SMED30003153

Overview
NameSMED30003153
Smed IDSMED30003153
Length (bp)1479
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30003153 (SMED30003153) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30003153 (SMED30003153) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30003153 (SMED30003153) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30003153 (SMED30003153) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003153

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30003153SMESG000067402.1 SmedASXL_015228SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30003153SMESG000067402.1 SmedASXL_015228SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30003153 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.031253:2234..3712 +7269
v31.018541:4481..5959 +7269
Homology
BLAST of SMED30003153 vs. TrEMBL
Match: A0A0X3NRT2 (RRM domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR82562 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.245e-11
Identity = 90/375 (24.00%), Postives = 162/375 (43.20%), Query Frame = 1
Query:  367 EPLVKKFKSDEKHVVPKTYTLIENIDSSLTPKDLKNHLLENGISFDNVLVMSGSVAIVNFERQKDMEKLFNVCQGVQYKSNELFIFK--------LLNENKSDVKSVSNLCENSIHLKNLDVTISEEDITSELGDLPLKSITLNTEKKTAV-----IEFTDNQSARICIXXXXXXXXXXXXVQASFLVKSQRPDVFT---LKLSNLPKDVTKHHVQIAFPTATKVKFQRKSSEECLIHFKTAEDF-NAVLQGGTEFLIGDQKITVEEYVGNKTKKQPEQPIKQFVLNIFNLPFDTTVNELRAHYPGVRYVEMLKNAEGNFMGSARLMYDDRACCEEALKSSKGKTFKHRRVRAEMKIVENFTKHYDNKQSEASTK 1440
            +P+ K   S     V  ++ L+ N DS L    L   L + G++  ++  +   VA++     +  +K  + C G  Y +  L            L ++ K  + S + L   ++   NL  +++ ++I   +G  P     + T  K  +     I+ T    A+   + L+ +      ++A FL  +Q+    T   L ++N P  V    ++  FPTA+ V+  RK +    + FK+ ED   A  Q   + + G Q   V      K K       K+F + + NLPF + ++E+RA YPG  +V + K  +G F G A + +      ++AL  +  K  + R++RA          H + +Q+E S K
Sbjct:  158 QPVAKSSTSAATSKVAPSHVLLFNFDS-LNENLLSGFLKKRGVNPQSIGCIYSPVALIGLSNDEAAKKAVSACSGATYNARSLSAVMVSGDTSKILTSKPKQPISSDTPLL--TVFATNLPKSLTADNIKKMVGIEPKAMRLMTTGPKNKLFNACYIDCTSEADAKKAFEALEGRSESGTNIRA-FLKGAQQWAPLTESSLIITNAPFAVGVDQMKKEFPTASSVESMRKGA--FHLSFKSKEDREKAADQARGKVMDGRQLRVVTPGEDMKAKDD----AKKFSIVVSNLPFTSKIDEIRALYPGCTWVTIKKRDDGKFSGVAVVSFKSEDAAKKALDETPSKQLQGRQLRA----------HLEGQQAEGSKK 512          
BLAST of SMED30003153 vs. TrEMBL
Match: A0A3P7PD45 (RRM domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS11787 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.003e-11
Identity = 93/360 (25.83%), Postives = 157/360 (43.61%), Query Frame = 1
Query:  409 VPKTYTLIENIDSSLTPKDLKNHLLENGISFDNVLVMSGSVAIVNFERQKDMEKLFNVCQGVQYKSNELF-------IFKLLNENKSDVKSVSNLCE-NSIHLKNLDVTISEEDITSELGDLPLKSITLNTEKK------TAVIEFTDNQSARICIXXXXXXXXXXXXVQASFLVKSQRPDVF--TLKLSNLPKDVTKHHVQIAFPTATKVKFQRKSSEECLIHFKTAEDFNAVLQGGTEFLIGDQKITVEEYVGNKTKKQPEQPIKQFVLNIFNLPFDTTVNELRAHYPGVRYVEMLKNAEGNFMGSARLMYDDRACCEEALKSSKGKTFKHRRVRAEMKIVENFTKHYDNKQSEASTK 1440
            V K++ L+ N DS L    L   L + G++   +  +   VA++     +  +K  + C G  Y +  L        + K+L  NKS  K  SN     ++   NL  +++ EDI   +G  P KS+ L T            I+      AR     L+ +      ++A    + Q P V   TL ++N P  +    ++  FPTAT V+  +K S    + FKT ED           ++  + + V   V    +K+P++  K   L + NLPF   ++E+R  YPG  +V + K  +G F G+A + +      ++AL  +  K  + R++RA          H +++Q EA  K
Sbjct:  170 VAKSHVLLFNFDS-LNESLLAGFLKKRGVNAQTLGCIYSPVALLGLPNDEAAKKAVSACSGATYNTRALSAVMVDGDVSKILT-NKS--KQTSNDGPLMTVFASNLPKSLTTEDIKKIIGVEP-KSMRLLTSGPKNRLFNACYIDCLSEADARKAFKALEGRSESGTNIRAFLKNQQQWPAVTETTLIITNAPFTIGVEQMKKEFPTATLVESTKKGSFH--LTFKTKEDKEKAATKAKGKVMEGRPLRV---VIPGEEKKPQKDSKPNSLVVSNLPFTAKIDEIRQLYPGCSWVTLKKRDDGKFNGTAVISFKSAEDAKKALNETPSKQVQGRQLRA----------HLESQQPEAPVK 509          
BLAST of SMED30003153 vs. TrEMBL
Match: A0A5K3EQL2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.034e-9
Identity = 51/152 (33.55%), Postives = 72/152 (47.37%), Query Frame = 1
Query:  988 KVKFQRKSSEECLIHFKTAEDFNAVLQGGTEFLIGDQKI----------TVEEYVG---------NKTKKQPEQPIKQFVLNIFNLPFDTTVNELRAHYPGVRYVEMLKNAEGNFMGSARLMYDDRACCEEALKSSKGKTFKHRRVRAEMKI 1386
            ++KF   +S+ C+I F + +D  A     TE    D+KI          T EEY G         NK K  P++   Q  + +FNLP+  T  EL+  +P  R +   KN  G   G A L +  R  CE ALK +K  T   RR+RAE+ +
Sbjct:   38 RIKF---ASQSCIIAFDSRDDCRA-----TETACRDKKIAGRQVGCSSTTSEEYSGLLQEILPGRNKGKAAPDRDGLQ--IKLFNLPYSITEEELKKVFPRCRRIFFAKNKSGTSCGIAILTFKKRLICEAALKRAKHLTLHGRRIRAEVNV 179          
BLAST of SMED30003153 vs. TrEMBL
Match: A0A0X3NVL6 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR135955 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 3.435e-7
Identity = 59/249 (23.69%), Postives = 108/249 (43.37%), Query Frame = 1
Query:  748 LPLKSITL----NTEKKTAVIEFTDNQSARICIXXXXXXXXXXXXVQASFLVKSQRPDV----------------FTLKLSNLPKDVTKHHVQIAFPTATKVKFQR----KSSEECLIHFKTAEDFNAVLQGGTEFLIGDQKIT------------VEEYVGNKTKKQPEQPIKQFVLNIFNLPFDTTVNELRAHYPGVRYVEMLKNAEGNFMGSARLMYDDRACCEEALKSSKGKTFKHRRVRAEMKI 1386
            LP +  +L     + K+  VI F+  +      D L        KV ASF+    +P V                + L ++N+P   ++  ++ +FPTA  V  +R    KS   C++ F  A+D  +VL       I  ++I             V E +     K+ +  ++   L +FN+P+DT+  EL+  +P  R++      +G+  G A + +     C+ ALK +     ++R++RAE+ +
Sbjct:    2 LPFRCKSLELFKKSGKRNGVISFSTPEECGAAFDALQSFEYEGSKVIASFVQPRAKPPVPKPAELAKLLPSGKQEYCLNITNIPFSTSQEQLEESFPTAEHVIMRRRKDGKSKGSCMLSFSNADDCKSVLDACRHKEIDGRRIICTLGTSEELSALVAETIARGLPKR-KLDLEGCQLKLFNVPYDTSERELKKIFPQSRHI-FFPEVKGSPAGIALVTFKTPTICKVALKKASHLKLQNRKIRAEINV 248          
BLAST of SMED30003153 vs. TrEMBL
Match: W6UZZ4 (Nucleolin OS=Echinococcus granulosus OX=6210 GN=EGR_00686 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.821e-6
Identity = 42/174 (24.14%), Postives = 82/174 (47.13%), Query Frame = 1
Query:  913 FTLKLSNLPKDVTKHHVQIAFPTATKVKFQ-RKSSE---ECLIHFKTAEDFNAVLQGGTEFLIGDQKIT------------VEEYVGNKTKKQPEQPIKQFVLNIFNLPFDTTVNELRAHYPGVRYVEMLKNAEGNFMGSARLMYDDRACCEEALKSSKGKTFKHRRVRAEMKI 1386
            F L ++N+P  +T   ++  FP A  +  + RK  +    C+  FK+  D++       E ++  +++             +EEY    +K   E       + +FNLP+  +  E++  +P  R + + ++ +GN  G A L +  +A C+ AL  +K    + RR+RAE+ +
Sbjct:  140 FCLDIANIPFFITLEQLKAVFPKAEAILMRCRKDGKFKGSCIAVFKSQSDYDEAEAACKEEIMEGRRLLCSQTTSEDCNKLLEEYSLGPSKGDREG----LQIKLFNLPYGVSKEEIKKAFPKARNIFLPQDKKGNPTGIAILTFKTKAICQAALGRAKNVRLQGRRLRAEINV 309          
BLAST of SMED30003153 vs. Planmine SMEST
Match: SMESG000067402.1 (SMESG000067402.1)

HSP 1 Score: 853.973 bits (2205), Expect = 0.000e+0
Identity = 464/469 (98.93%), Postives = 467/469 (99.57%), Query Frame = 1
Query:   52 MTNNIVEKPKLKKKYQDNLNICNEFKGLSSLTDNIKICEKNQIEIIQNEGAQSTLDIAXXXXXXXXXXXXXXXXXXXXTEQDTTSDLTNSEXXXXXXXXSDNESIEPLVKKFKSDEKHVVPKTYTLIENIDSSLTPKDLKNHLLENGISFDNVLVMSGSVAIVNFERQKDMEKLFNVCQGVQYKSNELFIFKLLNENKSDVKSVSNLCENSIHLKNLDVTISEEDITSELGDLPLKSITLNTEKKTAVIEFTDNQSARICIXXXXXXXXXXXXVQASFLVKSQRPDVFTLKLSNLPKDVTKHHVQIAFPTATKVKFQRKSSEECLIHFKTAEDFNAVLQGGTEFLIGDQKITVEEYVGNKTKKQPEQPIKQFVLNIFNLPFDTTVNELRAHYPGVRYVEMLKNAEGNFMGSARLMYDDRACCEEALKSSKGKTFKHRRVRAEMKIVENFTKHYDNKQSEASTKTENVDE 1458
            MTNNIVEKPKLKKKYQDNLNICNEFKGLSSLTDNIKICEKNQIEIIQNEGAQSTLDIAKSNESSKKKKSKNV+IIKSETEQDTTSDLTNSEKPKKKKLKSDNESIEPLVKKFKSDEKHVVPKTYTLIENIDSSLTPKDLKNHLLENGISFDNVLVMSGSVAIVNFERQKDMEKLFNVCQGVQYKSNELFIFKLLNENKSDVKSVSNLCENSIHLKNLDVTISEEDITSELGDLPLKSITLNTEKKTAVIEFTDNQSARICIDLLDQKL GDKKVQASFLVKSQRPDVFTLKLSNLPKDVTKH VQIAFPTATKVKFQRKSSEECLIHFKTAEDFNAVLQGGTEFLIGDQ+ITVEEYVGNKTKKQPEQPIKQFVLNIFNLPFDTTVN+LRAHYPGVRYVEMLKNAEGNFMGSARLMYDDRACCEEALKSSKGKTFKHRRVRAEMKIVENFTKHYDNKQSEASTKTENVDE
Sbjct:    1 MTNNIVEKPKLKKKYQDNLNICNEFKGLSSLTDNIKICEKNQIEIIQNEGAQSTLDIAKSNESSKKKKSKNVKIIKSETEQDTTSDLTNSEKPKKKKLKSDNESIEPLVKKFKSDEKHVVPKTYTLIENIDSSLTPKDLKNHLLENGISFDNVLVMSGSVAIVNFERQKDMEKLFNVCQGVQYKSNELFIFKLLNENKSDVKSVSNLCENSIHLKNLDVTISEEDITSELGDLPLKSITLNTEKKTAVIEFTDNQSARICIDLLDQKLFGDKKVQASFLVKSQRPDVFTLKLSNLPKDVTKHQVQIAFPTATKVKFQRKSSEECLIHFKTAEDFNAVLQGGTEFLIGDQRITVEEYVGNKTKKQPEQPIKQFVLNIFNLPFDTTVNDLRAHYPGVRYVEMLKNAEGNFMGSARLMYDDRACCEEALKSSKGKTFKHRRVRAEMKIVENFTKHYDNKQSEASTKTENVDE 469          
BLAST of SMED30003153 vs. Planmine SMEST
Match: SMESG000029031.1 (SMESG000029031.1)

HSP 1 Score: 53.5286 bits (127), Expect = 2.631e-7
Identity = 80/333 (24.02%), Postives = 142/333 (42.64%), Query Frame = 1
Query:  415 KTYTLIENIDSSLTPKDLKNHLLENGISFDNVLVMSGSVAIVNFERQKDMEKLFNVCQGVQYKSNE-LFIFKLL-NENKSDVKSVSNLCENS--IHLKNLDVTISEEDITSEL-GDLPLK--SITLNTEKKTAVIEFTDNQSARICIXXXXXXXXXXXXVQASF----LVKSQRPDVFTLKLSNLPKDVTKHHVQIAFPTATKVKFQRKSSEE-CLIHFKTAEDFNAVLQGGTEFLIGDQKITVEEYVGNKTKKQPEQPIKQFVLNIFNLPFDTTVNELRAHYPGVRYVEMLKNAEGNFMGSARLMYDDRACCEEALKSSKGKTFKHRRVRAE 1377
            K   +I N+    TP+++ N L + GI  +   + +G  A++        EK+          ++E +   KLL N  K +    SN   N   I +KN++   + +DI   +  D  +K       ++K  A+IEF +       ID L+  +L   K+ A F    + +++   +FTL++ NL +  +   ++      + +   +KS +  C + FK+ +D     Q      I   K+TV + V  KT K  E+      L+I NLPF  T  EL   +     ++   N  G   G   L ++       A++  K K    R++R +
Sbjct:   82 KYNAVILNLPLDATPEEMSNFLSKRGIPVNAFSIENGKYAVIESSDIHSHEKIKKSLAAKSLVNSENMIASKLLGNSQKLETLCQSNAILNRSLITVKNINSQTAIDDILCLIPSDFEIKKHQYIKKSKKHIALIEFLNPLVTDAVIDKLNSSILDGNKLVAEFKHKLVSETEEEKLFTLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTV-KLVEFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQ 413          
BLAST of SMED30003153 vs. Planmine SMEST
Match: SMESG000029031.1 (SMESG000029031.1)

HSP 1 Score: 53.5286 bits (127), Expect = 2.711e-7
Identity = 80/333 (24.02%), Postives = 142/333 (42.64%), Query Frame = 1
Query:  415 KTYTLIENIDSSLTPKDLKNHLLENGISFDNVLVMSGSVAIVNFERQKDMEKLFNVCQGVQYKSNE-LFIFKLL-NENKSDVKSVSNLCENS--IHLKNLDVTISEEDITSEL-GDLPLK--SITLNTEKKTAVIEFTDNQSARICIXXXXXXXXXXXXVQASF----LVKSQRPDVFTLKLSNLPKDVTKHHVQIAFPTATKVKFQRKSSEE-CLIHFKTAEDFNAVLQGGTEFLIGDQKITVEEYVGNKTKKQPEQPIKQFVLNIFNLPFDTTVNELRAHYPGVRYVEMLKNAEGNFMGSARLMYDDRACCEEALKSSKGKTFKHRRVRAE 1377
            K   +I N+    TP+++ N L + GI  +   + +G  A++        EK+          ++E +   KLL N  K +    SN   N   I +KN++   + +DI   +  D  +K       ++K  A+IEF +       ID L+  +L   K+ A F    + +++   +FTL++ NL +  +   ++      + +   +KS +  C + FK+ +D     Q      I   K+TV + V  KT K  E+      L+I NLPF  T  EL   +     ++   N  G   G   L ++       A++  K K    R++R +
Sbjct:   86 KYNAVILNLPLDATPEEMSNFLSKRGIPVNAFSIENGKYAVIESSDIHSHEKIKKSLAAKSLVNSENMIASKLLGNSQKLETLCQSNAILNRSLITVKNINSQTAIDDILCLIPSDFEIKKHQYIKKSKKHIALIEFLNPLVTDAVIDKLNSSILDGNKLVAEFKHKLVSETEEEKLFTLRIGNLSETTSYETIKSLEFNCSSMHLTKKSGKRICFLSFKSNKDLTEAYQALLNKEIDGSKVTV-KLVEFKTNKLSEEEFDLMKLHITNLPFSCTKEELEKEFQMASSLKFPLNNNGKSKGCCYLSFESMELAALAMEGFKDKIINGRKIRCQ 417          
The following BLAST results are available for this feature:
BLAST of SMED30003153 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003153 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003153 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003153 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003153 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003153 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003153 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003153 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NRT21.245e-1124.00RRM domain-containing protein OS=Schistocephalus s... [more]
A0A3P7PD452.003e-1125.83RRM domain-containing protein OS=Dibothriocephalus... [more]
A0A5K3EQL22.034e-933.55Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3NVL63.435e-723.69Uncharacterized protein OS=Schistocephalus solidus... [more]
W6UZZ41.821e-624.14Nucleolin OS=Echinococcus granulosus OX=6210 GN=EG... [more]
back to top
BLAST of SMED30003153 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003153 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003153 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003153 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003153 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003153 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000067402.10.000e+098.93SMESG000067402.1[more]
SMESG000029031.12.631e-724.02SMESG000029031.1[more]
SMESG000029031.12.711e-724.02SMESG000029031.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003153 ID=SMED30003153|Name=SMED30003153|organism=Schmidtea mediterranea sexual|type=transcript|length=1479bp
ATTAAACCTTATTATTTTAAATTATCACATTTTTAGAATTTAATTATTTC
AATGACAAATAATATTGTAGAAAAACCAAAACTAAAAAAGAAATATCAAG
ATAATCTAAATATTTGCAATGAATTCAAAGGTCTTTCTAGCTTAACGGAC
AATATTAAAATATGTGAAAAGAATCAAATTGAAATAATTCAGAATGAAGG
AGCTCAATCTACATTAGATATTGCAAAAAGTAATGAGTCAAGTAAAAAGA
AAAAATCCAAGAATGTTGAAATTATAAAATCTGAAACTGAACAAGATACA
ACATCGGATTTAACCAACTCTGAAAAGCCTAAAAAAAAGAAATTGAAATC
TGACAATGAAAGTATTGAGCCGTTGGTAAAAAAATTTAAAAGCGATGAAA
AACACGTAGTTCCTAAGACTTATACTCTCATTGAAAACATTGATTCTTCA
CTTACGCCCAAAGATTTAAAGAATCATTTACTTGAAAATGGAATATCTTT
TGACAACGTCCTAGTAATGTCAGGTTCTGTTGCAATAGTCAATTTTGAAA
GACAAAAAGATATGGAAAAACTTTTTAACGTTTGTCAAGGTGTTCAATAT
AAAAGCAATGAATTATTTATTTTCAAACTCTTAAATGAAAACAAATCAGA
CGTAAAATCAGTATCGAATTTGTGCGAGAATTCGATTCACTTGAAAAATC
TTGATGTCACAATCAGCGAAGAGGACATTACCTCAGAGTTAGGTGATTTA
CCTCTCAAATCTATTACGCTGAACACTGAAAAGAAAACCGCTGTTATTGA
ATTCACTGACAATCAATCAGCGAGAATTTGTATTGATTTACTGGATCAAA
AATTACTCGGTGATAAAAAAGTCCAAGCATCTTTTCTCGTCAAATCTCAA
CGACCCGACGTTTTTACGCTGAAACTGTCGAACCTCCCGAAGGACGTCAC
CAAACATCACGTGCAAATCGCCTTTCCAACAGCGACAAAAGTTAAATTTC
AACGTAAATCCTCTGAGGAATGTTTGATTCATTTTAAAACCGCAGAAGAT
TTCAATGCCGTTCTCCAGGGGGGAACGGAATTCCTTATCGGTGATCAAAA
GATCACAGTAGAGGAGTACGTGGGTAACAAAACGAAAAAACAGCCGGAAC
AACCGATTAAACAATTCGTATTGAACATTTTTAATTTGCCATTCGACACG
ACAGTTAATGAGTTGAGAGCCCATTACCCAGGCGTTCGCTACGTGGAGAT
GCTCAAGAATGCCGAAGGGAATTTCATGGGATCGGCAAGGCTCATGTACG
ATGATCGGGCTTGCTGTGAGGAGGCGTTGAAGAGCTCTAAAGGGAAGACG
TTTAAGCATAGAAGAGTTAGAGCGGAAATGAAAATTGTGGAAAACTTCAC
GAAACATTATGACAACAAGCAATCGGAGGCGTCGACAAAAACTGAAAATG
TTGATGAATAATAAATATTTTAATTGCTG
back to top

protein sequence of SMED30003153-orf-1

>SMED30003153-orf-1 ID=SMED30003153-orf-1|Name=SMED30003153-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=470bp
MTNNIVEKPKLKKKYQDNLNICNEFKGLSSLTDNIKICEKNQIEIIQNEG
AQSTLDIAKSNESSKKKKSKNVEIIKSETEQDTTSDLTNSEKPKKKKLKS
DNESIEPLVKKFKSDEKHVVPKTYTLIENIDSSLTPKDLKNHLLENGISF
DNVLVMSGSVAIVNFERQKDMEKLFNVCQGVQYKSNELFIFKLLNENKSD
VKSVSNLCENSIHLKNLDVTISEEDITSELGDLPLKSITLNTEKKTAVIE
FTDNQSARICIDLLDQKLLGDKKVQASFLVKSQRPDVFTLKLSNLPKDVT
KHHVQIAFPTATKVKFQRKSSEECLIHFKTAEDFNAVLQGGTEFLIGDQK
ITVEEYVGNKTKKQPEQPIKQFVLNIFNLPFDTTVNELRAHYPGVRYVEM
LKNAEGNFMGSARLMYDDRACCEEALKSSKGKTFKHRRVRAEMKIVENFT
KHYDNKQSEASTKTENVDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 124..191
e-value: 1.7
score: 4.6
coord: 373..442
e-value: 8.8E-6
score: 35.2
coord: 211..277
e-value: 2.4E-5
score: 33.8
coord: 289..354
e-value: 0.0093
score: 24.7
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 376..440
e-value: 2.4E-4
score: 20.9
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 191..281
e-value: 9.8E-7
score: 30.8
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 362..449
e-value: 9.8E-8
score: 34.0
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 282..361
e-value: 2.5E-5
score: 26.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 79..102
NoneNo IPR availableCDDcd00590RRM_SFcoord: 212..277
e-value: 4.15009E-6
score: 42.2921
NoneNo IPR availableCDDcd00590RRM_SFcoord: 290..354
e-value: 6.02705E-4
score: 36.5141
NoneNo IPR availableCDDcd00590RRM_SFcoord: 376..442
e-value: 3.38533E-9
score: 51.1517
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 286..444
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 127..281