Lambda-crystallin homolog

Overview
NameLambda-crystallin homolog
Smed IDSMED30003152
Length (bp)1544
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lambda-crystallin homolog (SMED30003152) t-SNE clustered cells

Violin plots show distribution of expression levels for Lambda-crystallin homolog (SMED30003152) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lambda-crystallin homolog (SMED30003152) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lambda-crystallin homolog (SMED30003152) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003152

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30003152SMESG000050288.1 dd_Smed_v4_1696_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003152SMESG000050288.1 dd_Smed_v4_1696_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lambda-crystallin homolog vs. Ensembl Human
Match: CRYL1 (crystallin lambda 1 [Source:HGNC Symbol;Acc:HGNC:18246])

HSP 1 Score: 175.252 bits (443), Expect = 6.519e-50
Identity = 91/252 (36.11%), Postives = 151/252 (59.92%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPP 1058
            + WAM+F +    + +YDI   QI+  L +IR  ++ L  +   +    VE QL  I+      +  + +  + ECV E++E+K+K+F  LDS  +D  I  SS+S L  S     L++  +CI+AHPV+PPY + LVE+VP   T+  TV +T  LM++I Q P+  +KE+ GF LNR+Q A+ +  ++L+++ +++  D+D +++EGLG R+AF GPL    LN  G+ +Y ++Y  G+   ++ Q F P
Sbjct:   19 RSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQCIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSEGLGMRYAFIGPLETMHLNAEGMLSYCDRYSEGIK--HVLQTFGP 268          
BLAST of Lambda-crystallin homolog vs. Ensembl Human
Match: CRYL1 (crystallin lambda 1 [Source:HGNC Symbol;Acc:HGNC:18246])

HSP 1 Score: 168.703 bits (426), Expect = 1.186e-47
Identity = 89/248 (35.89%), Postives = 148/248 (59.68%), Query Frame = 3
Query:  315 MIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPP 1058
            M+F +    + +YDI   QI+  L +IR  ++ L  +   +    VE QL  I+      +  + +  + ECV E++E+K+K+F  LDS  +D  I  SS+S L  S     L++  +CI+AHPV+PPY + LVE+VP   T+  TV +T  LM++I Q P+  +KE+ GF LNR+Q A+ +  ++L+++ +++  D+D +++EGLG R+AF GPL    LN  G+ +Y ++Y  G+   ++ Q F P
Sbjct:    1 MLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQCIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSEGLGMRYAFIGPLETMHLNAEGMLSYCDRYSEGIK--HVLQTFGP 246          
BLAST of Lambda-crystallin homolog vs. Ensembl Human
Match: CRYL1 (crystallin lambda 1 [Source:HGNC Symbol;Acc:HGNC:18246])

HSP 1 Score: 168.703 bits (426), Expect = 1.186e-47
Identity = 89/248 (35.89%), Postives = 148/248 (59.68%), Query Frame = 3
Query:  315 MIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPP 1058
            M+F +    + +YDI   QI+  L +IR  ++ L  +   +    VE QL  I+      +  + +  + ECV E++E+K+K+F  LDS  +D  I  SS+S L  S     L++  +CI+AHPV+PPY + LVE+VP   T+  TV +T  LM++I Q P+  +KE+ GF LNR+Q A+ +  ++L+++ +++  D+D +++EGLG R+AF GPL    LN  G+ +Y ++Y  G+   ++ Q F P
Sbjct:    1 MLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQCIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSEGLGMRYAFIGPLETMHLNAEGMLSYCDRYSEGIK--HVLQTFGP 246          
BLAST of Lambda-crystallin homolog vs. Ensembl Human
Match: CRYL1 (crystallin lambda 1 [Source:HGNC Symbol;Acc:HGNC:18246])

HSP 1 Score: 165.236 bits (417), Expect = 5.702e-47
Identity = 85/229 (37.12%), Postives = 138/229 (60.26%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPG 989
            + WAM+F +    + +YDI   QI+  L +IR  ++ L  +   +    VE QL  I+      +  + +  + ECV E++E+K+K+F  LDS  +D  I  SS+S L  S     L++  +CI+AHPV+PPY + LVE+VP   T+  TV +T  LM++I Q P+  +KE+ GF LNR+Q A+ +  ++L+++ +++  D+D +++EGLG R+AF GPL    LN  G
Sbjct:   19 RSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQCIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSEGLGMRYAFIGPLETMHLNAEG 247          
BLAST of Lambda-crystallin homolog vs. Ensembl Human
Match: CRYL1 (crystallin lambda 1 [Source:HGNC Symbol;Acc:HGNC:18246])

HSP 1 Score: 130.954 bits (328), Expect = 1.656e-34
Identity = 70/193 (36.27%), Postives = 114/193 (59.07%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIK 881
            + WAM+F +    + +YDI   QI+  L +IR  ++ L  +   +    VE QL  I+      +  + +  + ECV E++E+K+K+F  LDS  +D  I  SS+S L  S     L++  +CI+AHPV+PPY + LVE+VP   T+  TV +T  LM++I Q P+  +KE+ GF LNR+Q A+ +  ++L++
Sbjct:   19 RSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQCIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLVE 211          
BLAST of Lambda-crystallin homolog vs. Ensembl Celegans
Match: Y71F9B.9 (pep chromosome:WBcel235:I:2759023:2761044:-1 gene:WBGene00022130.1 transcript:Y71F9B.9a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y71F9B.9)

HSP 1 Score: 186.808 bits (473), Expect = 9.058e-55
Identity = 99/292 (33.90%), Postives = 170/292 (58.22%), Query Frame = 3
Query:  309 WAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLD-LLNIKQNFPPQHDQSVIERIIDETKIR----NLSSIFEERNFTIGSILKIK 1169
            WA IF +    + +YDI + Q+++ L ++   L++L +  + R +   +  L R++ TT  +++ +N+ ++ E   E++  + + ++++D   +  TI  SS+S +P S FT+ LINK +C+I HPV+PP  L L E+VPA +TS +TV +  ++M  +KQ PV  KKE+ GF +NR+Q A+    ++L+ D VI V DVD +++ GLGPR+AF G      LN  G+ +YF +Y  G+  +L      P   D+ VI ++ +E + +    N+     ER   +  I K+K
Sbjct:   19 WATIFASSGYEVQMYDISEKQLQVALENVEKNLRKLDEHGLQRGNLSADEALLRVSTTTSLNEVMKNAIYMQESALEDLNFRIQFYKVIDEIADPTTILASSTSTIPASKFTDGLINKERCLIVHPVNPPLFLPLTELVPAPWTSQDTVDRAAEIMRSVKQEPVKLKKEVLGFVVNRLQFALLAETWRLVADGVIGVNDVDAVMSAGLGPRYAFNGTCETVHLNAFGVRDYFKRYAAGITAVLKDMGPIPDFTDEKVINKLEEELEPKMSTLNIRKHQAEREEKLVEIAKLK 310          
BLAST of Lambda-crystallin homolog vs. Ensembl Celegans
Match: Y71F9B.9 (pep chromosome:WBcel235:I:2759029:2761044:-1 gene:WBGene00022130.1 transcript:Y71F9B.9b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y71F9B.9)

HSP 1 Score: 186.422 bits (472), Expect = 1.439e-54
Identity = 99/290 (34.14%), Postives = 162/290 (55.86%), Query Frame = 3
Query:  309 WAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPPQHDQSVIERIIDETKIRNLSSIFEERNFTIGSILKIKLHQ 1178
            WA IF +    + +YDI + Q+++ L ++   L++L +  + R +   +  L R++ TT  +++ +N+ ++ E   E++  + + ++++D   +  TI  SS+S +P S FT+ LINK +C+I HPV+PP  L L E+VPA +TS +TV +  ++M  +KQ PV  KKE+ GF +NR+Q A+    ++L+ D VI V DVD +++ GLGPR+AF G      LN  G+ +YF +Y  G+             D   I    DE  I  L    E +     S L I+ HQ
Sbjct:   19 WATIFASSGYEVQMYDISEKQLQVALENVEKNLRKLDEHGLQRGNLSADEALLRVSTTTSLNEVMKNAIYMQESALEDLNFRIQFYKVIDEIADPTTILASSTSTIPASKFTDGLINKERCLIVHPVNPPLFLPLTELVPAPWTSQDTVDRAAEIMRSVKQEPVKLKKEVLGFVVNRLQFALLAETWRLVADGVIGVNDVDAVMSAGLGPRYAFNGTCETVHLNAFGVRDYFKRYAAGI-----------TADMGPIPDFTDEKVINKLEEELEPKM----STLNIRKHQ 293          
BLAST of Lambda-crystallin homolog vs. Ensembl Celegans
Match: ech-8 (Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:O17761])

HSP 1 Score: 69.3218 bits (168), Expect = 2.383e-12
Identity = 53/183 (28.96%), Postives = 91/183 (49.73%), Query Frame = 3
Query:  438 SDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAF-YGPLTVAALNG 983
            +D  VE     + +TT F  L  N D ++E V E++++K+++F  LD       I  +++S L ++  +  L + +K +  H  +P  L+R+VE++  S TS   V    +    IK++PV+       F  NR+     N   KL+ +       +DK++T      + F  GPLTVA +NG
Sbjct:   96 NDSKVEKLRKNLQITTDFQKL-NNCDLIVEAVFEDMKLKKELFTKLDKICKPSCIFGTNTSSLDLNEMSSVLRDPTKVVGIHFFNPANLIRMVEVIYGSKTSSKAVATAFEACRSIKKLPVLV-GNCPAFVFNRLLGVYLNQSQKLMYEYGYLPHQIDKIITN-----FGFLMGPLTVADMNG 271          
BLAST of Lambda-crystallin homolog vs. Ensembl Celegans
Match: ech-9 (Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:A0A061AKU6])

HSP 1 Score: 66.2402 bits (160), Expect = 1.820e-11
Identity = 50/183 (27.32%), Postives = 95/183 (51.91%), Query Frame = 3
Query:  438 SDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAF-YGPLTVAALNG 983
            +D+ +E     + +T+ F  L  N D ++E V E++++K+++F  L++      I  +++S L ++  +  L + S  +  H  +P  ++RLVEI+  S TS   +    Q  E IK++PV+     + F  NR+    ++   KL+ +       +DK++T      + F  GP+TVA +NG
Sbjct:   81 NDKRIEKINANLKITSDFHKL-SNCDLIVESVIEDMKLKKELFANLENICKSTCIFGTNTSSLDLNEISSVLRDPSNLVGIHFFNPANVIRLVEIIYGSHTSSQAIATAFQACESIKKLPVLVGN-CKSFVFNRLLHVYFDQSQKLMYEYGYLPHQIDKIIT-----NFGFLMGPMTVADMNG 256          
BLAST of Lambda-crystallin homolog vs. Ensembl Celegans
Match: ech-9 (Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:A0A061AKU6])

HSP 1 Score: 66.2402 bits (160), Expect = 1.894e-11
Identity = 50/183 (27.32%), Postives = 95/183 (51.91%), Query Frame = 3
Query:  438 SDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAF-YGPLTVAALNG 983
            +D+ +E     + +T+ F  L  N D ++E V E++++K+++F  L++      I  +++S L ++  +  L + S  +  H  +P  ++RLVEI+  S TS   +    Q  E IK++PV+     + F  NR+    ++   KL+ +       +DK++T      + F  GP+TVA +NG
Sbjct:   93 NDKRIEKINANLKITSDFHKL-SNCDLIVESVIEDMKLKKELFANLENICKSTCIFGTNTSSLDLNEISSVLRDPSNLVGIHFFNPANVIRLVEIIYGSHTSSQAIATAFQACESIKKLPVLVGN-CKSFVFNRLLHVYFDQSQKLMYEYGYLPHQIDKIIT-----NFGFLMGPMTVADMNG 268          
BLAST of Lambda-crystallin homolog vs. Ensembl Fly
Match: Had1 (gene:FBgn0286508 transcript:FBtr0074240)

HSP 1 Score: 201.06 bits (510), Expect = 4.348e-60
Identity = 110/299 (36.79%), Postives = 173/299 (57.86%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSS-FLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPPQHDQSVIERIIDE-TKIRNLSSIFEERNF-----TIGSILKIKLHQ 1178
            + W+M+F +    + +YDI  +Q+   L + +  LQ L    + R       Q   I+ T    +L + + FV EC+ E +++K+ +++ LD+     TI  SS+S FLP S F+  L NK+  +++HPV+PPY + LVEIVPA +T    V KT+ LMEEI Q PV   +EIEGF LNRIQ A+ N  ++L++  ++NV+D+D +++ GLGPR+AF GPL  A LN  G+ NYF +Y   +  ++      P+ +  V   +  +  ++  L  + + RN+     T  SILK KL+Q
Sbjct:   18 RSWSMLFASVGYQVVLYDILPEQVSTALTATQKELQDLEAKGLLRGKLTAAQQFACISGTNDLKELVKGAIFVQECIPERLDLKKALYKQLDAVVGPNTILSSSTSTFLP-SLFSADLKNKANVLVSHPVNPPYYVPLVEIVPAPWTKPEWVKKTRALMEEIGQKPVTLSREIEGFALNRIQYAILNETWRLVEAGILNVKDIDSVMSNGLGPRYAFLGPLETAHLNAEGMANYFERYSNTIYAVSETMGPTPKMEGPVAVEVAKQLGEMVPLDQLAQRRNYRDNCLTQLSILKNKLNQ 315          
BLAST of Lambda-crystallin homolog vs. Ensembl Fly
Match: Had1 (gene:FBgn0286508 transcript:FBtr0346059)

HSP 1 Score: 201.06 bits (510), Expect = 4.348e-60
Identity = 110/299 (36.79%), Postives = 173/299 (57.86%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSS-FLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPPQHDQSVIERIIDE-TKIRNLSSIFEERNF-----TIGSILKIKLHQ 1178
            + W+M+F +    + +YDI  +Q+   L + +  LQ L    + R       Q   I+ T    +L + + FV EC+ E +++K+ +++ LD+     TI  SS+S FLP S F+  L NK+  +++HPV+PPY + LVEIVPA +T    V KT+ LMEEI Q PV   +EIEGF LNRIQ A+ N  ++L++  ++NV+D+D +++ GLGPR+AF GPL  A LN  G+ NYF +Y   +  ++      P+ +  V   +  +  ++  L  + + RN+     T  SILK KL+Q
Sbjct:   18 RSWSMLFASVGYQVVLYDILPEQVSTALTATQKELQDLEAKGLLRGKLTAAQQFACISGTNDLKELVKGAIFVQECIPERLDLKKALYKQLDAVVGPNTILSSSTSTFLP-SLFSADLKNKANVLVSHPVNPPYYVPLVEIVPAPWTKPEWVKKTRALMEEIGQKPVTLSREIEGFALNRIQYAILNETWRLVEAGILNVKDIDSVMSNGLGPRYAFLGPLETAHLNAEGMANYFERYSNTIYAVSETMGPTPKMEGPVAVEVAKQLGEMVPLDQLAQRRNYRDNCLTQLSILKNKLNQ 315          
BLAST of Lambda-crystallin homolog vs. Ensembl Fly
Match: Had2 (gene:FBgn0033949 transcript:FBtr0087499)

HSP 1 Score: 180.644 bits (457), Expect = 3.121e-52
Identity = 89/237 (37.55%), Postives = 146/237 (61.60%), Query Frame = 3
Query:  309 WAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSS-FLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGP-GIDNYFNKY 1013
            WAM+F A    + +YDI + Q+   L  +   L +L + +  R +     Q   I VTT+  +L + +  + ECV E + +K+ ++  LD    ++T+  SS+S F+P S ++E L  + + ++AHP++PPY + LVEIVPA +TS + V +T+ LM  + Q PV  K+EI+GF  NRIQ A+ N V++L+   +++V DVD++L++GLG R+A  G L  A LN P G+ +YF ++
Sbjct:   18 WAMLFAAAGYRVQLYDILESQLATALQELDKDLHRLEEQSALRGNIRASEQFALIGVTTRLEELTREAVHIQECVPEVLHLKKSLYSQLDELLEEQTVVASSTSTFMP-SLYSEGLQKRQQMLVAHPLNPPYFIPLVEIVPAPWTSPSAVERTRDLMLSLGQRPVTLKREIQGFATNRIQYAILNEVWRLVGSGILSVADVDRVLSQGLGLRYALLGSLETAHLNAPGGVADYFQRF 253          
BLAST of Lambda-crystallin homolog vs. Ensembl Fly
Match: Mtpalpha (gene:FBgn0028479 transcript:FBtr0079858)

HSP 1 Score: 49.2914 bits (116), Expect = 9.122e-6
Identity = 37/152 (24.34%), Postives = 80/152 (52.63%), Query Frame = 3
Query:  462 LGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFK-KEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDK 914
            L  +  T  +SD  +N+D ++E V E++++K +V + L++   +  +  +++S +PI+          K +  H  SP   ++L+EI+    TS +T+   + +   +KQ  VV    +  GF   RI + + +   +L+++ V + +D+D+
Sbjct:  438 LASLRPTLDYSDF-KNADIIIEAVFEDIKVKHRVIKELEAVVPEHCVIATNTSAIPITKIAAGSSRPEKVVGMHYFSPVDKMQLLEIITHPGTSKDTI--AQAVAVGLKQGKVVITVGDGPGFYTTRILSTMLSEAIRLLQEGV-DPKDLDQ 585          
BLAST of Lambda-crystallin homolog vs. Ensembl Fly
Match: Mtpalpha (gene:FBgn0028479 transcript:FBtr0079857)

HSP 1 Score: 48.9062 bits (115), Expect = 9.375e-6
Identity = 37/152 (24.34%), Postives = 80/152 (52.63%), Query Frame = 3
Query:  462 LGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFK-KEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDK 914
            L  +  T  +SD  +N+D ++E V E++++K +V + L++   +  +  +++S +PI+          K +  H  SP   ++L+EI+    TS +T+   + +   +KQ  VV    +  GF   RI + + +   +L+++ V + +D+D+
Sbjct:  399 LASLRPTLDYSDF-KNADIIIEAVFEDIKVKHRVIKELEAVVPEHCVIATNTSAIPITKIAAGSSRPEKVVGMHYFSPVDKMQLLEIITHPGTSKDTI--AQAVAVGLKQGKVVITVGDGPGFYTTRILSTMLSEAIRLLQEGV-DPKDLDQ 546          
BLAST of Lambda-crystallin homolog vs. Ensembl Zebrafish
Match: cryl1 (crystallin, lambda 1 [Source:ZFIN;Acc:ZDB-GENE-060810-7])

HSP 1 Score: 166.007 bits (419), Expect = 1.304e-46
Identity = 98/298 (32.89%), Postives = 160/298 (53.69%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGP-GIDNYFNKYLPGLDLLNIKQNFPPQHDQSV--IERIIDE------TKIRNLSSIFEERNFTIGSILKIK 1169
            + WAM+F +    + +YD    Q    +  IR  L++L  + + R +     QL R++           + FV E V E++E KQ VF  ++   ++  I  SS+S L  S     + N+++CI++HPV+PPY +RLVE+VP   T    +     LM ++ Q PV  +KEI+GF LNR+Q A+    ++L++D VI+V+D+D +++EGLG R+AF GP+    LN P G+ +Y  +Y  G+    +   F P  D S     R+I E       +  +LS+  E R+  +  + K+K
Sbjct:   19 RSWAMVFLSGGYKVKLYDNKPGQASGAIAEIRKQLEELQQAKMLRGNLSATEQLSRLSSHEDLQQALDGAFFVQESVFEDLEAKQSVFHAVEELVSESVILSSSTSCLMPSNVFSQVQNRTRCIVSHPVNPPYYVRLVELVPHPETLPAVMEVAYSLMTDVGQAPVRLRKEIDGFALNRVQYAIIAESWRLVQDGVISVKDIDLVMSEGLGMRYAFIGPIETMHLNAPEGMKDYLQRYSEGMK--RVLNTFGPVPDFSGEPAARVIKEICEMIPGEQEHLSARRERRDQLLMGLAKLK 314          
BLAST of Lambda-crystallin homolog vs. Ensembl Zebrafish
Match: cryl1 (crystallin, lambda 1 [Source:ZFIN;Acc:ZDB-GENE-060810-7])

HSP 1 Score: 166.007 bits (419), Expect = 1.304e-46
Identity = 98/298 (32.89%), Postives = 160/298 (53.69%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGP-GIDNYFNKYLPGLDLLNIKQNFPPQHDQSV--IERIIDE------TKIRNLSSIFEERNFTIGSILKIK 1169
            + WAM+F +    + +YD    Q    +  IR  L++L  + + R +     QL R++           + FV E V E++E KQ VF  ++   ++  I  SS+S L  S     + N+++CI++HPV+PPY +RLVE+VP   T    +     LM ++ Q PV  +KEI+GF LNR+Q A+    ++L++D VI+V+D+D +++EGLG R+AF GP+    LN P G+ +Y  +Y  G+    +   F P  D S     R+I E       +  +LS+  E R+  +  + K+K
Sbjct:   19 RSWAMVFLSGGYKVKLYDNKPGQASGAIAEIRKQLEELQQAKMLRGNLSATEQLSRLSSHEDLQQALDGAFFVQESVFEDLEAKQSVFHAVEELVSESVILSSSTSCLMPSNVFSQVQNRTRCIVSHPVNPPYYVRLVELVPHPETLPAVMEVAYSLMTDVGQAPVRLRKEIDGFALNRVQYAIIAESWRLVQDGVISVKDIDLVMSEGLGMRYAFIGPIETMHLNAPEGMKDYLQRYSEGMK--RVLNTFGPVPDFSGEPAARVIKEICEMIPGEQEHLSARRERRDQLLMGLAKLK 314          
BLAST of Lambda-crystallin homolog vs. Ensembl Zebrafish
Match: cryl1 (crystallin, lambda 1 [Source:ZFIN;Acc:ZDB-GENE-060810-7])

HSP 1 Score: 166.007 bits (419), Expect = 1.304e-46
Identity = 98/298 (32.89%), Postives = 160/298 (53.69%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGP-GIDNYFNKYLPGLDLLNIKQNFPPQHDQSV--IERIIDE------TKIRNLSSIFEERNFTIGSILKIK 1169
            + WAM+F +    + +YD    Q    +  IR  L++L  + + R +     QL R++           + FV E V E++E KQ VF  ++   ++  I  SS+S L  S     + N+++CI++HPV+PPY +RLVE+VP   T    +     LM ++ Q PV  +KEI+GF LNR+Q A+    ++L++D VI+V+D+D +++EGLG R+AF GP+    LN P G+ +Y  +Y  G+    +   F P  D S     R+I E       +  +LS+  E R+  +  + K+K
Sbjct:   19 RSWAMVFLSGGYKVKLYDNKPGQASGAIAEIRKQLEELQQAKMLRGNLSATEQLSRLSSHEDLQQALDGAFFVQESVFEDLEAKQSVFHAVEELVSESVILSSSTSCLMPSNVFSQVQNRTRCIVSHPVNPPYYVRLVELVPHPETLPAVMEVAYSLMTDVGQAPVRLRKEIDGFALNRVQYAIIAESWRLVQDGVISVKDIDLVMSEGLGMRYAFIGPIETMHLNAPEGMKDYLQRYSEGMK--RVLNTFGPVPDFSGEPAARVIKEICEMIPGEQEHLSARRERRDQLLMGLAKLK 314          
BLAST of Lambda-crystallin homolog vs. Ensembl Zebrafish
Match: cryl1 (crystallin, lambda 1 [Source:ZFIN;Acc:ZDB-GENE-060810-7])

HSP 1 Score: 156.762 bits (395), Expect = 1.019e-43
Identity = 81/228 (35.53%), Postives = 130/228 (57.02%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGP 986
            + WAM+F +    + +YD    Q    +  IR  L++L  + + R +     QL R++           + FV E V E++E KQ VF  ++   ++  I  SS+S L  S     + N+++CI++HPV+PPY +RLVE+VP   T    +     LM ++ Q PV  +KEI+GF LNR+Q A+    ++L++D VI+V+D+D +++EGLG R+AF GP+    LN P
Sbjct:   19 RSWAMVFLSGGYKVKLYDNKPGQASGAIAEIRKQLEELQQAKMLRGNLSATEQLSRLSSHEDLQQALDGAFFVQESVFEDLEAKQSVFHAVEELVSESVILSSSTSCLMPSNVFSQVQNRTRCIVSHPVNPPYYVRLVELVPHPETLPAVMEVAYSLMTDVGQAPVRLRKEIDGFALNRVQYAIIAESWRLVQDGVISVKDIDLVMSEGLGMRYAFIGPIETMHLNAP 246          
BLAST of Lambda-crystallin homolog vs. Ensembl Zebrafish
Match: cryl1 (crystallin, lambda 1 [Source:ZFIN;Acc:ZDB-GENE-060810-7])

HSP 1 Score: 156.762 bits (395), Expect = 1.019e-43
Identity = 81/228 (35.53%), Postives = 130/228 (57.02%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGP 986
            + WAM+F +    + +YD    Q    +  IR  L++L  + + R +     QL R++           + FV E V E++E KQ VF  ++   ++  I  SS+S L  S     + N+++CI++HPV+PPY +RLVE+VP   T    +     LM ++ Q PV  +KEI+GF LNR+Q A+    ++L++D VI+V+D+D +++EGLG R+AF GP+    LN P
Sbjct:   19 RSWAMVFLSGGYKVKLYDNKPGQASGAIAEIRKQLEELQQAKMLRGNLSATEQLSRLSSHEDLQQALDGAFFVQESVFEDLEAKQSVFHAVEELVSESVILSSSTSCLMPSNVFSQVQNRTRCIVSHPVNPPYYVRLVELVPHPETLPAVMEVAYSLMTDVGQAPVRLRKEIDGFALNRVQYAIIAESWRLVQDGVISVKDIDLVMSEGLGMRYAFIGPIETMHLNAP 246          
BLAST of Lambda-crystallin homolog vs. Ensembl Xenopus
Match: cryl1 (crystallin lambda 1 [Source:NCBI gene;Acc:100145620])

HSP 1 Score: 176.792 bits (447), Expect = 1.105e-50
Identity = 112/304 (36.84%), Postives = 170/304 (55.92%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFL-PISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPP----------QHDQSVIERIIDETKIRNLSSIFEERNFTIGSILKIKLHQK 1181
            + WAM+F +    + +YDI  +Q+   L  IR  +++L  S + R    +E Q+  I+  T        + ++ ECV EN+++KQK+F  LD + +D TI  SS+S L P S FT  L +   CI+AHPV+PPY + LVE+VP   T   TV +T  LM+++ Q PV   KE++GF LNR+Q AV +  ++L++D VI+  DVD +++EGLG R+AF GPL  A LN  G  +Y  +Y  G+    +   F P          + DQ++ E + D  K   L +  E RN  +  + K+K   K
Sbjct:    7 RSWAMVFASGGFRVKLYDIVQEQVSTALEDIRKQMEELKKSEMLRGALSMEDQMALISGCTDLKYALHGAQYIQECVPENLDLKQKIFSELDLYVDDSTIISSSTSCLSPTSMFT-GLQHVKNCIVAHPVNPPYYVPLVELVPHPQTEMATVERTYNLMKKVGQSPVKLMKEMDGFVLNRLQYAVISEAWRLVQDGVISPRDVDLVMSEGLGMRYAFLGPLETAHLNAEGFKSYCERYGEGIK--RVLATFGPVPDFEGEVAEKIDQALWEDVRD--KADQLKAGREYRNTCLSHLAKLKKEMK 305          
BLAST of Lambda-crystallin homolog vs. Ensembl Xenopus
Match: cryl1 (crystallin lambda 1 [Source:NCBI gene;Acc:100145620])

HSP 1 Score: 177.178 bits (448), Expect = 1.373e-50
Identity = 112/304 (36.84%), Postives = 170/304 (55.92%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFL-PISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPP----------QHDQSVIERIIDETKIRNLSSIFEERNFTIGSILKIKLHQK 1181
            + WAM+F +    + +YDI  +Q+   L  IR  +++L  S + R    +E Q+  I+  T        + ++ ECV EN+++KQK+F  LD + +D TI  SS+S L P S FT  L +   CI+AHPV+PPY + LVE+VP   T   TV +T  LM+++ Q PV   KE++GF LNR+Q AV +  ++L++D VI+  DVD +++EGLG R+AF GPL  A LN  G  +Y  +Y  G+    +   F P          + DQ++ E + D  K   L +  E RN  +  + K+K   K
Sbjct:   19 RSWAMVFASGGFRVKLYDIVQEQVSTALEDIRKQMEELKKSEMLRGALSMEDQMALISGCTDLKYALHGAQYIQECVPENLDLKQKIFSELDLYVDDSTIISSSTSCLSPTSMFT-GLQHVKNCIVAHPVNPPYYVPLVELVPHPQTEMATVERTYNLMKKVGQSPVKLMKEMDGFVLNRLQYAVISEAWRLVQDGVISPRDVDLVMSEGLGMRYAFLGPLETAHLNAEGFKSYCERYGEGIK--RVLATFGPVPDFEGEVAEKIDQALWEDVRD--KADQLKAGREYRNTCLSHLAKLKKEMK 317          
BLAST of Lambda-crystallin homolog vs. Ensembl Xenopus
Match: vps41 (VPS41, HOPS complex subunit [Source:Xenbase;Acc:XB-GENE-999710])

HSP 1 Score: 64.3142 bits (155), Expect = 1.193e-10
Identity = 49/212 (23.11%), Postives = 97/212 (45.75%), Query Frame = 3
Query:  312 AMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDEC----VEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLG 935
            A +  +    + + D  DD +K    +I   L+++     +   E     +E  L   T +T  + +  ++D V+E + EN+++K ++F+ LD    + TI  S++S LPI+    S   + +    H  +P  +++L+E++    TS  T        + + + PV   K+  GF +NR+         +L +    + ED+D  +  G G
Sbjct:   44 AQVAASTGHTVVLVDQTDDILKKSRKTIEDSLKRVTKKMFADKPEAASQFIEKILANFTTSTDPAAVVHSTDLVVEAIVENLDVKNELFKRLDKFAPEHTIFASNTSSLPITDIANSTTRQDRFGGLHFFNPVPMMKLIEVIKTPMTSQTTFESLMDFSKALGKTPVSC-KDTPGFIVNRLLVPYLMESVRLYERGHASKEDIDVAMKLGAG 254          
BLAST of Lambda-crystallin homolog vs. Ensembl Xenopus
Match: vps41 (VPS41, HOPS complex subunit [Source:Xenbase;Acc:XB-GENE-999710])

HSP 1 Score: 63.929 bits (154), Expect = 1.630e-10
Identity = 49/212 (23.11%), Postives = 97/212 (45.75%), Query Frame = 3
Query:  312 AMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDEC----VEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLG 935
            A +  +    + + D  DD +K    +I   L+++     +   E     +E  L   T +T  + +  ++D V+E + EN+++K ++F+ LD    + TI  S++S LPI+    S   + +    H  +P  +++L+E++    TS  T        + + + PV   K+  GF +NR+         +L +    + ED+D  +  G G
Sbjct:   42 AQVAASTGHTVVLVDQTDDILKKSRKTIEDSLKRVTKKMFADKPEAASQFIEKILANFTTSTDPAAVVHSTDLVVEAIVENLDVKNELFKRLDKFAPEHTIFASNTSSLPITDIANSTTRQDRFGGLHFFNPVPMMKLIEVIKTPMTSQTTFESLMDFSKALGKTPVSC-KDTPGFIVNRLLVPYLMESVRLYERGHASKEDIDVAMKLGAG 252          
BLAST of Lambda-crystallin homolog vs. Ensembl Mouse
Match: Cryl1 (crystallin, lambda 1 [Source:MGI Symbol;Acc:MGI:1915881])

HSP 1 Score: 163.31 bits (412), Expect = 1.355e-45
Identity = 93/269 (34.57%), Postives = 155/269 (57.62%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPPQHDQSVIERIIDETKIR 1109
            + WAM+F +    + +YDI   QI   L +IR  ++ L  S   +     E QL  I+     ++  + +  + ECV EN+E+K+K+F  LD   +D  I  SSSS L  S     L +  +CI+AHPV+PPY + LVE+VP   T+  T+ +T  LM++I Q PV   KEI+GF LNR+Q AV +  ++L+++++++  D+D ++++GLG R+AF GPL    LN  G+ +Y  +Y  G+  +       P+   + +ER+ ++  ++
Sbjct:   19 RSWAMLFASGGFKVKLYDIEQQQITDALENIRKEMKSLEQSGSLKGSLSAERQLSLISGCGNLAEAVEGAVHIQECVPENLELKKKIFAQLDRIVDDRVILSSSSSCLLPSKLFSGLAHVKQCIVAHPVNPPYYVPLVELVPHPETAPATMDRTYALMKKIGQSPVRVLKEIDGFVLNRLQYAVISEAWRLVEEEIVSPSDLDLVMSDGLGMRYAFIGPLETMHLNAEGVISYCERYSEGMKHVLSTFGPVPEFSGATVERVSEDMCMK 287          
BLAST of Lambda-crystallin homolog vs. Ensembl Mouse
Match: Hadh (hydroxyacyl-Coenzyme A dehydrogenase [Source:MGI Symbol;Acc:MGI:96009])

HSP 1 Score: 65.4698 bits (158), Expect = 3.881e-11
Identity = 45/182 (24.73%), Postives = 87/182 (47.80%), Query Frame = 3
Query:  390 SIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLG 935
            S++   ++    N    DE VE  L  ++ +T  + +  ++D V+E + EN+++K ++FQ LD    + TI  S++S L I+    +   + +    H  +P  +++LVE++    TS  T        + + + PV   K+  GF +NR+         +L +    + ED+D  +  G G
Sbjct:   73 SLKRMAKKKFTENPKAGDEFVEKTLSCLSTSTDAASVVHSTDLVVEAIVENLKLKNELFQRLDKFAAEHTIFASNTSSLQITNIANATTRQDRFAGLHFFNPVPMMKLVEVIKTPMTSQKTFESLVDFCKTLGKHPVSC-KDTPGFIVNRLLVPYLIEAVRLHERGDASKEDIDTAMKLGAG 253          
BLAST of Lambda-crystallin homolog vs. UniProt/SwissProt
Match: sp|Q9Y2S2|CRYL1_HUMAN (Lambda-crystallin homolog OS=Homo sapiens OX=9606 GN=CRYL1 PE=1 SV=3)

HSP 1 Score: 175.252 bits (443), Expect = 3.131e-49
Identity = 91/252 (36.11%), Postives = 151/252 (59.92%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPP 1058
            + WAM+F +    + +YDI   QI+  L +IR  ++ L  +   +    VE QL  I+      +  + +  + ECV E++E+K+K+F  LDS  +D  I  SS+S L  S     L++  +CI+AHPV+PPY + LVE+VP   T+  TV +T  LM++I Q P+  +KE+ GF LNR+Q A+ +  ++L+++ +++  D+D +++EGLG R+AF GPL    LN  G+ +Y ++Y  G+   ++ Q F P
Sbjct:   19 RSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQCIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSEGLGMRYAFIGPLETMHLNAEGMLSYCDRYSEGIK--HVLQTFGP 268          
BLAST of Lambda-crystallin homolog vs. UniProt/SwissProt
Match: sp|Q5RDZ2|CRYL1_PONAB (Lambda-crystallin homolog OS=Pongo abelii OX=9601 GN=CRYL1 PE=2 SV=3)

HSP 1 Score: 173.711 bits (439), Expect = 1.163e-48
Identity = 90/252 (35.71%), Postives = 151/252 (59.92%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPP 1058
            + WAM+F +    + +YDI   QI+  L +IR  ++ L  +   +    VE QL  I+      +  + +  + ECV E++E+K+K+F  LDS  +D  I  SS+S L  S     L++  +CI+AHPV+PPY + LVE+VP   T+  TV +T  LM++I Q P+  +KE+ GF LNR+Q A+ +  ++L+++ +++  D+D +++EGLG R+AF GPL    LN  G+ +Y ++Y  G+   ++ + F P
Sbjct:   19 RSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQCIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSEGLGMRYAFIGPLETMHLNAEGMLSYCDRYSEGMK--HVLKTFGP 268          
BLAST of Lambda-crystallin homolog vs. UniProt/SwissProt
Match: sp|Q811X6|CRYL1_RAT (Lambda-crystallin homolog OS=Rattus norvegicus OX=10116 GN=Cryl1 PE=1 SV=3)

HSP 1 Score: 163.696 bits (413), Expect = 6.400e-45
Identity = 90/241 (37.34%), Postives = 145/241 (60.17%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGL 1025
            + WAM+F +    + +YDI   QI   L SIR  ++ L  S   +     E QL  I+     ++  + +  + ECV EN+E+K+K+F  LD   +D+ I  SSSS L  S     L +  +CI+AHPV+PPY + LVE+VP   T+  T+ +T  LM++I+Q PV   KEI+GF LNR+Q A+ +  ++L+++ +++  D+D ++++GLG R+AF GPL    LN  G+ +Y ++Y  G+
Sbjct:   19 RSWAMLFASGGFKVKLYDIEQQQITNALESIRKEMKSLEQSGSLKGSLGAEQQLSLISGCGNLAEAVEGAMHIQECVPENLELKKKIFAQLDRIVDDQVILSSSSSCLLPSKLFTGLAHVKQCIVAHPVNPPYYVPLVELVPHPETAPATMDRTYALMKKIRQTPVRVLKEIDGFVLNRLQYAIISEAWRLVEEGIVSPNDLDLVMSDGLGMRYAFIGPLETMHLNAEGMVSYCDRYSEGM 259          
BLAST of Lambda-crystallin homolog vs. UniProt/SwissProt
Match: sp|P14755|CRYL1_RABIT (Lambda-crystallin OS=Oryctolagus cuniculus OX=9986 GN=CRYL1 PE=1 SV=3)

HSP 1 Score: 163.696 bits (413), Expect = 7.474e-45
Identity = 93/262 (35.50%), Postives = 151/262 (57.63%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPPQHDQSVIERI 1088
            + WAM+F +    + +YDI   QI   L +IR  ++ L  S   +     E QL  I+  T  ++  +    + ECV EN+++K+K+F  LDS  +D  +  SSSS L  S     L +  +CI+AHPV+PPY + LVE+VP   TS  TV +T  LM +I Q PV   KEI+GF LNR+Q A+ +  ++L+++ +++  D+D ++++GLG R+AF GPL    LN  G+ +Y ++Y  G+  +       P+   + +E++
Sbjct:   19 RSWAMLFASGGFRVKLYDIEPRQITGALENIRKEMKSLQQSGSLKGSLSAEEQLSLISSCTNLAEAVEGVVHIQECVPENLDLKRKIFAQLDSIVDDRVVLSSSSSCLLPSKLFTGLAHVKQCIVAHPVNPPYYIPLVELVPHPETSPATVDRTHALMRKIGQSPVRVLKEIDGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSDGLGMRYAFIGPLETMHLNAEGMLSYCDRYSEGMKRVLKSFGSIPEFSGATVEKV 280          
BLAST of Lambda-crystallin homolog vs. UniProt/SwissProt
Match: sp|Q99KP3|CRYL1_MOUSE (Lambda-crystallin homolog OS=Mus musculus OX=10090 GN=Cryl1 PE=1 SV=3)

HSP 1 Score: 163.31 bits (412), Expect = 9.480e-45
Identity = 93/269 (34.57%), Postives = 155/269 (57.62%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPPQHDQSVIERIIDETKIR 1109
            + WAM+F +    + +YDI   QI   L +IR  ++ L  S   +     E QL  I+     ++  + +  + ECV EN+E+K+K+F  LD   +D  I  SSSS L  S     L +  +CI+AHPV+PPY + LVE+VP   T+  T+ +T  LM++I Q PV   KEI+GF LNR+Q AV +  ++L+++++++  D+D ++++GLG R+AF GPL    LN  G+ +Y  +Y  G+  +       P+   + +ER+ ++  ++
Sbjct:   19 RSWAMLFASGGFKVKLYDIEQQQITDALENIRKEMKSLEQSGSLKGSLSAERQLSLISGCGNLAEAVEGAVHIQECVPENLELKKKIFAQLDRIVDDRVILSSSSSCLLPSKLFSGLAHVKQCIVAHPVNPPYYVPLVELVPHPETAPATMDRTYALMKKIGQSPVRVLKEIDGFVLNRLQYAVISEAWRLVEEEIVSPSDLDLVMSDGLGMRYAFIGPLETMHLNAEGVISYCERYSEGMKHVLSTFGPVPEFSGATVERVSEDMCMK 287          
BLAST of Lambda-crystallin homolog vs. TrEMBL
Match: A0A2P2HXQ3 (Lambda-crystallin homolog OS=Hirondellea gigas OX=1518452 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 6.135e-62
Identity = 102/239 (42.68%), Postives = 154/239 (64.44%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLP 1019
            + WAM+FT+   ++ +YD+  DQ+   L  +   LQ+L  S + R  +  + Q  R+T T    +   ++ FV EC+ EN+++K K+F  LD    + TI  SS+S +  S FTE L+++  CI++HPV+PPY + LVE+VPA +TS +TV +TK+LM E+ Q PVVF KE+ GFGLNRIQ  + N  + L++D V++  DVDKL++ GLGPR+ + GPL  A LN  G+ +Y  +Y P
Sbjct:   16 RSWAMLFTSVGYHVAIYDVTIDQVTSSLAEVLKQLQELEASGMLRGTDDAQTQHNRLTGTATLKECVCDAMFVQECIPENLDLKIKLFAELDKLVGENTILSSSTSCIMPSKFTEPLVHRENCIVSHPVNPPYFVPLVEVVPAPWTSASTVSRTKELMTELGQEPVVFSKELPGFGLNRIQYVILNECYHLVQDGVLSARDVDKLMSCGLGPRYTWMGPLETAHLNADGLGSYIERYGP 254          
BLAST of Lambda-crystallin homolog vs. TrEMBL
Match: T1I9V9 (Uncharacterized protein (Fragment) OS=Rhodnius prolixus OX=13249 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 6.130e-61
Identity = 108/253 (42.69%), Postives = 159/253 (62.85%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSS-FLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPP 1058
            + WAM+F +   N+ +YD+   +++  L  I+  +  L   N+ R     E QL  I+ T    D  +++ ++ EC+ EN+++K+++FQ +D   ND TI  SS+S FLP S F+E L +K   ++AHPV+PPY + LVEIVPA +T  N  LKTK++M EI Q PV+  KE+ GF LNRIQ  + N  + L+K+ V+NVED+DK++TEGLG R+AF GPL  A LN  G+ NY  +Y     + N+ Q  PP
Sbjct:   19 RSWAMLFASVGYNVTIYDVISQKVEDALADIKQQMSILEKKNLLRGKLSPEQQLALISGTLNLEDCLRDALYIQECIPENLDLKKELFQKIDMIVNDTTILASSTSTFLP-SLFSEGLKHKENVVVAHPVNPPYYVPLVEIVPAPWTKSNVALKTKEIMLEIGQSPVLLNKELPGFALNRIQYVILNECWNLLKEGVLNVEDIDKVMTEGLGMRYAFLGPLETAHLNAEGMANYCERY--SNSIYNVCQTMPP 268          
BLAST of Lambda-crystallin homolog vs. TrEMBL
Match: A0A0P4VQX7 (Putative 3-hydroxyacyl-coa dehydrogenase OS=Rhodnius neglectus OX=72488 PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 7.054e-61
Identity = 108/253 (42.69%), Postives = 159/253 (62.85%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSS-FLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPP 1058
            + WAM+F +   N+ +YD+   +++  L  I+  +  L   N+ R     E QL  I+ T    D  +++ ++ EC+ EN+++K+++FQ +D   ND TI  SS+S FLP S F+E L +K   ++AHPV+PPY + LVEIVPA +T  N  LKTK++M EI Q PV+  KE+ GF LNRIQ  + N  + L+K+ V+NVED+DK++TEGLG R+AF GPL  A LN  G+ NY  +Y     + N+ Q  PP
Sbjct:   18 RSWAMLFASVGYNVTIYDVISQKVEDALADIKQQMSILEKKNLLRGKLSPEQQLALISGTLNLEDCLRDALYIQECIPENLDLKKELFQKIDMIVNDTTILASSTSTFLP-SLFSEGLKHKENVVVAHPVNPPYYVPLVEIVPAPWTKSNVALKTKEIMLEIGQSPVLLNKELPGFALNRIQYVILNECWNLLKEGVLNVEDIDKVMTEGLGMRYAFLGPLETAHLNAEGMANYCERY--SNSIYNVCQTMPP 267          
BLAST of Lambda-crystallin homolog vs. TrEMBL
Match: E9GXZ8 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_306692 PE=4 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 6.463e-60
Identity = 107/295 (36.27%), Postives = 172/295 (58.31%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPP------QHDQSVIERIIDETKIRNLSSIFEERNFTIGSILKIK 1169
            + WAM+F     N+ +YD+  + ++  +  I   LQ L  S + R +     QL  IT T    +  Q + +V ECV EN+E+K+KVF  LD+  +D  I  SS+S    S F+E++ ++   I+AHPV+PP+ + LVE+VPA +TS    +K +Q+MEE+ Q PV   +EI GF LNRIQ A+ N  + L ++ +++V D+D +++ GLGPR+AF GPL  A LN  G++NY  +Y  G  + N+ +   P       + Q V ++++D+  + NL      RN  + S+ ++K
Sbjct:   16 RSWAMLFAGAGYNVHLYDVTQELVENAIKDIEEQLQALATSGLLRGNLNASEQLKLITGTKTLKECVQGALYVQECVPENLELKKKVFAELDALVDDSAIIASSTSCTLPSLFSENMKHRQNVIVAHPVNPPFYVPLVELVPAPWTSPEVAIKARQIMEELGQKPVSLSREIPGFALNRIQYAILNECWYLAQEGILDVADIDSVMSHGLGPRYAFMGPLETAHLNAEGMENYCERY--GETIFNVSKTLGPVTRFEGANLQKVNQQLVDQVPLENLQEKRAWRNNCLSSLAQLK 308          
BLAST of Lambda-crystallin homolog vs. TrEMBL
Match: X1Z7A3 (Uncharacterized protein OS=Capitella teleta OX=283909 PE=4 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 7.093e-60
Identity = 107/295 (36.27%), Postives = 172/295 (58.31%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPPQ------HDQSVIERIIDETKIRNLSSIFEERNFTIGSILKIK 1169
            + W+M+F A    + +YDI  +Q+   L  +R  L+ L  S + R    V+ QL  I+ T +F D  + + ++ EC  EN E+K+KVFQ LD   +D T+  SS+S +P STF+E L ++S+ I+AHP +PP+   L E+VPA +T       T  +M+EI Q+ V+ KKE+ GF LNRIQ ++     +L+ +DVI+VED+DK++TEGLG R+AF GP+    LN  G+ NY  +Y  G  +  I + F P         + +I+ + ++  +  L+     R+  + ++ K+K
Sbjct:   18 RSWSMLFAAAGYKVVIYDIDANQVSSALEGVREQLKDLEKSGLLRGKLSVDEQLQLISGTNKFEDCVKGAKYIQECTPENFELKKKVFQQLDQLADDHTVLASSTSSMPASTFSEDLKHRSQVIVAHPTNPPFYCPLTEVVPAPWTKPEVTTATMSIMKEIGQVAVLLKKEVLGFALNRIQYSIVQECRRLVSNDVISVEDLDKVMTEGLGMRYAFIGPMETCHLNAEGMANYSERY--GEMIYRITETFGPNPKWEGPGHEKIIQEMNEQIPLDTLAERRRWRDARLTALAKLK 310          
BLAST of Lambda-crystallin homolog vs. Ensembl Cavefish
Match: cryl1 (crystallin, lambda 1 [Source:ZFIN;Acc:ZDB-GENE-060810-7])

HSP 1 Score: 174.866 bits (442), Expect = 4.146e-50
Identity = 98/296 (33.11%), Postives = 163/296 (55.07%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGP-GIDNYFNKYLPGLDLLNIKQNFPPQHDQSVIERIIDE------TKIRNLSSIFEERNFTIGSILKIK 1169
            + WAM+F +    + +YD    Q    +  I+  +++L ++ + R       QL  ++     S+  + + FV ECV E +E K+ VFQ +++H  +  +  SS+S L  S     + N+++CII+HPV+PPY +RLVE+VP   T    +    +LM E+ Q PV   KEI+GF LNR+Q A+    ++L+KD+VI+V+D+D +++EGLG R+AF GP+    LN P G+++Y  +Y  G+  +       P+ D     RI  E          +LS+  E R+  +  + K+K
Sbjct:   19 RSWAMVFLSGGYKVKIYDNQPGQASRAIAEIKKQVEELQEAQMLRGKLSAANQLSLLSSHEDLSEALEGAFFVQECVFEELEAKKSVFQAVENHVGEGVVLSSSTSCLMPSNVFSLVQNRTRCIISHPVNPPYYVRLVELVPHPETLPVVMDMAYELMTEVGQAPVRILKEIDGFALNRVQYAIIAECWRLVKDEVISVKDIDLVMSEGLGMRYAFIGPIETMHLNAPEGLEDYLKRYREGMRRVLSSFGPIPEFDGEAAARINKEICELIPNDQEHLSARRERRDQLLMGLAKLK 314          
BLAST of Lambda-crystallin homolog vs. Ensembl Cavefish
Match: hadh (hydroxyacyl-CoA dehydrogenase [Source:NCBI gene;Acc:103033308])

HSP 1 Score: 67.0106 bits (162), Expect = 7.636e-12
Identity = 51/212 (24.06%), Postives = 100/212 (47.17%), Query Frame = 3
Query:  312 AMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNIS----RSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLG 935
            A +      ++ + D+ +D +K    SI   L++++    +      +E ++  +  I+ +T  + + Q +D V+E + EN+++KQ +F  LD    + TI  S++S LPI+    S     +    H  +P  +++LVE++ A  TS  T        + + + PV   K+  GF +NR+         +L +    + ED+D  +  G G
Sbjct:   38 AQVAATTGHSVVLVDMSEDILKKSAKSIEGSLKRVVKKKFADKPEAGEEFLQKAMKNISTSTDAAAVVQKTDLVVEAIVENLKVKQDLFSTLDKVAPEHTIFASNTSSLPIADIASSTARLDRFGGLHFFNPVPMMKLVEVIKAPGTSQQTFDALIDFSKALGKHPVSC-KDTPGFIVNRLLVPYLMEAVRLHERGHGSKEDIDVAMKLGAG 248          
BLAST of Lambda-crystallin homolog vs. Ensembl Sea Lamprey
Match: cryl1 (crystallin, lambda 1 [Source:ZFIN;Acc:ZDB-GENE-060810-7])

HSP 1 Score: 176.407 bits (446), Expect = 2.745e-51
Identity = 90/253 (35.57%), Postives = 140/253 (55.34%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSS-FLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPP 1058
            + WAM+F A    + +YD      +  L  IR  L+ L  S   R    V+ QL  I      S+     D+V EC+ E++ +K+++++ LD      T+  SS+S  LP + F +     + C++ HPV+PPY +RLVE+VP + T    + +  +LM  + Q PV  ++EI GF LNR+Q A+    ++L++D V++ EDVD ++TEGLGPR+AF GPL    LN  G  +Y  +Y  G+   +I   F P
Sbjct:   18 RSWAMLFAAAGFPVRLYDSLPGVAEKALQDIRENLKSLAASGSLRGSLPVDSQLSLIQAVADLSEAVSGVDYVQECIPEDLSMKEELYRQLDPLLGPRTVLASSTSCLLPSALFAQRRY-PANCLVCHPVNPPYFVRLVELVPHAGTGGAALSRAHRLMRRLGQAPVTLRREIPGFALNRVQYAIIAEAWRLVRDGVMSPEDVDLVMTEGLGPRYAFVGPLETMHLNAEGFKSYCERYEAGMT--SIMSAFGP 267          
BLAST of Lambda-crystallin homolog vs. Ensembl Sea Lamprey
Match: hadh (hydroxyacyl-CoA dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040801-261])

HSP 1 Score: 63.929 bits (154), Expect = 1.772e-11
Identity = 51/212 (24.06%), Postives = 95/212 (44.81%), Query Frame = 3
Query:  312 AMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDEC----VEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLG 935
            A +       + + D  DD ++  +  I S L++++      + E     +   +  I+ +T  + +  + D V+E + EN+ +KQ +F  LD    +ETI  S++S LPI+    S   + +    H  +P  +++LVE+V    TS  T          + + PV   K+  GF +NR+         +L +    + ED+D  +  G G
Sbjct:   45 AQVAATTGHKVVIVDQTDDILQKAMKGIESSLKRVVKKTFGDNTEAGAKFMADTMSNISTSTDAAAVVHSCDLVLEAIVENLPVKQSLFSQLDKFAPEETIFASNTSSLPITDIANSTSRQDRFGGLHFFNPVPVMKLVEVVETPMTSKATFEALTDFTIALGKKPVSC-KDTPGFIVNRLLVPYMMEAVRLHERGHGSKEDIDLAMKLGAG 255          
BLAST of Lambda-crystallin homolog vs. Ensembl Nematostella
Match: EDO38824 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBT1])

HSP 1 Score: 169.088 bits (427), Expect = 2.541e-48
Identity = 91/241 (37.76%), Postives = 145/241 (60.17%), Query Frame = 3
Query:  303 QQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSD---FVMECVSENVEIKQKVFQLLDSHFND-ETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKY 1013
            + W+ +F++   ++ +YD    Q+     +I S LQ+L    + +   C   Q     VTT   DLPQ  +   +V EC  EN+E+K+KVFQ L++  +  E I  SS+S +  S FTESL  + +CI+AHP++PPY + LVE++PA +T  + + +T +LM++I Q PV+ KKE  GF +NR+Q A+    ++L+++ + + EDVD  +TEGLG R++  GP     LN  GI +Y  +Y
Sbjct:   20 RAWSTLFSSAGYHVALYDTVSSQLVNAKEAIISQLQELESKELLKGRHCKTAQEAFKLVTTT-DDLPQALNGVFYVQECTPENLELKKKVFQNLEATLSSSEVILASSTSCIMPSKFTESLQLRQRCIVAHPINPPYYVPLVEVIPAPWTDASVIEQTIKLMKDIGQSPVLLKKETNGFIVNRLQYALIAEAWRLVEEGICSPEDVDTTMTEGLGLRYSLIGPFETMHLNADGIRDYCQRY 259          
BLAST of Lambda-crystallin homolog vs. Ensembl Nematostella
Match: EDO27740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8E7])

HSP 1 Score: 142.895 bits (359), Expect = 2.255e-40
Identity = 69/160 (43.12%), Postives = 108/160 (67.50%), Query Frame = 3
Query:  516 FVMECVSENVEIKQKVFQLLDSHFND-ETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGI 992
            F+ EC  EN+E+K+KVFQ L++  +  E I  SS+S +  S FTESL  + +CI+AHP++PPY + LVE++PA +T  + + +T +LM++I Q PV+ KKE  GF +NR+Q A+    ++L+++ + + EDVD  +TEGLG R++  GP     LN  G+
Sbjct:    1 FLQECTPENLELKKKVFQNLEATLSSSEVILASSTSCIMPSKFTESLQLRQRCIVAHPINPPYYVPLVEVIPAPWTDASVIEQTIKLMKDIGQSPVLLKKETNGFIVNRLQYALIAEAWRLVEEGICSPEDVDTTMTEGLGLRYSLIGPFETMHLNADGM 160          
BLAST of Lambda-crystallin homolog vs. Ensembl Nematostella
Match: EDO29655 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T309])

HSP 1 Score: 55.8398 bits (133), Expect = 1.222e-8
Identity = 42/168 (25.00%), Postives = 80/168 (47.62%), Query Frame = 3
Query:  396 RSYLQQLIDSNISRSDECVEMQ---LGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDV 890
            + Y  +L++  + RS    + +   L RI  T + +D  +  D ++E V E+ ++K  V    +     + +  S++S LPI+    ++  + K I  H  SP   + LVEI+    TSD T+ +    + +IK+ P+V   +  GF  +R+     N    ++ + V
Sbjct:   40 KDYSAKLLEKKVGRSQMSADKRDGILARIKPTVRDADF-EGCDLIIEAVFEDRDLKANVTAAAERSALSDAVIASNTSTLPITGLATAVQRQDKFIGLHFFSPVDKMPLVEIIKGEQTSDETLARGFDYVMQIKKTPIVV-NDSRGFFTSRVFGTFTNEGLAMLGEGV 205          
BLAST of Lambda-crystallin homolog vs. Ensembl Nematostella
Match: EDO29372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3U0])

HSP 1 Score: 55.8398 bits (133), Expect = 1.692e-8
Identity = 37/133 (27.82%), Postives = 63/133 (47.37%), Query Frame = 3
Query:  450 VEMQLGRITVTTQFSDLPQ--NSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRI 842
             E    R+   T   D     ++D V+E V EN+E+KQ++F+ LD+      I  S++S L I           + +  H  SP ++++L+EIV    T+   +     L + I ++ VV     +GF  NR+
Sbjct:   65 AEQSAARLACVTPVGDYVALADADLVIEAVYENLELKQQIFRTLDATLKPGAILASNTSALDIDAIAAVTKRPEQVLGLHFFSPAHIMKLLEIVRGGQTAPAVLDAAVTLGQRIGKVSVV-AGNCDGFIGNRM 196          
BLAST of Lambda-crystallin homolog vs. Ensembl Nematostella
Match: EDO46266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQC1])

HSP 1 Score: 54.6842 bits (130), Expect = 3.697e-8
Identity = 44/212 (20.75%), Postives = 95/212 (44.81%), Query Frame = 3
Query:  312 AMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQL----IDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLG 935
            A +  A   N+ + D  +  +   L SI   +Q++       ++      V   + R+ ++        ++D V+E + EN+  K K+F  LD     + I  +++S +P++  +       +    H  +P  +++LVE+V    TSD+T        +++ ++PV   K+  GF +NR+         ++++    + +D+D  +  G G
Sbjct:   59 AQVAAATDHNVTIVDQTNAILIKTLQSIERSMQRIAKKQFKDDVEAGKTFVAGTMSRLKISLDVPGSVADADLVIEAIVENLRTKHKLFTALDEAAPPQCIFATNTSSIPVADISSVTNRHDRFGGLHFFNPVPVMKLVEVVRTQQTSDDTFNTLLTFGKKLGKVPVSC-KDTPGFIVNRLLVPYLAEAVRMLERGDASPKDIDTAMKLGAG 269          
BLAST of Lambda-crystallin homolog vs. Ensembl Medaka
Match: cryl1 (crystallin lambda 1 [Source:NCBI gene;Acc:101157739])

HSP 1 Score: 185.652 bits (470), Expect = 4.831e-54
Identity = 114/315 (36.19%), Postives = 186/315 (59.05%), Query Frame = 3
Query:  255 LSMNKTXXXXXXXXXXQQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGP-GIDNYFNKYLPG----LDLLNIKQNFPPQHDQSVIERIID--ETKIRNLSSIFEERNFTIGSILKIKLHQ 1178
            +S +KTI++IG GLIG+ WAM+F +   ++ +YD    Q    ++ I   L++L ++++ R +     QL  I+     S   + + FV ECV E +EIKQ VFQ ++     + I  SS+S L  S+    L NKS+C+++HPV+PPY ++LVE+VP   T+   +  T  LM ++ Q+PV  KKEI+GF +NR+QAA+    ++L++D VI+V+D+D +++EGLG R+AF GP+    LN P G+++Y  +Y  G    L       NF  Q   S++E + +      ++LS+  E R+  +  + K+K  Q
Sbjct:    3 ISESKTITVIGSGLIGRSWAMVFASGGYSVKIYDNQPGQAAKAILEISQQLKELEEAHMLRGELTATQQLTLISSYDDLSQALEGAFFVQECVFEQLEIKQSVFQEVEQIVGKDVILSSSTSCLVPSSVFSKLQNKSRCLVSHPVNPPYYVKLVELVPHPQTTATIMDTTHALMTKVGQVPVCLKKEIDGFAINRVQAAIIAESWRLVQDGVISVKDIDLVMSEGLGMRYAFIGPMETMHLNAPEGLEDYMKRYGKGIQRVLTSFGPVPNFFDQGAGSIVEEMCELIPNDEQHLSARKERRDQLLMQLSKLKKDQ 317          
BLAST of Lambda-crystallin homolog vs. Ensembl Medaka
Match: cryl1 (crystallin lambda 1 [Source:NCBI gene;Acc:101157739])

HSP 1 Score: 177.563 bits (449), Expect = 4.238e-51
Identity = 99/254 (38.98%), Postives = 159/254 (62.60%), Query Frame = 3
Query:  255 LSMNKTXXXXXXXXXXQQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYL 1016
            +S +KTI++IG GLIG+ WAM+F +   ++ +YD    Q    ++ IR  L++L ++++ R +     QL  I+     S   + + FV ECV E +EIKQ VFQ ++     + I  SS+S L  S+    L NKS+C+++HPV+PPY ++LVE+VP   T+   +  T  LM ++ Q+PV  KKEI+GF +NR+QAA+    ++L++D VI+V+D+D +++EGLG R+AF GP+    LN P  +  +  +L
Sbjct:    3 ISESKTITVIGSGLIGRSWAMVFASGGYSVKIYDNQPGQAAKAILEIRWQLKELEEAHMLRGELTATQQLTLISSYDDLSQALEGAFFVQECVFEQLEIKQSVFQEVEQIVGKDVILSSSTSCLVPSSVFSKLQNKSRCLVSHPVNPPYYVKLVELVPHPQTTATIMDTTHALMTKVGQVPVCLKKEIDGFAINRVQAAIIAESWRLVQDGVISVKDIDLVMSEGLGMRYAFIGPMETMHLNAPEGNATYMTFL 256          
BLAST of Lambda-crystallin homolog vs. Ensembl Medaka
Match: hadh (hydroxyacyl-CoA dehydrogenase [Source:NCBI gene;Acc:101166688])

HSP 1 Score: 61.2326 bits (147), Expect = 5.650e-10
Identity = 50/212 (23.58%), Postives = 96/212 (45.28%), Query Frame = 3
Query:  312 AMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNIS----RSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLG 935
            A +  +    + + D  +D +K     I   L++++    +      +E ++  L  ++++T      Q +D ++E + EN+++KQ +F  LD      TI  S++S LPI+    S     +    H  +P  +++LVE+V  S TS  T        + + + PV   K+  GF +NR+         +L +    + ED+D  +  G G
Sbjct:   38 AQVAASTGHTVTLVDTSEDILKKSRKGIEGSLKRVVKKKFADKPEAGEEFIQNVLQNVSISTDAGASVQAADLLLEAIVENLKVKQDLFGHLDKLAPANTIFASNTSSLPITDIASSTSRLDRFGGLHFFNPVPMMKLVEVVGTSTTSQETFDSLLNFSKALGKTPVSC-KDTPGFIVNRLLVPYMMEALRLHERGHGSKEDIDIAMKLGAG 248          
BLAST of Lambda-crystallin homolog vs. Planmine SMEST
Match: SMESG000050288.1 (SMESG000050288.1)

HSP 1 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 302/307 (98.37%), Postives = 304/307 (99.02%), Query Frame = 3
Query:  261 MNKTXXXXXXXXXXQQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPPQHDQSVIERIIDETKIRNLSSIFEERNFTIGSILKIKLHQK 1181
            MNKTISIIGGGLIGQQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQ IDSNISRSDECVEMQLGRITVTTQFSDLPQ SDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVED DKLLTEGLGPRWAFYGP+TVAALNGPGIDNYFNKYLPGLDLLNIKQNFPPQHDQSVIERIID+TKIRNLSSIFEERNFTIGSILKIKLHQK
Sbjct:    1 MNKTISIIGGGLIGQQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQQFIDSNISRSDECVEMQLGRITVTTQFSDLPQKSDFVMECVSENVEIKQKVFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLRLVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYNSVFKLIKDDVINVEDADKLLTEGLGPRWAFYGPMTVAALNGPGIDNYFNKYLPGLDLLNIKQNFPPQHDQSVIERIIDQTKIRNLSSIFEERNFTIGSILKIKLHQK 307          
The following BLAST results are available for this feature:
BLAST of Lambda-crystallin homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CRYL16.519e-5036.11crystallin lambda 1 [Source:HGNC Symbol;Acc:HGNC:1... [more]
CRYL11.186e-4735.89crystallin lambda 1 [Source:HGNC Symbol;Acc:HGNC:1... [more]
CRYL11.186e-4735.89crystallin lambda 1 [Source:HGNC Symbol;Acc:HGNC:1... [more]
CRYL15.702e-4737.12crystallin lambda 1 [Source:HGNC Symbol;Acc:HGNC:1... [more]
CRYL11.656e-3436.27crystallin lambda 1 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Lambda-crystallin homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y71F9B.99.058e-5533.90pep chromosome:WBcel235:I:2759023:2761044:-1 gene:... [more]
Y71F9B.91.439e-5434.14pep chromosome:WBcel235:I:2759029:2761044:-1 gene:... [more]
ech-82.383e-1228.96Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:... [more]
ech-91.820e-1127.32Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:... [more]
ech-91.894e-1127.32Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Lambda-crystallin homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Had14.348e-6036.79gene:FBgn0286508 transcript:FBtr0074240[more]
Had14.348e-6036.79gene:FBgn0286508 transcript:FBtr0346059[more]
Had23.121e-5237.55gene:FBgn0033949 transcript:FBtr0087499[more]
Mtpalpha9.122e-624.34gene:FBgn0028479 transcript:FBtr0079858[more]
Mtpalpha9.375e-624.34gene:FBgn0028479 transcript:FBtr0079857[more]
back to top
BLAST of Lambda-crystallin homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cryl11.304e-4632.89crystallin, lambda 1 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
cryl11.304e-4632.89crystallin, lambda 1 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
cryl11.304e-4632.89crystallin, lambda 1 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
cryl11.019e-4335.53crystallin, lambda 1 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
cryl11.019e-4335.53crystallin, lambda 1 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
back to top
BLAST of Lambda-crystallin homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cryl11.105e-5036.84crystallin lambda 1 [Source:NCBI gene;Acc:10014562... [more]
cryl11.373e-5036.84crystallin lambda 1 [Source:NCBI gene;Acc:10014562... [more]
vps411.193e-1023.11VPS41, HOPS complex subunit [Source:Xenbase;Acc:XB... [more]
vps411.630e-1023.11VPS41, HOPS complex subunit [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Lambda-crystallin homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cryl11.355e-4534.57crystallin, lambda 1 [Source:MGI Symbol;Acc:MGI:19... [more]
Hadh3.881e-1124.73hydroxyacyl-Coenzyme A dehydrogenase [Source:MGI S... [more]
back to top
BLAST of Lambda-crystallin homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y2S2|CRYL1_HUMAN3.131e-4936.11Lambda-crystallin homolog OS=Homo sapiens OX=9606 ... [more]
sp|Q5RDZ2|CRYL1_PONAB1.163e-4835.71Lambda-crystallin homolog OS=Pongo abelii OX=9601 ... [more]
sp|Q811X6|CRYL1_RAT6.400e-4537.34Lambda-crystallin homolog OS=Rattus norvegicus OX=... [more]
sp|P14755|CRYL1_RABIT7.474e-4535.50Lambda-crystallin OS=Oryctolagus cuniculus OX=9986... [more]
sp|Q99KP3|CRYL1_MOUSE9.480e-4534.57Lambda-crystallin homolog OS=Mus musculus OX=10090... [more]
back to top
BLAST of Lambda-crystallin homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2P2HXQ36.135e-6242.68Lambda-crystallin homolog OS=Hirondellea gigas OX=... [more]
T1I9V96.130e-6142.69Uncharacterized protein (Fragment) OS=Rhodnius pro... [more]
A0A0P4VQX77.054e-6142.69Putative 3-hydroxyacyl-coa dehydrogenase OS=Rhodni... [more]
E9GXZ86.463e-6036.27Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
X1Z7A37.093e-6036.27Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Lambda-crystallin homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cryl14.146e-5033.11crystallin, lambda 1 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
hadh7.636e-1224.06hydroxyacyl-CoA dehydrogenase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Lambda-crystallin homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cryl12.745e-5135.57crystallin, lambda 1 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
hadh1.772e-1124.06hydroxyacyl-CoA dehydrogenase [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Lambda-crystallin homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lambda-crystallin homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO388242.541e-4837.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277402.255e-4043.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296551.222e-825.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293721.692e-827.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462663.697e-820.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lambda-crystallin homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cryl14.831e-5436.19crystallin lambda 1 [Source:NCBI gene;Acc:10115773... [more]
cryl14.238e-5138.98crystallin lambda 1 [Source:NCBI gene;Acc:10115773... [more]
hadh5.650e-1023.58hydroxyacyl-CoA dehydrogenase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Lambda-crystallin homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000050288.10.000e+098.37SMESG000050288.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003152 ID=SMED30003152|Name=Lambda-crystallin homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1544bp
TGAACTACGAATTTGTTTTATTGCATATATGTAAAATGTATTTGCTTACT
AATTAGAACTTATAGTGATATTGTTGATATTATTTAATAACGAAATTTTT
ATTTGATTATTTTAATAGTCATACAAACTTTATGATGTTCATTGTAATCA
TTGAATTACTTTTTAGACTTTAAACTTTTTAAATTTGTAATGTTGATGCT
ATATGAATTTCAATAAATTATCATTTTTTATTTAGTCGTGATCAAATTTC
TATTTTATCTATGAATAAAACTATTTCAATAATCGGTGGTGGATTAATTG
GGCAACAATGGGCTATGATATTTACTGCTTATAAATCCAATATTTTTGTT
TATGATATTTGTGACGATCAAATTAAGTTGTTTTTGATATCAATTCGAAG
TTATCTGCAACAGCTTATTGATAGTAACATTTCAAGATCTGATGAATGCG
TAGAAATGCAACTTGGTCGTATTACAGTGACCACTCAATTTAGTGATCTG
CCACAAAATTCAGATTTTGTGATGGAATGTGTTTCAGAAAATGTAGAAAT
AAAACAAAAAGTCTTTCAGTTATTGGATAGTCATTTTAATGATGAAACTA
TTCGAATGAGTAGTTCGAGTTTTCTACCGATTTCTACTTTTACGGAAAGT
TTGATTAATAAATCAAAGTGCATAATCGCTCATCCGGTTAGTCCACCATA
TTTGTTACGGTTAGTAGAAATCGTCCCCGCTTCATTTACAAGTGACAATA
CAGTATTGAAAACTAAACAATTAATGGAAGAAATTAAGCAAATTCCTGTC
GTTTTCAAGAAGGAAATTGAAGGATTTGGTCTTAATCGAATTCAAGCAGC
TGTGTATAATAGTGTTTTTAAATTGATTAAAGATGATGTCATTAACGTAG
AAGATGTCGACAAGTTATTAACTGAAGGTTTAGGGCCAAGATGGGCGTTT
TATGGCCCTTTGACAGTTGCAGCATTAAATGGGCCTGGAATTGATAATTA
TTTTAACAAATATCTGCCCGGACTTGATTTACTGAACATCAAGCAAAATT
TCCCGCCGCAGCACGACCAATCAGTGATTGAACGAATCATCGATGAGACT
AAAATTAGAAATTTGTCATCGATTTTTGAGGAAAGAAATTTCACAATTGG
TTCGATTTTGAAAATCAAACTCCATCAGAAATTGTAAGAAAGCTTATTCA
ACAAGTTTTCTAATTTAGTATATTTTTCAATAGGATTAATGCTTTTATAT
ATGTTTTTTAAGTGCCGAATGTTGTTGATCAATTTAGATGAAAGTTTAAA
TTCAAACAAAAGCCAAATATTTTATTTCCAAAACGAACCGATTTTAAAAA
ATCAATTTCTATTAATGGGTGTTTCAAATTTAAATACTCCCCCAAGGGGT
ATTAGGTGAACTTGAGTGGATTAAGCCTAAAATATAAAATCAATTAACTA
ACTTATAACAAATGTGTGTGTGTGTGCGCTATTAAAGCATTAACTTTTGG
TATGGTGTATTCTTCTCGTAAAGTATTGTTTCTTTCCTCGTTCG
back to top

protein sequence of SMED30003152-orf-1

>SMED30003152-orf-1 ID=SMED30003152-orf-1|Name=SMED30003152-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=309bp
MNKTISIIGGGLIGQQWAMIFTAYKSNIFVYDICDDQIKLFLISIRSYLQ
QLIDSNISRSDECVEMQLGRITVTTQFSDLPQNSDFVMECVSENVEIKQK
VFQLLDSHFNDETIRMSSSSFLPISTFTESLINKSKCIIAHPVSPPYLLR
LVEIVPASFTSDNTVLKTKQLMEEIKQIPVVFKKEIEGFGLNRIQAAVYN
SVFKLIKDDVINVEDVDKLLTEGLGPRWAFYGPLTVAALNGPGIDNYFNK
YLPGLDLLNIKQNFPPQHDQSVIERIIDETKIRNLSSIFEERNFTIGSIL
KIKLHQKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR030374PABS
IPR0061763-OHacyl-CoA_DH_NAD-bd
IPR0133286PGD_dom2
IPR0061083HC_DH_C
IPR016040NAD(P)-bd_dom
IPR0089276-PGluconate_DH-like_C_sf
Vocabulary: molecular function
TermDefinition
GO:00038573-hydroxyacyl-CoA dehydrogenase activity
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0006631fatty acid metabolic process
GO:0055114oxidation-reduction process