQVKMVLKVLFLYIPLPMFWALFDQQGSRWTLQATTMDGDFG-ALTIQPDQMQTVNPILILILVPIMDTLIYPLISKCKLNFTPLRRITVGMFFAAMAFVAAAVVQLQIDKTLPKFPSNSEMQVKFINAVNREVDITAGGHVLPLKPLTATETYETFKNPFLLTVGDY---EYAVSFPKGTRN 461          

HSP 2 Score: 103.219 bits (256), Expect = 3.036e-22
Identity = 47/94 (50.00%), Postives = 69/94 (73.40%), Query Frame = 2
Query: 1991 STISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            +T S+ WQ PQY L++ GE++ S+TGL FSY QAP  MK+++ A W L+ AFGNIIV++VA+   +E Q  EY++FA L ++  +IFA +AY+Y
Sbjct:  580 NTFSMAWQIPQYFLLTAGEVVFSVTGLEFSYSQAPSNMKAVLQAGWLLTVAFGNIIVLIVAEAATLEDQWAEYILFAALLVLVCIIFAIMAYFY 673          
BLAST of slc15a-1 vs. Ensembl Medaka
Match: slc15a1a (solute carrier family 15 member 1 [Source:NCBI gene;Acc:101165016])

HSP 1 Score: 286.96 bits (733), Expect = 1.640e-85
Identity = 156/407 (38.33%), Postives = 241/407 (59.21%), Query Frame = 2
Query:  230 FPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSG--------------PIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANV-ACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNS--PKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTL 1399
            +P +++FI++ E CERFSYYGMR +L+LY    L   +  A SIYH FV+LCY T I+G+ ++D++LGK++T++ L  +Y +G   M++++I  I  S                ++ L LIA GTGG+K CV   GGDQ   H++    ++FS+FY  IN G+L STI+TPILR           CY LAFG+PA LM V+L++ ++G   Y       +I +    C   A+KN YR R  +   +K  +++A  +YD   I  ++ +L++  LY+PLP++W L++Q GSRWTLQA  MDG     LVI PDQM   N I+++ L+PI +S +YP+         PL+RMT+G+    L+F  A  +Q QI+   P+  +   S+L L+N    ++++ + N +T+
Sbjct:   16 YPISIFFIVVNEFCERFSYYGMRAVLVLYFKYFLQWDDDLATSIYHTFVALCYLTPILGAIVADSWLGKFKTIIYLSIVYAIGQVAMAVSAIHDITDSDRDGTPNNMTFHVVLSMVGLFLIALGTGGIKPCVAAFGGDQFDDHQEKQRRTFFSVFYLCINGGSLLSTIITPILRGQTCGIYSQQKCYALAFGVPAALMVVSLVVFIVGSGMYYKAKPEGNIMLSVCKCIGFAIKNRYRHRSKAYPKRKHWMDWAEEKYDRLLIAQIKMVLKVLFLYIPLPMFWTLFDQKGSRWTLQATTMDGNFG-QLVIQPDQMQTFNPILILTLVPIMESVVYPLIKKCGFNFTPLKRMTVGMFLAALAFVCAGVVQLQIDKTLPIFPSTSESQLKLLNMGNNQLEVHLPNNFTV 421          

HSP 2 Score: 88.1965 bits (217), Expect = 1.411e-17
Identity = 41/94 (43.62%), Postives = 65/94 (69.15%), Query Frame = 2
Query: 1991 STISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYY 2272
            +++ +  Q PQY LI+ GE++ S+TGL FSY QAP  MK+++ A W L+ A GN IV++VA++  + K+  E+ +FA L +   VIF+ +AY+Y
Sbjct:  530 NSVHMALQIPQYFLITAGEVMFSVTGLEFSYSQAPSNMKAVLQAGWLLTVAVGNFIVLIVAEIAKLPKKWAEFFLFASLLVAVCVIFSIMAYFY 623          
BLAST of slc15a-1 vs. Planmine SMEST
Match: SMESG000039777.1 (SMESG000039777.1)

HSP 1 Score: 1437.17 bits (3719), Expect = 0.000e+0
Identity = 728/729 (99.86%), Postives = 728/729 (99.86%), Query Frame = 2
Query:  143 MDTDSNHNEESKLIKDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRMQELTEHVE 2329
            MDTDSNHNEESKLIKDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRTILILYLTQHLLLKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPAILMGVALLILLLGHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAA VTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRMQELTEHVE
Sbjct:    1 MDTDSNHNEESKLIKDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRTILILYLTQHLLLKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPAILMGVALLILLLGHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAAIVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKETYDRMQELTEHVE 729          
BLAST of slc15a-1 vs. Planmine SMEST
Match: SMESG000042203.1 (SMESG000042203.1)

HSP 1 Score: 325.479 bits (833), Expect = 1.278e-100
Identity = 204/637 (32.03%), Postives = 343/637 (53.85%), Query Frame = 2
Query:  341 ESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNS-HPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVI 2248
            +++   +YH+FV L Y + I G+ I+DNYLG++ T++++  +Y LG  LM+LT+I   N+ GP+I + ++A G+GG+K+ V   GGDQ+P    ++++ YFS+FY  INLGA A+  +TPILR +++C     CYPL FG+PA +  V  +I + G + Y  VP   S+  K   C   +++N+ +E+  S  K +LEYA  EY   FI+D +  LRI I++ P+PV+WALY+Q GSRWTLQA  M+G++ N+  + P+Q+  +N +++I LIP+FD  IYP     +  ++P  R+        LSF  A  LQ  +   Q +  N   S+L ++NS + C++ +TI N   +++    +   ++DL  G   + +   KC     ++  L +++       YI    +NN++I ++++                V S    N  +F+  +    +    +  +       S++ +L   G Y     SP        N +++         N++V P  + S       +M+++  +         N    I ++WQ PQY+LI+  EIL SIT LSF+Y ++PD MKSL+ A + ++   GNIIV+ VA +     Q+ E+ +FA L ++   I
Sbjct:   17 DNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTVIVVGLVYLLGHVLMTLTAIQK-NILGPLIGMCILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCV-DGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNYIKEKKISKYKSILEYAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIGNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSV---NLDLNPGLVQVSM---KCLGYQLQVKNL-TLSQYKMTGGYIYK--DNNERIDMKSY---------------FVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSL-DVGVYEIYCSSP--------NYNEY------KCGNVDVTPGLVGS-------LMMTSERKLHFWKEFEPN---LIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCI 602          
BLAST of slc15a-1 vs. Planmine SMEST
Match: SMESG000011953.1 (SMESG000011953.1)

HSP 1 Score: 172.94 bits (437), Expect = 6.982e-45
Identity = 175/716 (24.44%), Postives = 321/716 (44.83%), Query Frame = 2
Query:  188 DDNEDEERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAI--NLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXX--XHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEAR-QPLPINVGNSRLFLVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPN------VPSNTSKWDGVLSLNGN---NLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLAYYYRMSKKET 2293
            D  +  E     F F    Y ++  +L      Y     + +Y+   L   ++ + +I+H    +   T I G+ + D++LG+ +T ++      L   L+   S+ AI     G I +  L+A   G V   +  +  DQIP   K++L ++    YF  N G +    L PI+  ++ C   ++CYPL F I  +L  +A +I ++    K +V     +++ +  + C   AVK       + P K  L+Y++ +YD +FIND++    + I  +  P++W ++EQ+ S WTLQA  MDG ++   VI  DQM  LN I+V+++IP+F+  +YP    I+ K+ P R +T G  FT L+  +   +Q QI++  +P                         N+ T++S  +  +++         N+ +KY   +L   EI++  + +   K+N+Y + N   N K+++ T      S+ K      L      L  +Q++ K  T         V     V   D I+++   R   N +  +          V      +D V  +N N   N ++  + +  +E     +      +T + +  L       +I+WQ   Y+L+++GEI  ++    F Y +AP  MK+++ A  Y+  A GNI ++ + ++       + +LI  IL     ++   L Y+Y  ++  T
Sbjct:    6 DQTKPVETSKGRFKFSTGGYLLVCYQLISGMGSYCYILSMPIYMASILKFSDTTSTTIFHARSGIGTITNICGAILGDSFLGRSKTYLLFQPFSIL---LIGSISVMAIYTKTEGIITTYFLLAILGGLVSPAIRTIIADQIPKDNKIMLSTFLHCIYFMNNFGVIIVAYLAPIMHKDIYC-FDNECYPLVFFISFLLSSLAFMIFVVGFLMKLFVIYKPTENLLLNILKCIHHAVKKRILLGKSPPTKTWLDYSNEKYDKSFINDIKIAKSLLIFLIAHPLFWTVFEQISSIWTLQAQYMDGMISEQFVIKADQMQTLNPILVVLIIPLFELVVYPCLDKINFKV-PYRIVT-GQFFTVLACVSMIFIQFQIDSVIEP------------------------KNSDTILSTLFNGAKT---------NLTVKYDSKSL---EITSFQTKSFRLKQNSYFVVNFY-NHKVNILT----NSSSNKDF----LTVFYENLTDFQYVSKEVTKQTNGGYANVRMFNLVESKDPISILLKARVGINKEFSLFSRGYEFGNYVKCGIGLFD-VFLVNKNQNINKKIGKVTLFPAESKTLVISGKATNETFVDLSEL--RLKLPNILWQIIPYILVTLGEIFFNVNTGIFLYGEAPLSMKAMLLAAEYICIALGNIFILALKQLLSNMSLIYLFLICGILVFASGILTGVLGYFYLKNRNIT 667          
BLAST of slc15a-1 vs. Planmine SMEST
Match: SMESG000011908.1 (SMESG000011908.1)

HSP 1 Score: 145.206 bits (365), Expect = 7.678e-36
Identity = 102/354 (28.81%), Postives = 185/354 (52.26%), Query Frame = 2
Query:  224 FHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCS---LYTLGSTLMSLTSIPAINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXX---XXXHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFF 1267
            + FP+    +I+ +       Y    I  +Y+T  ++  ++ A S YH    + +   I+G+ I+D+YLG+ +T +I      L   G  + S+       ++  +IS +L       ++A VG    DQIP   +V+L ++  M Y   NLG +    + PI+  ++ C    +CYPL F +  +LM +   I+   L    F + +P ++ I+++T++C    +K  +++  N P    ++YA  +Y   F++D + +L +    L  P+++ ++EQM S WT QA  MDG + N+ ++  D +  LN I+V++LIPIF+  IYPI   I+ K+    R+++G  FT +S F
Sbjct:   17 YKFPKGAALLIVYQFFSGMGVYAFTLIFPIYMTSMMMYSDATATSFYHARAGITFCMNIVGAIIADSYLGRIKTFLIFYPIDILMYFGVFIFSIYETYTTLVTVVLISAVLCGMYGSAMRAFVG----DQIPETDQVMLSTFLHMIYLINNLGIIIIGFVGPIIHKDIYCF-KKECYPLNFVLTVLLMVLTFSIVGLGLFLRWFVIKLPTKN-IFIETLACIGYGMKCRFQKGRN-PGGHWMDYAEDKYGVVFVHDCKVVLGLIFFLLGHPIFFTVFEQMSSVWTFQARYMDGMVTNDFILKADHIQTLNPILVVILIPIFEMSIYPILDKINFKVP--YRISVGQYFTAISCF 361          

HSP 2 Score: 50.0618 bits (118), Expect = 6.757e-6
Identity = 29/88 (32.95%), Postives = 50/88 (56.82%), Query Frame = 2
Query: 2000 SIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVIFAGLA 2263
             I WQF  YL ++IGE+  ++    F Y +AP  MKS++ +  Y+  A G++I+++++ +     +S   L F +LC V  V  +GL 
Sbjct:  569 KIYWQFFPYLFVTIGEVFFNVNTGIFLYSEAPASMKSVLLSAQYMCIALGDVIIIILSSV----FESLNLLYFFVLCTVL-VFISGLV 651          
BLAST of slc15a-1 vs. Planmine SMEST
Match: SMESG000030835.1 (SMESG000030835.1)

HSP 1 Score: 116.701 bits (291), Expect = 5.389e-27
Identity = 98/383 (25.59%), Postives = 191/383 (49.87%), Query Frame = 2
Query:  203 EERCSSCFHFPRAVYFIIITELCERFSYYGMRXXXXXXXXXXXXXKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPA-----INLSGPI------ISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPXXXXXXXXXXXXXXHKFYVHVPIRDSIYMKTISCFITAVKNW--YRERHNSPKK--ELLEYAS----SEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPI---SYNISPKLRPLRRMTIGIAFTCLSFFAAFALQ 1285
            ++  S+   F   ++ I++ ELCER ++Y +    + + T  L +    A+++  +F    Y  T+   +ISD+ LGK++T+++   +Y +G  L++  +  +     I LS  +        L+ I   TGG+K+ VGP G +Q+    + +   +F  +Y+ +NLG+  + +    ++ N+        + + F IP + + VA+++ ++ H+FY     R+  +  T S F      W  ++ R  S  K  + L+YAS      YD   I D R  +RI  + L    ++  Y QM S + LQA +++  ++   VI    ++++N ++++ +IP+    +YPI    +  SP    L+R+ +G+  + LS  AA  L+
Sbjct:    3 QKSVSALSSFKPVIFCILVFELCERLTFYSISANFVRFCTIFLQVDNVTAMNMSLIFTGSIYIVTLFCGWISDSVLGKFKTIILSGIIYFIGVLLITAVTFQSEPRLKITLSLTLRRVLTGFGLVFIGIATGGIKSTVGPFGAEQLDQKNENITRLFFIWYYWFVNLGSAIAFLGVTYVQQNIN-------FFIGFIIPLVSISVAMVLFIIPHRFYK----RNESFKNTSSIFTYVSIFWEAFQRRSRSIYKYSQFLDYASLSNGGSYDDTVIADFRKTIRIIPVLLTFIPFYIAYSQMQSTYLLQAERLNLNIS-TFVIPVASLNVVNTVVILFIIPLLAILVYPILNKCFKASPN--HLKRIALGLFLSSLSVIAAGVLE 371          

HSP 2 Score: 51.9878 bits (123), Expect = 1.704e-6
Identity = 34/117 (29.06%), Postives = 55/117 (47.01%), Query Frame = 2
Query: 1985 NGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKM-----------DLVEKQSWEYLIF----AILCIVFNVIFAGLAYYYRMSKKE 2290
            N S IS++ Q PQ+  +  GE+  S TGL F+Y QAP  M++++   +Y+    G+    ++  +           D ++K  +E   F     IL  V   IF    Y Y  S++E
Sbjct:  394 NVSHISVLAQIPQFFFVGSGEVFASATGLEFAYSQAPVSMQAVITGLFYVMTGIGSFASSLLILLVNVNLKDQWMPDDIDKGHYESFFFLLGGIILLDVTIFIFIARGYRYSTSEEE 510          
The following BLAST results are available for this feature:
BLAST of slc15a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC15A25.510e-10233.29solute carrier family 15 member 2 [Source:HGNC Sym... [more]
SLC15A21.582e-9432.55solute carrier family 15 member 2 [Source:HGNC Sym... [more]
SLC15A11.234e-8240.26solute carrier family 15 member 1 [Source:HGNC Sym... [more]
SLC15A21.960e-3045.19solute carrier family 15 member 2 [Source:HGNC Sym... [more]
SLC15A46.397e-1823.92solute carrier family 15 member 4 [Source:HGNC Sym... [more]
back to top
BLAST of slc15a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pept-38.259e-9130.14Peptide transporter 3 [Source:UniProtKB/Swiss-Pro... [more]
pept-16.952e-7536.87Peptide transporter family 1 [Source:UniProtKB/Sw... [more]
pept-21.903e-6536.54Peptide transporter family 2 [Source:UniProtKB/Sw... [more]
pept-21.903e-6536.54Peptide transporter family 2 [Source:UniProtKB/Sw... [more]
back to top
BLAST of slc15a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG29301.299e-11231.97gene:FBgn0028491 transcript:FBtr0070608[more]
CG29301.284e-8237.70gene:FBgn0028491 transcript:FBtr0340201[more]
CG29301.706e-8237.70gene:FBgn0028491 transcript:FBtr0070609[more]
CG29301.706e-8237.70gene:FBgn0028491 transcript:FBtr0070610[more]
CG29301.706e-8237.70gene:FBgn0028491 transcript:FBtr0340202[more]
back to top
BLAST of slc15a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc15a1b3.722e-8937.76solute carrier family 15 member 1b [Source:ZFIN;Ac... [more]
slc15a21.507e-8038.92solute carrier family 15 member 2 [Source:NCBI gen... [more]
slc15a1a7.695e-7733.83solute carrier family 15 member 1a [Source:ZFIN;Ac... [more]
slc15a1a1.420e-7634.38solute carrier family 15 member 1a [Source:ZFIN;Ac... [more]
slc15a1a8.684e-7034.38solute carrier family 15 member 1a [Source:ZFIN;Ac... [more]
back to top
BLAST of slc15a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC15A21.151e-7336.96solute carrier family 15 member 2 [Source:NCBI gen... [more]
SLC15A23.407e-7339.90solute carrier family 15 member 2 [Source:NCBI gen... [more]
SLC15A25.108e-7340.43solute carrier family 15 member 2 [Source:NCBI gen... [more]
SLC15A21.086e-7140.33solute carrier family 15 member 2 [Source:NCBI gen... [more]
SLC15A25.110e-6932.53solute carrier family 15 member 2 [Source:NCBI gen... [more]
back to top
BLAST of slc15a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc15a23.153e-10633.93solute carrier family 15 (H+/peptide transporter),... [more]
Slc15a21.875e-9832.69solute carrier family 15 (H+/peptide transporter),... [more]
Slc15a15.294e-8337.65solute carrier family 15 (oligopeptide transporter... [more]
Slc15a21.503e-4447.28solute carrier family 15 (H+/peptide transporter),... [more]
Slc15a21.168e-2846.92solute carrier family 15 (H+/peptide transporter),... [more]
back to top
BLAST of slc15a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ES07|S15A2_MOUSE4.589e-10633.74Solute carrier family 15 member 2 OS=Mus musculus ... [more]
sp|P46029|S15A2_RABIT7.429e-10332.86Solute carrier family 15 member 2 OS=Oryctolagus c... [more]
sp|Q16348|S15A2_HUMAN2.646e-10133.29Solute carrier family 15 member 2 OS=Homo sapiens ... [more]
sp|O01840|PEPT3_CAEEL1.051e-8930.14Peptide transporter 3 OS=Caenorhabditis elegans OX... [more]
sp|P36836|S15A1_RABIT1.796e-8340.84Solute carrier family 15 member 1 OS=Oryctolagus c... [more]
back to top
BLAST of slc15a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF860.000e+0100.00Slc15a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
B0W8F31.146e-12032.87Oligopeptide transporter OS=Culex quinquefasciatus... [more]
A0A369SE251.227e-12035.27Solute carrier family 15 member 1 OS=Trichoplax sp... [more]
A0A1Q3FLX23.204e-11833.01Putative peptide transporter family 1 OS=Culex tar... [more]
T2MCC72.322e-11734.37Solute carrier family 15 member 2 OS=Hydra vulgari... [more]
back to top
BLAST of slc15a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc15a1a2.416e-9029.39solute carrier family 15 member 1a [Source:ZFIN;Ac... [more]
SLC15A12.968e-8940.05solute carrier family 15 member 1 [Source:HGNC Sym... [more]
SLC15A11.738e-8839.60solute carrier family 15 member 1 [Source:HGNC Sym... [more]
slc15a23.959e-8739.84solute carrier family 15 member 2 [Source:NCBI gen... [more]
slc15a1a3.396e-6733.77solute carrier family 15 member 1a [Source:ZFIN;Ac... [more]
back to top
BLAST of slc15a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc15a1b4.240e-10333.99solute carrier family 15 member 1b [Source:ZFIN;Ac... [more]
ENSPMAT00000005298.12.346e-643.18pep scaffold:Pmarinus_7.0:GL477384:58393:77162:-1 ... [more]
back to top
BLAST of slc15a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PTR23.173e-2626.80Integral membrane peptide transporter; mediates tr... [more]
back to top
BLAST of slc15a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO330753.511e-11733.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331763.918e-3427.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO285691.955e-3337.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO294954.168e-1837.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373722.759e-1421.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc15a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc15a24.009e-8936.84solute carrier family 15 member 2 [Source:NCBI gen... [more]
slc15a29.830e-8936.84solute carrier family 15 member 2 [Source:NCBI gen... [more]
slc15a1a2.616e-8737.91solute carrier family 15 member 1 [Source:NCBI gen... [more]
SLC15A11.559e-8538.57solute carrier family 15 member 1 [Source:NCBI gen... [more]
slc15a1a1.640e-8538.33solute carrier family 15 member 1 [Source:NCBI gen... [more]
back to top
BLAST of slc15a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039777.10.000e+099.86SMESG000039777.1[more]
SMESG000042203.11.278e-10032.03SMESG000042203.1[more]
SMESG000011953.16.982e-4524.44SMESG000011953.1[more]
SMESG000011908.17.678e-3628.81SMESG000011908.1[more]
SMESG000030835.15.389e-2725.59SMESG000030835.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30003156
GenBankAKN21487.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003156 ID=SMED30003156|Name=slc15a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2462bp
TTTAAATACGTAACATTTAGGTCAATATATGAGTTGCAATTTTCAAATTA
AGTTTATAAATATACTTTATCTAAATTTCGCTCATAAAAATTAAAATATC
AAATTTGAAAATTTTAGTTGGCAGTTGAATTTTAATTTAGAAATGGATAC
GGATTCTAATCACAATGAAGAATCGAAACTGATAAAAGATGACAATGAAG
ACGAAGAACGTTGTTCATCTTGCTTTCATTTTCCAAGAGCAGTGTATTTT
ATAATAATTACTGAATTATGTGAAAGATTCAGCTATTATGGAATGAGAAC
AATCTTAATACTTTATCTGACCCAACATTTACTGTTGAAAGAAAGTAATG
CCGTTTCAATTTATCATATGTTCGTGAGTCTTTGCTATTTCACGACAATT
ATTGGGAGCTTTATCTCTGATAATTATCTTGGAAAATACAGAACTTTAGT
CATTTTATGCAGTTTATACACATTGGGATCGACACTAATGTCGTTAACTT
CAATTCCAGCTATTAATCTATCCGGTCCTATAATAAGCTTGTTATTGATT
GCTTTTGGTACCGGTGGTGTAAAAGCATGCGTCGGTCCTTTGGGGGGAGA
TCAAATTCCCGCTCATAAAAAAGTTCTATTGGACAGCTATTTTTCCATGT
TTTATTTCGGGATCAATTTGGGCGCTCTTGCTTCGACGATTCTCACTCCG
ATACTTCGAGCCAATGTTGCTTGCAATGGAACTGATGATTGTTACCCTCT
GGCGTTTGGAATTCCGGCCATTCTAATGGGAGTAGCTCTCCTTATACTGC
TTCTCGGACATAAGTTTTACGTCCATGTCCCAATTCGTGACAGTATCTAT
ATGAAAACAATCAGTTGTTTTATTACAGCTGTGAAAAACTGGTATAGAGA
ACGACATAATTCGCCTAAAAAAGAGTTATTGGAATACGCAAGTTCTGAAT
ACGATGCTGCATTTATAAATGATCTCCGCACCATTCTACGCATTGCCATT
TTATATTTACCATTGCCAGTTTATTGGGCGCTTTACGAACAAATGGGCAG
TCGCTGGACTCTCCAAGCCGCCCAAATGGATGGAGAACTCGCTAATAATC
TTGTGATTCTACCAGATCAAATGTCAATTTTGAACGTCATTATGGTGATT
GTTCTTATTCCCATTTTTGACAGCTGTATCTATCCCATCAGTTATAATAT
AAGCCCTAAATTAAGACCTCTGCGCCGGATGACTATTGGAATAGCTTTCA
CTTGTCTCTCGTTTTTTGCGGCTTTCGCTTTACAAAAACAAATTGAGGCA
AGACAGCCGTTGCCAATAAATGTTGGCAATTCTCGACTGTTTCTTGTCAA
CTCTCACCCATGTGAGGTCCAAATGACCATTGGCAATGCCTATACTCTAG
TTTCAGGGGGTTACAAAATCTCACAATCTTCAATTGATTTACCAGATGGA
ACATATAATATTCAACTGAAATATGCAAAATGCAATCTTATTAACCAAGA
AATATCTACGCTGATTTCAATCAATCTGGTTCCTAAAAGGAATAATTATA
TTTTATCTAACCTCGAAAATAATCAAAAGATATCAGTGCAAACATTTCAT
GCATTTCAAAAGTCTAATCCAAAAGGGCACCCTTTAGCGAAACTTGTGGC
TTCTACCGCATTACTGAATAAATATCAATTCATTATAAAACATTCAACTA
CAGGAGTTCTGGCGGCAAGTGTCACAGTGGAAGGTAATCAGTCAGTATTC
CAAAGCGATTGGATTACACTGATGAAAACTGGAAGATATATTTGGAATGT
GAAATCACCAGTTCTTCCGCCGAATGTCCCTTCCAACACTAGCAAATGGG
ATGGGGTACTCTCACTTAATGGTAACAACTTGGAAGTAAATCCAATCCGC
ATCACGTCTTCAGAAGTGATTATATTTTATATGATGTTATCCAATCCTGA
ACAGACGGTTATCACAATTCCACTGTTACTTAATAATGGTTCAACAATTT
CAATAATGTGGCAATTTCCACAGTATTTACTGATATCAATTGGTGAGATA
TTGGTGAGCATAACTGGTCTTTCTTTTTCATACGACCAAGCTCCCGATGG
AATGAAATCTCTGGTTAATGCTTTCTGGTACTTGTCGAACGCATTCGGTA
ATATTATTGTCATGGTCGTTGCTAAAATGGATCTCGTCGAAAAGCAGAGT
TGGGAGTATCTCATATTTGCTATACTATGCATCGTATTCAATGTGATTTT
TGCTGGATTAGCATATTATTATCGGATGAGCAAAAAAGAAACTTACGATC
GAATGCAAGAATTGACAGAACATGTTGAATAACTGAGAAATAACAAATAA
GCAATATTATTCTGTTAAACGTCTGTGATTCGTCTGGGTTGTCATAATCA
AATCGTCTCGTTCACCTCGCCCTTTCTGTTACTTTTAATGTTATTATTAT
TATTATTTTTAT
back to top

protein sequence of SMED30003156-orf-1

>SMED30003156-orf-1 ID=SMED30003156-orf-1|Name=SMED30003156-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=730bp
MDTDSNHNEESKLIKDDNEDEERCSSCFHFPRAVYFIIITELCERFSYYG
MRTILILYLTQHLLLKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYR
TLVILCSLYTLGSTLMSLTSIPAINLSGPIISLLLIAFGTGGVKACVGPL
GGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDC
YPLAFGIPAILMGVALLILLLGHKFYVHVPIRDSIYMKTISCFITAVKNW
YRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQ
MGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPIS
YNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLF
LVNSHPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLI
NQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAK
LVASTALLNKYQFIIKHSTTGVLAASVTVEGNQSVFQSDWITLMKTGRYI
WNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLS
NPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQA
PDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFN
VIFAGLAYYYRMSKKETYDRMQELTEHVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
GO:0006857oligopeptide transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR000109POT_fam
IPR018456PTR2_symporter_CS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000109Proton-dependent oligopeptide transporter familyPFAMPF00854PTR2coord: 99..420
e-value: 4.6E-79
score: 266.1
coord: 615..679
e-value: 8.1E-14
score: 51.3
IPR000109Proton-dependent oligopeptide transporter familyPANTHERPTHR11654OLIGOPEPTIDE TRANSPORTER-RELATEDcoord: 36..723
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 4..413
e-value: 1.3E-106
score: 358.8
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 586..726
e-value: 2.4E-27
score: 97.5
NoneNo IPR availablePANTHERPTHR11654:SF96PEPTIDE TRANSPORTER FAMILY 1coord: 36..723
NoneNo IPR availableCDDcd17412MFS_SLC15A1coord: 619..710
e-value: 4.04014E-24
score: 103.385
NoneNo IPR availableCDDcd17347MFS_SLC15A1_2_likecoord: 31..402
e-value: 2.35801E-131
score: 393.907
NoneNo IPR availableTMHMMTMhelixcoord: 660..677
NoneNo IPR availableTMHMMTMhelixcoord: 130..152
NoneNo IPR availableTMHMMTMhelixcoord: 625..647
NoneNo IPR availableTMHMMTMhelixcoord: 281..298
NoneNo IPR availableTMHMMTMhelixcoord: 207..229
NoneNo IPR availableTMHMMTMhelixcoord: 329..351
NoneNo IPR availableTMHMMTMhelixcoord: 687..709
NoneNo IPR availableTMHMMTMhelixcoord: 104..126
NoneNo IPR availableTMHMMTMhelixcoord: 70..92
NoneNo IPR availableTMHMMTMhelixcoord: 363..380
NoneNo IPR availableTMHMMTMhelixcoord: 165..187
IPR018456PTR2 family proton/oligopeptide symporter, conserved sitePROSITEPS01023PTR2_2coord: 167..179
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 608..717
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 16..380